F373439
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 265 | 158 | 530 | 312 |
Family's Representative Sequence
| Representative Sequence | 3300031901|Ga0307406_10022206|Ga0307406_100222062 |
| Length | 335 |
| Sequence | MSLALPAGQSEPVPVEIPTMHAWTQVLPAADWRELERAHAERVRRYSDPYLARRSAGRKHPVEDFLFTYYTQKPGQLLRWHPGDGIVLTGAEAGQRSCWKYYRTLDGGELASCGLPAGSTAVALDRAAFLTARREALAFAQVILAGTAARPAQFGCFGLHEWAMVYRQDKFELRHEYLKLRLGEAGTDKVVEDSRIRCSHFDAFRFYTPDAVPLNELAPSRENQRSMEQPGCLHANMDLYKWAYKLSPALPSELVMDCFELSWRVRAMDMQASPYDLADWGYPPIRIETTEGKAAYVEQQRAFSAEAQVLRRRLLAALAPLFEPVDADRTSTELP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 2 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 3 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 4 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 5 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 11 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 12 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 13 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 14 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 15 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 16 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 17 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 18 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 19 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 20 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 21 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 22 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 23 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 24 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 25 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 26 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 27 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 28 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 29 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 30 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 31 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 32 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 33 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 34 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 35 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 36 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 37 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 38 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 39 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 40 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 41 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 42 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 43 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 44 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 45 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 46 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 47 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 48 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 49 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 50 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 51 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 52 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 53 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 54 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 55 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 56 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 57 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 58 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 59 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 60 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 61 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 62 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 63 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 64 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 65 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 66 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 67 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 68 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 69 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 70 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 71 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 72 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 73 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 74 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 75 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 76 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 77 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 78 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 79 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 80 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 81 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 82 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 83 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 84 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 85 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 86 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 87 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 88 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 89 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 90 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 91 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 92 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 93 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 94 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 95 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 96 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 97 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 98 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 99 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 100 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 101 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 102 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 103 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 104 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 105 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 106 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 107 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 108 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 109 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 110 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 111 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 112 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 113 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 114 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 115 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 116 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 117 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 118 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 119 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 120 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 121 | 2537561592 | Arthrobacter crystallopoietes BAB-32 | Isolate | Rhizosphere |
| 122 | 2690315906 | Arthrobacter sp. OY3WO11 | Isolate | Unclassified |
| 123 | 2775506735 | Arthrobacter sp. S95 1704 | Isolate | Unclassified |
| 124 | 2808606357 | Arthrobacter sp. SLBN-122 | Isolate | Unclassified |
| 125 | 2808606360 | Arthrobacter sp. SLBN-112 | Isolate | Unclassified |
| 126 | 2808606366 | Arthrobacter sp. SLBN-83 | Isolate | Unclassified |
| 127 | 2808606370 | Arthrobacter sp. SLBN-100 | Isolate | Unclassified |
| 128 | 2808606371 | Arthrobacter sp. SLBN-53 | Isolate | Unclassified |
| 129 | 2808606700 | Arthrobacter agilis UMCV2 | Isolate | Rhizosphere |
| 130 | 2811994871 | Arthrobacter sp. SLBN-179 | Isolate | Unclassified |
| 131 | 2833709550 | Microbacterium sp. 3290 | Isolate | Rhizosphere |
| 132 | 2844849076 | Arthrobacter cupressi DSM 24664 | Isolate | Rhizosphere |
| 133 | 2857740372 | Paenarthrobacter sp. R-74611 | Isolate | Unclassified |
| 134 | 2904497146 | Arthrobacter sp. 1276 | Isolate | Rhizosphere |
| 135 | 2905926851 | Arthrobacter sedimenti MIC A30 | Isolate | Rhizosphere |
| 136 | 2910809715 | Paenarthrobacter sp. CM16 | Isolate | Unclassified |
| 137 | 2919034639 | Paenarthrobacter nitroguajacolicus 247 | Isolate | Rhizosphere |
| 138 | 2919051321 | Sinomonas atrocyanea 1003 | Isolate | Rhizosphere |
| 139 | 2919059106 | Arthrobacter sp. 1088 | Isolate | Rhizosphere |
| 140 | 2919391150 | Arthrobacter ipis 2973 | Isolate | Unclassified |
| 141 | 2919538618 | Paenarthrobacter nitroguajacolicus 3945 | Isolate | Unclassified |
| 142 | 2932426870 | Paenarthrobacter sp. 4246 | Isolate | Rhizosphere |
| 143 | 2933418574 | Jeotgalibacillus campisalis 4120 | Isolate | Rhizosphere |
| 144 | 2939598168 | Arthrobacter sp. 754 | Isolate | Rhizosphere |
| 145 | 2939674588 | Arthrobacter bambusae 3552 | Isolate | Rhizosphere |
| 146 | 2945916053 | Arthrobacter ulcerisalmonis W1I2 | Isolate | Rhizosphere |
| 147 | 2945920336 | Pseudarthrobacter siccitolerans W1I3 | Isolate | Rhizosphere |
| 148 | 2945941187 | Arthrobacter pascens W1I14 | Isolate | Rhizosphere |
| 149 | 2945956166 | Arthrobacter globiformus W2I3 | Isolate | Rhizosphere |
| 150 | 2946003308 | Arthrobacter agilis W3I6 | Isolate | Rhizosphere |
| 151 | 2946024296 | Arthrobacter woluwensis W4I2 | Isolate | Rhizosphere |
| 152 | 2946059875 | Arthrobacter sp. SLBN-112 | Isolate | Rhizosphere |
| 153 | 2953998280 | Pseudarthrobacter sp. W1I19 | Isolate | Rhizosphere |
| 154 | 2974302888 | Pseudarthrobacter sp. SORGH_AS 212 | Isolate | Unclassified |
| 155 | 8004021418 | Arthrobacter sp. SDTb3-6 | Isolate | Rhizosphere |
| 156 | 8004025490 | Arthrobacter wenxiniae AETb3-4 | Isolate | Rhizosphere |
| 157 | 8054704163 | Micromonospora trifolii NIE79 | Isolate | Nodule |
| 158 | 8054727385 | Micromonospora alfalfae MED01 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 85.28 |
| Metatranscriptomes | 0.38 |
| Isolates | 14.34 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.26 |
| Nodule | 0.75 |
| Rhizoplane | 9.81 |
| Rhizosphere | 80.75 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0307406_10022206 | 3300031901 | Bacteria | 3762 |
| 2 | JGI25152J39213_1000237 | 3300002773 | Bacteria | 36982 |
| 3 | JGI25151J46595_10010465 | 3300003187 | Bacteria | 4308 |
| 4 | rootL2_10110205 | 3300003322 | Bacteria | 7368 |
| 5 | Ga0065714_10071714 | 3300005288 | Bacteria | 3507 |
| 6 | Ga0070677_10003467 | 3300005333 | Bacteria | 5087 |
| 7 | Ga0070668_100013939 | 3300005347 | Bacteria | 6011 |
| 8 | Ga0070673_100013038 | 3300005364 | Bacteria | 5733 |
| 9 | Ga0070678_100015179 | 3300005456 | Bacteria | 4888 |
| 10 | Ga0075432_10001250 | 3300006058 | Bacteria | 8185 |
| 11 | Ga0105248_10294591 | 3300009177 | Bacteria | 1827 |
| 12 | Ga0105246_10002796 | 3300011119 | Bacteria | 10563 |
| 13 | Ga0105246_10007041 | 3300011119 | Bacteria | 6883 |
| 14 | Ga0105246_10643362 | 3300011119 | Bacteria | 922 |
| 15 | Ga0157373_10077644 | 3300013100 | Bacteria | 2343 |
| 16 | Ga0157370_10002483 | 3300013104 | Bacteria | 22235 |
| 17 | Ga0157370_10119723 | 3300013104 | Bacteria | 2458 |
| 18 | Ga0157369_10288239 | 3300013105 | Bacteria | 1709 |
| 19 | Ga0163162_10020376 | 3300013306 | Bacteria | 6515 |
| 20 | Ga0163162_10545988 | 3300013306 | Bacteria | 1287 |
| 21 | Ga0157379_10139981 | 3300014968 | Bacteria | 2181 |
| 22 | Ga0163161_10197017 | 3300017792 | Bacteria | 1551 |
| 23 | Ga0207425_1010639 | 3300025245 | Bacteria | 2231 |
| 24 | Ga0209759_1004943 | 3300025256 | Bacteria | 4820 |
| 25 | Ga0209129_1000096 | 3300025258 | Bacteria | 166298 |
| 26 | Ga0209025_1002292 | 3300025294 | Bacteria | 20787 |
| 27 | Ga0209051_1017795 | 3300025303 | Bacteria | 3167 |
| 28 | Ga0207697_10001784 | 3300025315 | Bacteria | 11521 |
| 29 | Ga0207697_10024789 | 3300025315 | Bacteria | 2454 |
| 30 | Ga0207655_1001532 | 3300025728 | Bacteria | 20941 |
| 31 | Ga0207655_1006724 | 3300025728 | Bacteria | 7573 |
| 32 | Ga0207713_1054159 | 3300025735 | Bacteria | 1575 |
| 33 | Ga0207682_10001579 | 3300025893 | Bacteria | 10481 |
| 34 | Ga0207645_10005804 | 3300025907 | Bacteria | 8903 |
| 35 | Ga0207644_10152143 | 3300025931 | Bacteria | 1791 |
| 36 | Ga0207709_10069918 | 3300025935 | Bacteria | 2224 |
| 37 | Ga0207709_10077153 | 3300025935 | Bacteria | 2135 |
| 38 | Ga0207651_10019720 | 3300025960 | Bacteria | 4050 |
| 39 | Ga0207683_10018728 | 3300026121 | Bacteria | 5906 |
| 40 | Ga0307408_100009403 | 3300031548 | Bacteria | 6443 |
| 41 | Ga0307408_100016116 | 3300031548 | Bacteria | 4984 |
| 42 | Ga0307408_100040517 | 3300031548 | Bacteria | 3298 |
| 43 | Ga0307408_100043502 | 3300031548 | Bacteria | 3196 |
| 44 | Ga0307408_100044430 | 3300031548 | Bacteria | 3165 |
| 45 | Ga0307408_100050231 | 3300031548 | Bacteria | 2998 |
| 46 | Ga0307408_100054215 | 3300031548 | Bacteria | 2898 |
| 47 | Ga0307408_100109006 | 3300031548 | Bacteria | 2123 |
| 48 | Ga0307408_100127351 | 3300031548 | Bacteria | 1982 |
| 49 | Ga0307408_100129275 | 3300031548 | Bacteria | 1968 |
| 50 | Ga0307405_10015140 | 3300031731 | Bacteria | 4167 |
| 51 | Ga0307405_10021471 | 3300031731 | Bacteria | 3630 |
| 52 | Ga0307405_10030918 | 3300031731 | Bacteria | 3145 |
| 53 | Ga0307405_10062454 | 3300031731 | Bacteria | 2359 |
| 54 | Ga0307405_10070796 | 3300031731 | Bacteria | 2241 |
| 55 | Ga0307405_10162742 | 3300031731 | Bacteria | 1583 |
| 56 | Ga0307413_10003944 | 3300031824 | Bacteria | 6360 |
| 57 | Ga0307413_10017477 | 3300031824 | Bacteria | 3736 |
| 58 | Ga0307413_10022335 | 3300031824 | Bacteria | 3408 |
| 59 | Ga0307413_10189234 | 3300031824 | Bacteria | 1476 |
| 60 | Ga0307413_10195946 | 3300031824 | Bacteria | 1454 |
| 61 | Ga0307410_10022467 | 3300031852 | Bacteria | 3900 |
| 62 | Ga0307410_10220587 | 3300031852 | Bacteria | 1458 |
| 63 | Ga0307410_10343430 | 3300031852 | Bacteria | 1190 |
| 64 | Ga0307406_10008928 | 3300031901 | Bacteria | 5604 |
| 65 | Ga0307407_10022096 | 3300031903 | Bacteria | 3294 |
| 66 | Ga0307407_10029075 | 3300031903 | Bacteria | 2963 |
| 67 | Ga0307407_10038446 | 3300031903 | Bacteria | 2652 |
| 68 | Ga0307407_10182318 | 3300031903 | Bacteria | 1392 |
| 69 | Ga0307407_10238845 | 3300031903 | Bacteria | 1238 |
| 70 | Ga0307412_10074818 | 3300031911 | Bacteria | 2321 |
| 71 | Ga0307412_10076482 | 3300031911 | Bacteria | 2299 |
| 72 | Ga0307412_10076927 | 3300031911 | Bacteria | 2294 |
| 73 | Ga0307412_10176182 | 3300031911 | Bacteria | 1603 |
| 74 | Ga0307409_100023987 | 3300031995 | Bacteria | 4242 |
| 75 | Ga0307409_100026198 | 3300031995 | Bacteria | 4107 |
| 76 | Ga0307409_100066623 | 3300031995 | Bacteria | 2840 |
| 77 | Ga0307409_100277545 | 3300031995 | Bacteria | 1547 |
| 78 | Ga0307409_100337058 | 3300031995 | Bacteria | 1417 |
| 79 | Ga0307416_100011315 | 3300032002 | Bacteria | 5939 |
| 80 | Ga0307416_100044016 | 3300032002 | Bacteria | 3501 |
| 81 | Ga0307416_100082359 | 3300032002 | Bacteria | 2725 |
| 82 | Ga0307416_100090454 | 3300032002 | Bacteria | 2624 |
| 83 | Ga0307416_100113296 | 3300032002 | Bacteria | 2396 |
| 84 | Ga0307416_100188141 | 3300032002 | Bacteria | 1943 |
| 85 | Ga0307416_100205290 | 3300032002 | Bacteria | 1874 |
| 86 | Ga0307414_10041278 | 3300032004 | Bacteria | 3124 |
| 87 | Ga0307414_10229155 | 3300032004 | Bacteria | 1531 |
| 88 | Ga0307411_10042243 | 3300032005 | Bacteria | 2907 |
| 89 | Ga0307415_100043001 | 3300032126 | Bacteria | 3011 |
| 90 | Ga0307415_100067846 | 3300032126 | Bacteria | 2494 |
| 91 | Ga0307415_100125803 | 3300032126 | Bacteria | 1931 |
| 92 | Ga0307415_100171039 | 3300032126 | Bacteria | 1694 |
| 93 | Ga0395899_0011257 | 3300037312 | Bacteria | 6853 |
| 94 | Ga0395899_0032792 | 3300037312 | Bacteria | 3903 |
| 95 | Ga0395899_0070070 | 3300037312 | Bacteria | 2566 |
| 96 | Ga0395899_0079198 | 3300037312 | Bacteria | 2393 |
| 97 | Ga0395899_0130577 | 3300037312 | Bacteria | 1794 |
| 98 | Ga0395900_0043030 | 3300037418 | Bacteria | 4653 |
| 99 | Ga0395900_0088293 | 3300037418 | Bacteria | 3187 |
| 100 | Ga0395900_0153944 | 3300037418 | Bacteria | 2349 |
| 101 | Ga0395900_0267813 | 3300037418 | Bacteria | 1704 |
| 102 | Ga0395900_0313365 | 3300037418 | Bacteria | 1552 |
| 103 | Ga0395900_0577212 | 3300037418 | Bacteria | 1067 |
| 104 | Ga0395898_0008202 | 3300037466 | Bacteria | 11049 |
| 105 | Ga0395898_0012897 | 3300037466 | Bacteria | 8622 |
| 106 | Ga0395898_0054233 | 3300037466 | Bacteria | 3912 |
| 107 | Ga0395898_0055185 | 3300037466 | Bacteria | 3875 |
| 108 | Ga0395898_0075562 | 3300037466 | Bacteria | 3254 |
| 109 | Ga0395898_0151149 | 3300037466 | Bacteria | 2221 |
| 110 | Ga0395898_0192632 | 3300037466 | Bacteria | 1948 |
| 111 | Ga0395905_0020717 | 3300037471 | Bacteria | 6226 |
| 112 | Ga0395901_0035037 | 3300038443 | Bacteria | 5187 |
| 113 | Ga0395901_0043897 | 3300038443 | Bacteria | 4636 |
| 114 | Ga0395901_0070618 | 3300038443 | Bacteria | 3639 |
| 115 | Ga0395901_0152738 | 3300038443 | Bacteria | 2425 |
| 116 | Ga0395901_0218543 | 3300038443 | Bacteria | 1992 |
| 117 | Ga0395901_0267311 | 3300038443 | Bacteria | 1779 |
| 118 | Ga0436363_1238359 | 3300039450 | Bacteria | 1480 |
| 119 | Ga0439436_0000331 | 3300041404 | Bacteria | 11623 |
| 120 | Ga0439436_0008604 | 3300041404 | Bacteria | 3137 |
| 121 | Ga0439438_020595 | 3300041405 | Bacteria | 1850 |
| 122 | Ga0439439_0003643 | 3300041406 | Bacteria | 3413 |
| 123 | Ga0439466_0001956 | 3300041411 | Bacteria | 8084 |
| 124 | Ga0439465_0008627 | 3300041413 | Bacteria | 3215 |
| 125 | Ga0439433_0001202 | 3300041999 | Bacteria | 5331 |
| 126 | Ga0439433_0007568 | 3300041999 | Bacteria | 2346 |
| 127 | Ga0439433_0025421 | 3300041999 | Bacteria | 1338 |
| 128 | Ga0439442_000253 | 3300042002 | Bacteria | 13034 |
| 129 | Ga0439442_000652 | 3300042002 | Bacteria | 7378 |
| 130 | Ga0439442_000923 | 3300042002 | Bacteria | 6001 |
| 131 | Ga0439442_000992 | 3300042002 | Bacteria | 5730 |
| 132 | Ga0439442_004081 | 3300042002 | Bacteria | 2896 |
| 133 | Ga0439442_010158 | 3300042002 | Bacteria | 1907 |
| 134 | Ga0439432_005757 | 3300042006 | Bacteria | 4452 |
| 135 | Ga0439449_0001642 | 3300042007 | Bacteria | 8766 |
| 136 | Ga0439449_0014813 | 3300042007 | Bacteria | 2930 |
| 137 | Ga0439449_0031122 | 3300042007 | Bacteria | 1989 |
| 138 | Ga0439449_0051055 | 3300042007 | Bacteria | 1529 |
| 139 | Ga0439449_0053715 | 3300042007 | Bacteria | 1489 |
| 140 | Ga0439452_020043 | 3300042010 | Bacteria | 1759 |
| 141 | Ga0439457_001173 | 3300042014 | Bacteria | 7868 |
| 142 | Ga0439457_023255 | 3300042014 | Bacteria | 1371 |
| 143 | Ga0439462_0002521 | 3300042015 | Bacteria | 4266 |
| 144 | Ga0450919_003528 | 3300042121 | Bacteria | 1946 |
| 145 | Ga0450920_000740 | 3300042122 | Bacteria | 5267 |
| 146 | Ga0450920_002043 | 3300042122 | Bacteria | 3410 |
| 147 | Ga0450907_000883 | 3300042146 | Bacteria | 7175 |
| 148 | Ga0450907_008375 | 3300042146 | Bacteria | 1719 |
| 149 | Ga0450908_000573 | 3300042184 | Bacteria | 7062 |
| 150 | Ga0450909_000751 | 3300042185 | Bacteria | 4380 |
| 151 | Ga0439434_0001575 | 3300042435 | Bacteria | 6583 |
| 152 | Ga0450918_006503 | 3300042531 | Bacteria | 2081 |
| 153 | Ga0450918_011906 | 3300042531 | Bacteria | 1516 |
| 154 | Ga0495629_0054673 | 3300046459 | Bacteria | 2792 |
| 155 | Ga0495653_0011955 | 3300046463 | Bacteria | 7089 |
| 156 | Ga0495580_0089786 | 3300046472 | Bacteria | 2139 |
| 157 | Ga0495580_0109055 | 3300046472 | Bacteria | 1922 |
| 158 | Ga0495594_0082887 | 3300046499 | Bacteria | 1792 |
| 159 | Ga0495630_0036810 | 3300046517 | Bacteria | 3658 |
| 160 | Ga0495631_0019629 | 3300046518 | Bacteria | 3168 |
| 161 | Ga0495642_0027312 | 3300046528 | Bacteria | 2271 |
| 162 | Ga0495642_0040515 | 3300046528 | Bacteria | 1892 |
| 163 | Ga0495654_0097408 | 3300046530 | Bacteria | 1358 |
| 164 | Ga0495665_0004496 | 3300046531 | Bacteria | 7526 |
| 165 | Ga0495586_0003423 | 3300046535 | Bacteria | 8504 |
| 166 | Ga0495587_0002742 | 3300046536 | Bacteria | 11741 |
| 167 | Ga0495645_0001680 | 3300046543 | Bacteria | 15037 |
| 168 | Ga0495633_0059626 | 3300046558 | Bacteria | 1789 |
| 169 | Ga0495667_0000098 | 3300046559 | Bacteria | 62781 |
| 170 | Ga0495656_0001616 | 3300046615 | Bacteria | 7366 |
| 171 | Ga0495588_0037953 | 3300046674 | Bacteria | 2449 |
| 172 | Ga0495588_0074779 | 3300046674 | Bacteria | 1764 |
| 173 | Ga0495657_0038332 | 3300046675 | Bacteria | 3299 |
| 174 | Ga0495623_0122755 | 3300046679 | Bacteria | 1562 |
| 175 | Ga0495613_0171263 | 3300046689 | Bacteria | 1541 |
| 176 | Ga0495670_0000935 | 3300046691 | Bacteria | 14130 |
| 177 | Ga0495670_0006096 | 3300046691 | Bacteria | 5914 |
| 178 | Ga0495670_0095759 | 3300046691 | Bacteria | 1523 |
| 179 | Ga0495600_0003639 | 3300046809 | Bacteria | 9090 |
| 180 | Ga0495581_0016294 | 3300047315 | Bacteria | 4321 |
| 181 | Ga0495604_0226902 | 3300047317 | Bacteria | 1283 |
| 182 | Ga0495680_0030928 | 3300047322 | Bacteria | 4362 |
| 183 | Ga0495675_0009100 | 3300047444 | Bacteria | 6172 |
| 184 | Ga0495677_0055423 | 3300047445 | Bacteria | 1463 |
| 185 | Ga0495685_076592 | 3300047447 | Bacteria | 1116 |
| 186 | Ga0495684_0240511 | 3300047471 | Bacteria | 1321 |
| 187 | Ga0495615_0028138 | 3300048090 | Bacteria | 1325 |
| 188 | Ga0496100_0067694 | 3300048903 | Bacteria | 2372 |
| 189 | Ga0496100_0211531 | 3300048903 | Bacteria | 1418 |
| 190 | Ga0496101_0012205 | 3300048904 | Bacteria | 5728 |
| 191 | Ga0496102_0013659 | 3300048905 | Bacteria | 7037 |
| 192 | Ga0496102_0323010 | 3300048905 | Bacteria | 1454 |
| 193 | Ga0496102_0428895 | 3300048905 | Bacteria | 1241 |
| 194 | Ga0496103_0013983 | 3300048906 | Bacteria | 4764 |
| 195 | Ga0496103_0051521 | 3300048906 | Bacteria | 2548 |
| 196 | Ga0496103_0061310 | 3300048906 | Bacteria | 2339 |
| 197 | Ga0496103_0158207 | 3300048906 | Bacteria | 1453 |
| 198 | Ga0496105_0129001 | 3300048908 | Bacteria | 2085 |
| 199 | Ga0496106_0009246 | 3300048909 | Bacteria | 7282 |
| 200 | Ga0496106_0211381 | 3300048909 | Bacteria | 1545 |
| 201 | Ga0496108_0157333 | 3300048911 | Bacteria | 1963 |
| 202 | Ga0496109_0000380 | 3300048912 | Bacteria | 40383 |
| 203 | Ga0496109_0164389 | 3300048912 | Bacteria | 2080 |
| 204 | Ga0496110_0513119 | 3300048913 | Bacteria | 1091 |
| 205 | Ga0496110_0567674 | 3300048913 | Bacteria | 1030 |
| 206 | Ga0496111_0038683 | 3300048914 | Bacteria | 3419 |
| 207 | Ga0496111_0080580 | 3300048914 | Bacteria | 2375 |
| 208 | Ga0496112_0180068 | 3300048915 | Bacteria | 2077 |
| 209 | Ga0496112_0191778 | 3300048915 | Bacteria | 2005 |
| 210 | Ga0496113_0049351 | 3300048916 | Bacteria | 3133 |
| 211 | Ga0496113_0186610 | 3300048916 | Bacteria | 1645 |
| 212 | Ga0496114_0074628 | 3300048917 | Bacteria | 2855 |
| 213 | Ga0496115_0041464 | 3300048918 | Bacteria | 3664 |
| 214 | Ga0496124_0030134 | 3300048927 | Bacteria | 4821 |
| 215 | Ga0501032_0000340 | 3300049569 | Bacteria | 39022 |
| 216 | Ga0501032_0138967 | 3300049569 | Bacteria | 1600 |
| 217 | Ga0501034_0000057 | 3300049571 | Bacteria | 202455 |
| 218 | Ga0501036_0340719 | 3300049572 | Bacteria | 1252 |
| 219 | Ga0501037_0002741 | 3300049573 | Bacteria | 12738 |
| 220 | Ga0501037_0078453 | 3300049573 | Bacteria | 2396 |
| 221 | Ga0501037_0116550 | 3300049573 | Bacteria | 1922 |
| 222 | Ga0501038_0009141 | 3300049574 | Bacteria | 9092 |
| 223 | Ga0501038_0136511 | 3300049574 | Bacteria | 2009 |
| 224 | Ga0501039_0141494 | 3300049575 | Bacteria | 1889 |
| 225 | Ga0501043_0005462 | 3300049579 | Bacteria | 10277 |
| 226 | Ga0501043_0050843 | 3300049579 | Bacteria | 3257 |
| 227 | Ga0587090_004356 | 3300059510 | Bacteria | 1714 |
| 228 | 2537898041 | 2537561592 | Bacteria | 4348607 |
| 229 | 2691512558 | 2690315906 | Bacteria | 4517044 |
| 230 | 2775657675 | 2775506735 | Bacteria | 4556596 |
| 231 | 2808829811 | 2808606357 | Bacteria | 4466944 |
| 232 | 2808850992 | 2808606360 | Bacteria | 4404006 |
| 233 | 2808876499 | 2808606366 | Bacteria | 4415912 |
| 234 | 2808894065 | 2808606370 | Bacteria | 4942454 |
| 235 | 2808898009 | 2808606371 | Bacteria | 4251511 |
| 236 | 2810362994 | 2808606700 | Bacteria | 3482157 |
| 237 | 2812318493 | 2811994871 | Bacteria | 4497550 |
| 238 | 2833711015 | 2833709550 | Bacteria | 4008291 |
| 239 | 2844851437 | 2844849076 | Bacteria | 4091819 |
| 240 | 2857741863 | 2857740372 | Bacteria | 4782044 |
| 241 | 2904497711 | 2904497146 | Bacteria | 4731781 |
| 242 | 2905930704 | 2905926851 | Bacteria | 4423176 |
| 243 | 2910812502 | 2910809715 | Bacteria | 4982797 |
| 244 | 2919038641 | 2919034639 | Bacteria | 4763403 |
| 245 | 2919054877 | 2919051321 | Bacteria | 4210889 |
| 246 | 2919062529 | 2919059106 | Bacteria | 4991624 |
| 247 | 2919391827 | 2919391150 | Bacteria | 4884741 |
| 248 | 2919539630 | 2919538618 | Bacteria | 4677069 |
| 249 | 2932428498 | 2932426870 | Bacteria | 4547726 |
| 250 | 2933419861 | 2933418574 | Bacteria | 4476724 |
| 251 | 2939600773 | 2939598168 | Bacteria | 4687164 |
| 252 | 2939676567 | 2939674588 | Bacteria | 4844420 |
| 253 | 2945916248 | 2945916053 | Bacteria | 4555517 |
| 254 | 2945923616 | 2945920336 | Bacteria | 4501603 |
| 255 | 2945944710 | 2945941187 | Bacteria | 4682474 |
| 256 | 2945957082 | 2945956166 | Bacteria | 5110334 |
| 257 | 2946006829 | 2946003308 | Bacteria | 3857229 |
| 258 | 2946024534 | 2946024296 | Bacteria | 3508095 |
| 259 | 2946060049 | 2946059875 | Bacteria | 4386623 |
| 260 | 2954001903 | 2953998280 | Bacteria | 4812144 |
| 261 | 2974304198 | 2974302888 | Bacteria | 4369871 |
| 262 | 8004022624 | 8004021418 | Bacteria | 4313954 |
| 263 | 8004026362 | 8004025490 | Bacteria | 4327753 |
| 264 | 8054708576 | 8054704163 | Bacteria | 7247792 |
| 265 | 8054730800 | 8054727385 | Bacteria | 7558670 |
| 266 | Ga0307406_10022206 | |||
| 267 | JGI25152J39213_1000237 | |||
| 268 | JGI25151J46595_10010465 | |||
| 269 | rootL2_10110205 | |||
| 270 | Ga0065714_10071714 | |||
| 271 | Ga0070677_10003467 | |||
| 272 | Ga0070668_100013939 | |||
| 273 | Ga0070673_100013038 | |||
| 274 | Ga0070678_100015179 | |||
| 275 | Ga0075432_10001250 | |||
| 276 | Ga0105248_10294591 | |||
| 277 | Ga0105246_10002796 | |||
| 278 | Ga0105246_10007041 | |||
| 279 | Ga0105246_10643362 | |||
| 280 | Ga0157373_10077644 | |||
| 281 | Ga0157370_10002483 | |||
| 282 | Ga0157370_10119723 | |||
| 283 | Ga0157369_10288239 | |||
| 284 | Ga0163162_10020376 | |||
| 285 | Ga0163162_10545988 | |||
| 286 | Ga0157379_10139981 | |||
| 287 | Ga0163161_10197017 | |||
| 288 | Ga0207425_1010639 | |||
| 289 | Ga0209759_1004943 | |||
| 290 | Ga0209129_1000096 | |||
| 291 | Ga0209025_1002292 | |||
| 292 | Ga0209051_1017795 | |||
| 293 | Ga0207697_10001784 | |||
| 294 | Ga0207697_10024789 | |||
| 295 | Ga0207655_1001532 | |||
| 296 | Ga0207655_1006724 | |||
| 297 | Ga0207713_1054159 | |||
| 298 | Ga0207682_10001579 | |||
| 299 | Ga0207645_10005804 | |||
| 300 | Ga0207644_10152143 | |||
| 301 | Ga0207709_10069918 | |||
| 302 | Ga0207709_10077153 | |||
| 303 | Ga0207651_10019720 | |||
| 304 | Ga0207683_10018728 | |||
| 305 | Ga0307408_100009403 | |||
| 306 | Ga0307408_100016116 | |||
| 307 | Ga0307408_100040517 | |||
| 308 | Ga0307408_100043502 | |||
| 309 | Ga0307408_100044430 | |||
| 310 | Ga0307408_100050231 | |||
| 311 | Ga0307408_100054215 | |||
| 312 | Ga0307408_100109006 | |||
| 313 | Ga0307408_100127351 | |||
| 314 | Ga0307408_100129275 | |||
| 315 | Ga0307405_10015140 | |||
| 316 | Ga0307405_10021471 | |||
| 317 | Ga0307405_10030918 | |||
| 318 | Ga0307405_10062454 | |||
| 319 | Ga0307405_10070796 | |||
| 320 | Ga0307405_10162742 | |||
| 321 | Ga0307413_10003944 | |||
| 322 | Ga0307413_10017477 | |||
| 323 | Ga0307413_10022335 | |||
| 324 | Ga0307413_10189234 | |||
| 325 | Ga0307413_10195946 | |||
| 326 | Ga0307410_10022467 | |||
| 327 | Ga0307410_10220587 | |||
| 328 | Ga0307410_10343430 | |||
| 329 | Ga0307406_10008928 | |||
| 330 | Ga0307407_10022096 | |||
| 331 | Ga0307407_10029075 | |||
| 332 | Ga0307407_10038446 | |||
| 333 | Ga0307407_10182318 | |||
| 334 | Ga0307407_10238845 | |||
| 335 | Ga0307412_10074818 | |||
| 336 | Ga0307412_10076482 | |||
| 337 | Ga0307412_10076927 | |||
| 338 | Ga0307412_10176182 | |||
| 339 | Ga0307409_100023987 | |||
| 340 | Ga0307409_100026198 | |||
| 341 | Ga0307409_100066623 | |||
| 342 | Ga0307409_100277545 | |||
| 343 | Ga0307409_100337058 | |||
| 344 | Ga0307416_100011315 | |||
| 345 | Ga0307416_100044016 | |||
| 346 | Ga0307416_100082359 | |||
| 347 | Ga0307416_100090454 | |||
| 348 | Ga0307416_100113296 | |||
| 349 | Ga0307416_100188141 | |||
| 350 | Ga0307416_100205290 | |||
| 351 | Ga0307414_10041278 | |||
| 352 | Ga0307414_10229155 | |||
| 353 | Ga0307411_10042243 | |||
| 354 | Ga0307415_100043001 | |||
| 355 | Ga0307415_100067846 | |||
| 356 | Ga0307415_100125803 | |||
| 357 | Ga0307415_100171039 | |||
| 358 | Ga0395899_0011257 | |||
| 359 | Ga0395899_0032792 | |||
| 360 | Ga0395899_0070070 | |||
| 361 | Ga0395899_0079198 | |||
| 362 | Ga0395899_0130577 | |||
| 363 | Ga0395900_0043030 | |||
| 364 | Ga0395900_0088293 | |||
| 365 | Ga0395900_0153944 | |||
| 366 | Ga0395900_0267813 | |||
| 367 | Ga0395900_0313365 | |||
| 368 | Ga0395900_0577212 | |||
| 369 | Ga0395898_0008202 | |||
| 370 | Ga0395898_0012897 | |||
| 371 | Ga0395898_0054233 | |||
| 372 | Ga0395898_0055185 | |||
| 373 | Ga0395898_0075562 | |||
| 374 | Ga0395898_0151149 | |||
| 375 | Ga0395898_0192632 | |||
| 376 | Ga0395905_0020717 | |||
| 377 | Ga0395901_0035037 | |||
| 378 | Ga0395901_0043897 | |||
| 379 | Ga0395901_0070618 | |||
| 380 | Ga0395901_0152738 | |||
| 381 | Ga0395901_0218543 | |||
| 382 | Ga0395901_0267311 | |||
| 383 | Ga0436363_1238359 | |||
| 384 | Ga0439436_0000331 | |||
| 385 | Ga0439436_0008604 | |||
| 386 | Ga0439438_020595 | |||
| 387 | Ga0439439_0003643 | |||
| 388 | Ga0439466_0001956 | |||
| 389 | Ga0439465_0008627 | |||
| 390 | Ga0439433_0001202 | |||
| 391 | Ga0439433_0007568 | |||
| 392 | Ga0439433_0025421 | |||
| 393 | Ga0439442_000253 | |||
| 394 | Ga0439442_000652 | |||
| 395 | Ga0439442_000923 | |||
| 396 | Ga0439442_000992 | |||
| 397 | Ga0439442_004081 | |||
| 398 | Ga0439442_010158 | |||
| 399 | Ga0439432_005757 | |||
| 400 | Ga0439449_0001642 | |||
| 401 | Ga0439449_0014813 | |||
| 402 | Ga0439449_0031122 | |||
| 403 | Ga0439449_0051055 | |||
| 404 | Ga0439449_0053715 | |||
| 405 | Ga0439452_020043 | |||
| 406 | Ga0439457_001173 | |||
| 407 | Ga0439457_023255 | |||
| 408 | Ga0439462_0002521 | |||
| 409 | Ga0450919_003528 | |||
| 410 | Ga0450920_000740 | |||
| 411 | Ga0450920_002043 | |||
| 412 | Ga0450907_000883 | |||
| 413 | Ga0450907_008375 | |||
| 414 | Ga0450908_000573 | |||
| 415 | Ga0450909_000751 | |||
| 416 | Ga0439434_0001575 | |||
| 417 | Ga0450918_006503 | |||
| 418 | Ga0450918_011906 | |||
| 419 | Ga0495629_0054673 | |||
| 420 | Ga0495653_0011955 | |||
| 421 | Ga0495580_0089786 | |||
| 422 | Ga0495580_0109055 | |||
| 423 | Ga0495594_0082887 | |||
| 424 | Ga0495630_0036810 | |||
| 425 | Ga0495631_0019629 | |||
| 426 | Ga0495642_0027312 | |||
| 427 | Ga0495642_0040515 | |||
| 428 | Ga0495654_0097408 | |||
| 429 | Ga0495665_0004496 | |||
| 430 | Ga0495586_0003423 | |||
| 431 | Ga0495587_0002742 | |||
| 432 | Ga0495645_0001680 | |||
| 433 | Ga0495633_0059626 | |||
| 434 | Ga0495667_0000098 | |||
| 435 | Ga0495656_0001616 | |||
| 436 | Ga0495588_0037953 | |||
| 437 | Ga0495588_0074779 | |||
| 438 | Ga0495657_0038332 | |||
| 439 | Ga0495623_0122755 | |||
| 440 | Ga0495613_0171263 | |||
| 441 | Ga0495670_0000935 | |||
| 442 | Ga0495670_0006096 | |||
| 443 | Ga0495670_0095759 | |||
| 444 | Ga0495600_0003639 | |||
| 445 | Ga0495581_0016294 | |||
| 446 | Ga0495604_0226902 | |||
| 447 | Ga0495680_0030928 | |||
| 448 | Ga0495675_0009100 | |||
| 449 | Ga0495677_0055423 | |||
| 450 | Ga0495685_076592 | |||
| 451 | Ga0495684_0240511 | |||
| 452 | Ga0495615_0028138 | |||
| 453 | Ga0496100_0067694 | |||
| 454 | Ga0496100_0211531 | |||
| 455 | Ga0496101_0012205 | |||
| 456 | Ga0496102_0013659 | |||
| 457 | Ga0496102_0323010 | |||
| 458 | Ga0496102_0428895 | |||
| 459 | Ga0496103_0013983 | |||
| 460 | Ga0496103_0051521 | |||
| 461 | Ga0496103_0061310 | |||
| 462 | Ga0496103_0158207 | |||
| 463 | Ga0496105_0129001 | |||
| 464 | Ga0496106_0009246 | |||
| 465 | Ga0496106_0211381 | |||
| 466 | Ga0496108_0157333 | |||
| 467 | Ga0496109_0000380 | |||
| 468 | Ga0496109_0164389 | |||
| 469 | Ga0496110_0513119 | |||
| 470 | Ga0496110_0567674 | |||
| 471 | Ga0496111_0038683 | |||
| 472 | Ga0496111_0080580 | |||
| 473 | Ga0496112_0180068 | |||
| 474 | Ga0496112_0191778 | |||
| 475 | Ga0496113_0049351 | |||
| 476 | Ga0496113_0186610 | |||
| 477 | Ga0496114_0074628 | |||
| 478 | Ga0496115_0041464 | |||
| 479 | Ga0496124_0030134 | |||
| 480 | Ga0501032_0000340 | |||
| 481 | Ga0501032_0138967 | |||
| 482 | Ga0501034_0000057 | |||
| 483 | Ga0501036_0340719 | |||
| 484 | Ga0501037_0002741 | |||
| 485 | Ga0501037_0078453 | |||
| 486 | Ga0501037_0116550 | |||
| 487 | Ga0501038_0009141 | |||
| 488 | Ga0501038_0136511 | |||
| 489 | Ga0501039_0141494 | |||
| 490 | Ga0501043_0005462 | |||
| 491 | Ga0501043_0050843 | |||
| 492 | Ga0587090_004356 | |||
| 493 | 2537898041 | |||
| 494 | 2691512558 | |||
| 495 | 2775657675 | |||
| 496 | 2808829811 | |||
| 497 | 2808850992 | |||
| 498 | 2808876499 | |||
| 499 | 2808894065 | |||
| 500 | 2808898009 | |||
| 501 | 2810362994 | |||
| 502 | 2812318493 | |||
| 503 | 2833711015 | |||
| 504 | 2844851437 | |||
| 505 | 2857741863 | |||
| 506 | 2904497711 | |||
| 507 | 2905930704 | |||
| 508 | 2910812502 | |||
| 509 | 2919038641 | |||
| 510 | 2919054877 | |||
| 511 | 2919062529 | |||
| 512 | 2919391827 | |||
| 513 | 2919539630 | |||
| 514 | 2932428498 | |||
| 515 | 2933419861 | |||
| 516 | 2939600773 | |||
| 517 | 2939676567 | |||
| 518 | 2945916248 | |||
| 519 | 2945923616 | |||
| 520 | 2945944710 | |||
| 521 | 2945957082 | |||
| 522 | 2946006829 | |||
| 523 | 2946024534 | |||
| 524 | 2946060049 | |||
| 525 | 2954001903 | |||
| 526 | 2974304198 | |||
| 527 | 8004022624 | |||
| 528 | 8004026362 | |||
| 529 | 8054708576 | |||
| 530 | 8054730800 |
Family Sequences
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3kav-assembly1.cif.gz_A | crystal structure of the mutant (l80m) pa2107 protein from pseudomonas aeruginosa, northeast structural genomics consortium target par198 | 0.409 | 172 | 260 |
| 3kaw-assembly1.cif.gz_A | crystal structure of pa2107 protein from pseudomonas aeruginosa, northeast structural genomics consortium target par198 | 0.4036 | 172 | 260 |
| 4qh4-assembly1.cif.gz_B | the glic pentameric ligand-gated ion channel (wild-type) crystallized in acetate buffer at ph3 | 0.3693 | 58 | 264 |
| 3kaw-assembly1.cif.gz_A | crystal structure of pa2107 protein from pseudomonas aeruginosa, northeast structural genomics consortium target par198 | 0.365 | 172 | 260 |
| 6f0j-assembly1.cif.gz_A | glic mutant e26a | 0.363 | 58 | 264 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A1D8PQ93_287_481_1.20.1070.10 | Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins | 0.5018 | 172 | 269 | 1.20.1070.10 |
| 1sziA02 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Flagellar protein FliS | 0.4336 | 65 | 258 | 1.20.120.340 |
| af_Q61140_453_614_1.20.120.830 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Serine-rich domain | 0.4206 | 75 | 257 | 1.20.120.830 |
| af_G3V9U5_1_118_1.20.1070.10 | Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins | 0.4188 | 140 | 257 | 1.20.1070.10 |
| 3kawC00 | Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2; | 0.4147 | 172 | 260 | 1.20.1270.360 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0Q7K8S7-F1-model_v4 | Uncharacterized protein | 0.9858 | 175 | 262 |
|
| AF-A0A073AY53-F1-model_v4 | Uncharacterized protein | 0.9639 | 179 | 263 |
|
| AF-A0A378WQR5-F1-model_v4 | 3-methyladenine DNA glycosylase | 0.9574 | 177 | 262 |
|
| AF-A0A5N5EAZ7-F1-model_v4 | 3-methyladenine DNA glycosylase | 0.9568 | 168 | 262 |
|
| AF-A0A7Y9RU97-F1-model_v4 | Uncharacterized protein | 0.9546 | 177 | 262 |
|