F373439

General Info

Members Datasets Scaffolds Average Seq Length
265 158 530 312

Family's Representative Sequence

Representative Sequence 3300031901|Ga0307406_10022206|Ga0307406_100222062
Length 335
Sequence MSLALPAGQSEPVPVEIPTMHAWTQVLPAADWRELERAHAERVRRYSDPYLARRSAGRKHPVEDFLFTYYTQKPGQLLRWHPGDGIVLTGAEAGQRSCWKYYRTLDGGELASCGLPAGSTAVALDRAAFLTARREALAFAQVILAGTAARPAQFGCFGLHEWAMVYRQDKFELRHEYLKLRLGEAGTDKVVEDSRIRCSHFDAFRFYTPDAVPLNELAPSRENQRSMEQPGCLHANMDLYKWAYKLSPALPSELVMDCFELSWRVRAMDMQASPYDLADWGYPPIRIETTEGKAAYVEQQRAFSAEAQVLRRRLLAALAPLFEPVDADRTSTELP

Samples

Sample ID Description Type Environment
1 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
2 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
9 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
10 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
11 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
12 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
13 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
14 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
15 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
16 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
17 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
18 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
19 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
20 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
21 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
22 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
23 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
24 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
34 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
35 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
36 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
37 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
38 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
39 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
40 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
41 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
42 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
43 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
44 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
45 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
46 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
47 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
48 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
49 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
50 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
51 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
52 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
53 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
54 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
55 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
56 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
57 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
58 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
59 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
60 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
61 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
62 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
63 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
64 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
65 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
66 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
67 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
68 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
69 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
70 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
71 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
72 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
73 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
74 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
75 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
76 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
77 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
78 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
79 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
80 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
81 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
82 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
83 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
84 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
85 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
86 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
87 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
88 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
89 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
90 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
91 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
92 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
93 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
94 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
95 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
96 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
97 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
98 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
99 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
100 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
101 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
102 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
103 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
104 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
105 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
106 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
107 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
108 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
109 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
110 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
111 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
112 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
113 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
120 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
121 2537561592 Arthrobacter crystallopoietes BAB-32 Isolate Rhizosphere
122 2690315906 Arthrobacter sp. OY3WO11 Isolate Unclassified
123 2775506735 Arthrobacter sp. S95 1704 Isolate Unclassified
124 2808606357 Arthrobacter sp. SLBN-122 Isolate Unclassified
125 2808606360 Arthrobacter sp. SLBN-112 Isolate Unclassified
126 2808606366 Arthrobacter sp. SLBN-83 Isolate Unclassified
127 2808606370 Arthrobacter sp. SLBN-100 Isolate Unclassified
128 2808606371 Arthrobacter sp. SLBN-53 Isolate Unclassified
129 2808606700 Arthrobacter agilis UMCV2 Isolate Rhizosphere
130 2811994871 Arthrobacter sp. SLBN-179 Isolate Unclassified
131 2833709550 Microbacterium sp. 3290 Isolate Rhizosphere
132 2844849076 Arthrobacter cupressi DSM 24664 Isolate Rhizosphere
133 2857740372 Paenarthrobacter sp. R-74611 Isolate Unclassified
134 2904497146 Arthrobacter sp. 1276 Isolate Rhizosphere
135 2905926851 Arthrobacter sedimenti MIC A30 Isolate Rhizosphere
136 2910809715 Paenarthrobacter sp. CM16 Isolate Unclassified
137 2919034639 Paenarthrobacter nitroguajacolicus 247 Isolate Rhizosphere
138 2919051321 Sinomonas atrocyanea 1003 Isolate Rhizosphere
139 2919059106 Arthrobacter sp. 1088 Isolate Rhizosphere
140 2919391150 Arthrobacter ipis 2973 Isolate Unclassified
141 2919538618 Paenarthrobacter nitroguajacolicus 3945 Isolate Unclassified
142 2932426870 Paenarthrobacter sp. 4246 Isolate Rhizosphere
143 2933418574 Jeotgalibacillus campisalis 4120 Isolate Rhizosphere
144 2939598168 Arthrobacter sp. 754 Isolate Rhizosphere
145 2939674588 Arthrobacter bambusae 3552 Isolate Rhizosphere
146 2945916053 Arthrobacter ulcerisalmonis W1I2 Isolate Rhizosphere
147 2945920336 Pseudarthrobacter siccitolerans W1I3 Isolate Rhizosphere
148 2945941187 Arthrobacter pascens W1I14 Isolate Rhizosphere
149 2945956166 Arthrobacter globiformus W2I3 Isolate Rhizosphere
150 2946003308 Arthrobacter agilis W3I6 Isolate Rhizosphere
151 2946024296 Arthrobacter woluwensis W4I2 Isolate Rhizosphere
152 2946059875 Arthrobacter sp. SLBN-112 Isolate Rhizosphere
153 2953998280 Pseudarthrobacter sp. W1I19 Isolate Rhizosphere
154 2974302888 Pseudarthrobacter sp. SORGH_AS 212 Isolate Unclassified
155 8004021418 Arthrobacter sp. SDTb3-6 Isolate Rhizosphere
156 8004025490 Arthrobacter wenxiniae AETb3-4 Isolate Rhizosphere
157 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
158 8054727385 Micromonospora alfalfae MED01 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 85.28
Metatranscriptomes 0.38
Isolates 14.34

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.26
Nodule 0.75
Rhizoplane 9.81
Rhizosphere 80.75
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307406_10022206 3300031901 Bacteria 3762
2 JGI25152J39213_1000237 3300002773 Bacteria 36982
3 JGI25151J46595_10010465 3300003187 Bacteria 4308
4 rootL2_10110205 3300003322 Bacteria 7368
5 Ga0065714_10071714 3300005288 Bacteria 3507
6 Ga0070677_10003467 3300005333 Bacteria 5087
7 Ga0070668_100013939 3300005347 Bacteria 6011
8 Ga0070673_100013038 3300005364 Bacteria 5733
9 Ga0070678_100015179 3300005456 Bacteria 4888
10 Ga0075432_10001250 3300006058 Bacteria 8185
11 Ga0105248_10294591 3300009177 Bacteria 1827
12 Ga0105246_10002796 3300011119 Bacteria 10563
13 Ga0105246_10007041 3300011119 Bacteria 6883
14 Ga0105246_10643362 3300011119 Bacteria 922
15 Ga0157373_10077644 3300013100 Bacteria 2343
16 Ga0157370_10002483 3300013104 Bacteria 22235
17 Ga0157370_10119723 3300013104 Bacteria 2458
18 Ga0157369_10288239 3300013105 Bacteria 1709
19 Ga0163162_10020376 3300013306 Bacteria 6515
20 Ga0163162_10545988 3300013306 Bacteria 1287
21 Ga0157379_10139981 3300014968 Bacteria 2181
22 Ga0163161_10197017 3300017792 Bacteria 1551
23 Ga0207425_1010639 3300025245 Bacteria 2231
24 Ga0209759_1004943 3300025256 Bacteria 4820
25 Ga0209129_1000096 3300025258 Bacteria 166298
26 Ga0209025_1002292 3300025294 Bacteria 20787
27 Ga0209051_1017795 3300025303 Bacteria 3167
28 Ga0207697_10001784 3300025315 Bacteria 11521
29 Ga0207697_10024789 3300025315 Bacteria 2454
30 Ga0207655_1001532 3300025728 Bacteria 20941
31 Ga0207655_1006724 3300025728 Bacteria 7573
32 Ga0207713_1054159 3300025735 Bacteria 1575
33 Ga0207682_10001579 3300025893 Bacteria 10481
34 Ga0207645_10005804 3300025907 Bacteria 8903
35 Ga0207644_10152143 3300025931 Bacteria 1791
36 Ga0207709_10069918 3300025935 Bacteria 2224
37 Ga0207709_10077153 3300025935 Bacteria 2135
38 Ga0207651_10019720 3300025960 Bacteria 4050
39 Ga0207683_10018728 3300026121 Bacteria 5906
40 Ga0307408_100009403 3300031548 Bacteria 6443
41 Ga0307408_100016116 3300031548 Bacteria 4984
42 Ga0307408_100040517 3300031548 Bacteria 3298
43 Ga0307408_100043502 3300031548 Bacteria 3196
44 Ga0307408_100044430 3300031548 Bacteria 3165
45 Ga0307408_100050231 3300031548 Bacteria 2998
46 Ga0307408_100054215 3300031548 Bacteria 2898
47 Ga0307408_100109006 3300031548 Bacteria 2123
48 Ga0307408_100127351 3300031548 Bacteria 1982
49 Ga0307408_100129275 3300031548 Bacteria 1968
50 Ga0307405_10015140 3300031731 Bacteria 4167
51 Ga0307405_10021471 3300031731 Bacteria 3630
52 Ga0307405_10030918 3300031731 Bacteria 3145
53 Ga0307405_10062454 3300031731 Bacteria 2359
54 Ga0307405_10070796 3300031731 Bacteria 2241
55 Ga0307405_10162742 3300031731 Bacteria 1583
56 Ga0307413_10003944 3300031824 Bacteria 6360
57 Ga0307413_10017477 3300031824 Bacteria 3736
58 Ga0307413_10022335 3300031824 Bacteria 3408
59 Ga0307413_10189234 3300031824 Bacteria 1476
60 Ga0307413_10195946 3300031824 Bacteria 1454
61 Ga0307410_10022467 3300031852 Bacteria 3900
62 Ga0307410_10220587 3300031852 Bacteria 1458
63 Ga0307410_10343430 3300031852 Bacteria 1190
64 Ga0307406_10008928 3300031901 Bacteria 5604
65 Ga0307407_10022096 3300031903 Bacteria 3294
66 Ga0307407_10029075 3300031903 Bacteria 2963
67 Ga0307407_10038446 3300031903 Bacteria 2652
68 Ga0307407_10182318 3300031903 Bacteria 1392
69 Ga0307407_10238845 3300031903 Bacteria 1238
70 Ga0307412_10074818 3300031911 Bacteria 2321
71 Ga0307412_10076482 3300031911 Bacteria 2299
72 Ga0307412_10076927 3300031911 Bacteria 2294
73 Ga0307412_10176182 3300031911 Bacteria 1603
74 Ga0307409_100023987 3300031995 Bacteria 4242
75 Ga0307409_100026198 3300031995 Bacteria 4107
76 Ga0307409_100066623 3300031995 Bacteria 2840
77 Ga0307409_100277545 3300031995 Bacteria 1547
78 Ga0307409_100337058 3300031995 Bacteria 1417
79 Ga0307416_100011315 3300032002 Bacteria 5939
80 Ga0307416_100044016 3300032002 Bacteria 3501
81 Ga0307416_100082359 3300032002 Bacteria 2725
82 Ga0307416_100090454 3300032002 Bacteria 2624
83 Ga0307416_100113296 3300032002 Bacteria 2396
84 Ga0307416_100188141 3300032002 Bacteria 1943
85 Ga0307416_100205290 3300032002 Bacteria 1874
86 Ga0307414_10041278 3300032004 Bacteria 3124
87 Ga0307414_10229155 3300032004 Bacteria 1531
88 Ga0307411_10042243 3300032005 Bacteria 2907
89 Ga0307415_100043001 3300032126 Bacteria 3011
90 Ga0307415_100067846 3300032126 Bacteria 2494
91 Ga0307415_100125803 3300032126 Bacteria 1931
92 Ga0307415_100171039 3300032126 Bacteria 1694
93 Ga0395899_0011257 3300037312 Bacteria 6853
94 Ga0395899_0032792 3300037312 Bacteria 3903
95 Ga0395899_0070070 3300037312 Bacteria 2566
96 Ga0395899_0079198 3300037312 Bacteria 2393
97 Ga0395899_0130577 3300037312 Bacteria 1794
98 Ga0395900_0043030 3300037418 Bacteria 4653
99 Ga0395900_0088293 3300037418 Bacteria 3187
100 Ga0395900_0153944 3300037418 Bacteria 2349
101 Ga0395900_0267813 3300037418 Bacteria 1704
102 Ga0395900_0313365 3300037418 Bacteria 1552
103 Ga0395900_0577212 3300037418 Bacteria 1067
104 Ga0395898_0008202 3300037466 Bacteria 11049
105 Ga0395898_0012897 3300037466 Bacteria 8622
106 Ga0395898_0054233 3300037466 Bacteria 3912
107 Ga0395898_0055185 3300037466 Bacteria 3875
108 Ga0395898_0075562 3300037466 Bacteria 3254
109 Ga0395898_0151149 3300037466 Bacteria 2221
110 Ga0395898_0192632 3300037466 Bacteria 1948
111 Ga0395905_0020717 3300037471 Bacteria 6226
112 Ga0395901_0035037 3300038443 Bacteria 5187
113 Ga0395901_0043897 3300038443 Bacteria 4636
114 Ga0395901_0070618 3300038443 Bacteria 3639
115 Ga0395901_0152738 3300038443 Bacteria 2425
116 Ga0395901_0218543 3300038443 Bacteria 1992
117 Ga0395901_0267311 3300038443 Bacteria 1779
118 Ga0436363_1238359 3300039450 Bacteria 1480
119 Ga0439436_0000331 3300041404 Bacteria 11623
120 Ga0439436_0008604 3300041404 Bacteria 3137
121 Ga0439438_020595 3300041405 Bacteria 1850
122 Ga0439439_0003643 3300041406 Bacteria 3413
123 Ga0439466_0001956 3300041411 Bacteria 8084
124 Ga0439465_0008627 3300041413 Bacteria 3215
125 Ga0439433_0001202 3300041999 Bacteria 5331
126 Ga0439433_0007568 3300041999 Bacteria 2346
127 Ga0439433_0025421 3300041999 Bacteria 1338
128 Ga0439442_000253 3300042002 Bacteria 13034
129 Ga0439442_000652 3300042002 Bacteria 7378
130 Ga0439442_000923 3300042002 Bacteria 6001
131 Ga0439442_000992 3300042002 Bacteria 5730
132 Ga0439442_004081 3300042002 Bacteria 2896
133 Ga0439442_010158 3300042002 Bacteria 1907
134 Ga0439432_005757 3300042006 Bacteria 4452
135 Ga0439449_0001642 3300042007 Bacteria 8766
136 Ga0439449_0014813 3300042007 Bacteria 2930
137 Ga0439449_0031122 3300042007 Bacteria 1989
138 Ga0439449_0051055 3300042007 Bacteria 1529
139 Ga0439449_0053715 3300042007 Bacteria 1489
140 Ga0439452_020043 3300042010 Bacteria 1759
141 Ga0439457_001173 3300042014 Bacteria 7868
142 Ga0439457_023255 3300042014 Bacteria 1371
143 Ga0439462_0002521 3300042015 Bacteria 4266
144 Ga0450919_003528 3300042121 Bacteria 1946
145 Ga0450920_000740 3300042122 Bacteria 5267
146 Ga0450920_002043 3300042122 Bacteria 3410
147 Ga0450907_000883 3300042146 Bacteria 7175
148 Ga0450907_008375 3300042146 Bacteria 1719
149 Ga0450908_000573 3300042184 Bacteria 7062
150 Ga0450909_000751 3300042185 Bacteria 4380
151 Ga0439434_0001575 3300042435 Bacteria 6583
152 Ga0450918_006503 3300042531 Bacteria 2081
153 Ga0450918_011906 3300042531 Bacteria 1516
154 Ga0495629_0054673 3300046459 Bacteria 2792
155 Ga0495653_0011955 3300046463 Bacteria 7089
156 Ga0495580_0089786 3300046472 Bacteria 2139
157 Ga0495580_0109055 3300046472 Bacteria 1922
158 Ga0495594_0082887 3300046499 Bacteria 1792
159 Ga0495630_0036810 3300046517 Bacteria 3658
160 Ga0495631_0019629 3300046518 Bacteria 3168
161 Ga0495642_0027312 3300046528 Bacteria 2271
162 Ga0495642_0040515 3300046528 Bacteria 1892
163 Ga0495654_0097408 3300046530 Bacteria 1358
164 Ga0495665_0004496 3300046531 Bacteria 7526
165 Ga0495586_0003423 3300046535 Bacteria 8504
166 Ga0495587_0002742 3300046536 Bacteria 11741
167 Ga0495645_0001680 3300046543 Bacteria 15037
168 Ga0495633_0059626 3300046558 Bacteria 1789
169 Ga0495667_0000098 3300046559 Bacteria 62781
170 Ga0495656_0001616 3300046615 Bacteria 7366
171 Ga0495588_0037953 3300046674 Bacteria 2449
172 Ga0495588_0074779 3300046674 Bacteria 1764
173 Ga0495657_0038332 3300046675 Bacteria 3299
174 Ga0495623_0122755 3300046679 Bacteria 1562
175 Ga0495613_0171263 3300046689 Bacteria 1541
176 Ga0495670_0000935 3300046691 Bacteria 14130
177 Ga0495670_0006096 3300046691 Bacteria 5914
178 Ga0495670_0095759 3300046691 Bacteria 1523
179 Ga0495600_0003639 3300046809 Bacteria 9090
180 Ga0495581_0016294 3300047315 Bacteria 4321
181 Ga0495604_0226902 3300047317 Bacteria 1283
182 Ga0495680_0030928 3300047322 Bacteria 4362
183 Ga0495675_0009100 3300047444 Bacteria 6172
184 Ga0495677_0055423 3300047445 Bacteria 1463
185 Ga0495685_076592 3300047447 Bacteria 1116
186 Ga0495684_0240511 3300047471 Bacteria 1321
187 Ga0495615_0028138 3300048090 Bacteria 1325
188 Ga0496100_0067694 3300048903 Bacteria 2372
189 Ga0496100_0211531 3300048903 Bacteria 1418
190 Ga0496101_0012205 3300048904 Bacteria 5728
191 Ga0496102_0013659 3300048905 Bacteria 7037
192 Ga0496102_0323010 3300048905 Bacteria 1454
193 Ga0496102_0428895 3300048905 Bacteria 1241
194 Ga0496103_0013983 3300048906 Bacteria 4764
195 Ga0496103_0051521 3300048906 Bacteria 2548
196 Ga0496103_0061310 3300048906 Bacteria 2339
197 Ga0496103_0158207 3300048906 Bacteria 1453
198 Ga0496105_0129001 3300048908 Bacteria 2085
199 Ga0496106_0009246 3300048909 Bacteria 7282
200 Ga0496106_0211381 3300048909 Bacteria 1545
201 Ga0496108_0157333 3300048911 Bacteria 1963
202 Ga0496109_0000380 3300048912 Bacteria 40383
203 Ga0496109_0164389 3300048912 Bacteria 2080
204 Ga0496110_0513119 3300048913 Bacteria 1091
205 Ga0496110_0567674 3300048913 Bacteria 1030
206 Ga0496111_0038683 3300048914 Bacteria 3419
207 Ga0496111_0080580 3300048914 Bacteria 2375
208 Ga0496112_0180068 3300048915 Bacteria 2077
209 Ga0496112_0191778 3300048915 Bacteria 2005
210 Ga0496113_0049351 3300048916 Bacteria 3133
211 Ga0496113_0186610 3300048916 Bacteria 1645
212 Ga0496114_0074628 3300048917 Bacteria 2855
213 Ga0496115_0041464 3300048918 Bacteria 3664
214 Ga0496124_0030134 3300048927 Bacteria 4821
215 Ga0501032_0000340 3300049569 Bacteria 39022
216 Ga0501032_0138967 3300049569 Bacteria 1600
217 Ga0501034_0000057 3300049571 Bacteria 202455
218 Ga0501036_0340719 3300049572 Bacteria 1252
219 Ga0501037_0002741 3300049573 Bacteria 12738
220 Ga0501037_0078453 3300049573 Bacteria 2396
221 Ga0501037_0116550 3300049573 Bacteria 1922
222 Ga0501038_0009141 3300049574 Bacteria 9092
223 Ga0501038_0136511 3300049574 Bacteria 2009
224 Ga0501039_0141494 3300049575 Bacteria 1889
225 Ga0501043_0005462 3300049579 Bacteria 10277
226 Ga0501043_0050843 3300049579 Bacteria 3257
227 Ga0587090_004356 3300059510 Bacteria 1714
228 2537898041 2537561592 Bacteria 4348607
229 2691512558 2690315906 Bacteria 4517044
230 2775657675 2775506735 Bacteria 4556596
231 2808829811 2808606357 Bacteria 4466944
232 2808850992 2808606360 Bacteria 4404006
233 2808876499 2808606366 Bacteria 4415912
234 2808894065 2808606370 Bacteria 4942454
235 2808898009 2808606371 Bacteria 4251511
236 2810362994 2808606700 Bacteria 3482157
237 2812318493 2811994871 Bacteria 4497550
238 2833711015 2833709550 Bacteria 4008291
239 2844851437 2844849076 Bacteria 4091819
240 2857741863 2857740372 Bacteria 4782044
241 2904497711 2904497146 Bacteria 4731781
242 2905930704 2905926851 Bacteria 4423176
243 2910812502 2910809715 Bacteria 4982797
244 2919038641 2919034639 Bacteria 4763403
245 2919054877 2919051321 Bacteria 4210889
246 2919062529 2919059106 Bacteria 4991624
247 2919391827 2919391150 Bacteria 4884741
248 2919539630 2919538618 Bacteria 4677069
249 2932428498 2932426870 Bacteria 4547726
250 2933419861 2933418574 Bacteria 4476724
251 2939600773 2939598168 Bacteria 4687164
252 2939676567 2939674588 Bacteria 4844420
253 2945916248 2945916053 Bacteria 4555517
254 2945923616 2945920336 Bacteria 4501603
255 2945944710 2945941187 Bacteria 4682474
256 2945957082 2945956166 Bacteria 5110334
257 2946006829 2946003308 Bacteria 3857229
258 2946024534 2946024296 Bacteria 3508095
259 2946060049 2946059875 Bacteria 4386623
260 2954001903 2953998280 Bacteria 4812144
261 2974304198 2974302888 Bacteria 4369871
262 8004022624 8004021418 Bacteria 4313954
263 8004026362 8004025490 Bacteria 4327753
264 8054708576 8054704163 Bacteria 7247792
265 8054730800 8054727385 Bacteria 7558670
266 Ga0307406_10022206
267 JGI25152J39213_1000237
268 JGI25151J46595_10010465
269 rootL2_10110205
270 Ga0065714_10071714
271 Ga0070677_10003467
272 Ga0070668_100013939
273 Ga0070673_100013038
274 Ga0070678_100015179
275 Ga0075432_10001250
276 Ga0105248_10294591
277 Ga0105246_10002796
278 Ga0105246_10007041
279 Ga0105246_10643362
280 Ga0157373_10077644
281 Ga0157370_10002483
282 Ga0157370_10119723
283 Ga0157369_10288239
284 Ga0163162_10020376
285 Ga0163162_10545988
286 Ga0157379_10139981
287 Ga0163161_10197017
288 Ga0207425_1010639
289 Ga0209759_1004943
290 Ga0209129_1000096
291 Ga0209025_1002292
292 Ga0209051_1017795
293 Ga0207697_10001784
294 Ga0207697_10024789
295 Ga0207655_1001532
296 Ga0207655_1006724
297 Ga0207713_1054159
298 Ga0207682_10001579
299 Ga0207645_10005804
300 Ga0207644_10152143
301 Ga0207709_10069918
302 Ga0207709_10077153
303 Ga0207651_10019720
304 Ga0207683_10018728
305 Ga0307408_100009403
306 Ga0307408_100016116
307 Ga0307408_100040517
308 Ga0307408_100043502
309 Ga0307408_100044430
310 Ga0307408_100050231
311 Ga0307408_100054215
312 Ga0307408_100109006
313 Ga0307408_100127351
314 Ga0307408_100129275
315 Ga0307405_10015140
316 Ga0307405_10021471
317 Ga0307405_10030918
318 Ga0307405_10062454
319 Ga0307405_10070796
320 Ga0307405_10162742
321 Ga0307413_10003944
322 Ga0307413_10017477
323 Ga0307413_10022335
324 Ga0307413_10189234
325 Ga0307413_10195946
326 Ga0307410_10022467
327 Ga0307410_10220587
328 Ga0307410_10343430
329 Ga0307406_10008928
330 Ga0307407_10022096
331 Ga0307407_10029075
332 Ga0307407_10038446
333 Ga0307407_10182318
334 Ga0307407_10238845
335 Ga0307412_10074818
336 Ga0307412_10076482
337 Ga0307412_10076927
338 Ga0307412_10176182
339 Ga0307409_100023987
340 Ga0307409_100026198
341 Ga0307409_100066623
342 Ga0307409_100277545
343 Ga0307409_100337058
344 Ga0307416_100011315
345 Ga0307416_100044016
346 Ga0307416_100082359
347 Ga0307416_100090454
348 Ga0307416_100113296
349 Ga0307416_100188141
350 Ga0307416_100205290
351 Ga0307414_10041278
352 Ga0307414_10229155
353 Ga0307411_10042243
354 Ga0307415_100043001
355 Ga0307415_100067846
356 Ga0307415_100125803
357 Ga0307415_100171039
358 Ga0395899_0011257
359 Ga0395899_0032792
360 Ga0395899_0070070
361 Ga0395899_0079198
362 Ga0395899_0130577
363 Ga0395900_0043030
364 Ga0395900_0088293
365 Ga0395900_0153944
366 Ga0395900_0267813
367 Ga0395900_0313365
368 Ga0395900_0577212
369 Ga0395898_0008202
370 Ga0395898_0012897
371 Ga0395898_0054233
372 Ga0395898_0055185
373 Ga0395898_0075562
374 Ga0395898_0151149
375 Ga0395898_0192632
376 Ga0395905_0020717
377 Ga0395901_0035037
378 Ga0395901_0043897
379 Ga0395901_0070618
380 Ga0395901_0152738
381 Ga0395901_0218543
382 Ga0395901_0267311
383 Ga0436363_1238359
384 Ga0439436_0000331
385 Ga0439436_0008604
386 Ga0439438_020595
387 Ga0439439_0003643
388 Ga0439466_0001956
389 Ga0439465_0008627
390 Ga0439433_0001202
391 Ga0439433_0007568
392 Ga0439433_0025421
393 Ga0439442_000253
394 Ga0439442_000652
395 Ga0439442_000923
396 Ga0439442_000992
397 Ga0439442_004081
398 Ga0439442_010158
399 Ga0439432_005757
400 Ga0439449_0001642
401 Ga0439449_0014813
402 Ga0439449_0031122
403 Ga0439449_0051055
404 Ga0439449_0053715
405 Ga0439452_020043
406 Ga0439457_001173
407 Ga0439457_023255
408 Ga0439462_0002521
409 Ga0450919_003528
410 Ga0450920_000740
411 Ga0450920_002043
412 Ga0450907_000883
413 Ga0450907_008375
414 Ga0450908_000573
415 Ga0450909_000751
416 Ga0439434_0001575
417 Ga0450918_006503
418 Ga0450918_011906
419 Ga0495629_0054673
420 Ga0495653_0011955
421 Ga0495580_0089786
422 Ga0495580_0109055
423 Ga0495594_0082887
424 Ga0495630_0036810
425 Ga0495631_0019629
426 Ga0495642_0027312
427 Ga0495642_0040515
428 Ga0495654_0097408
429 Ga0495665_0004496
430 Ga0495586_0003423
431 Ga0495587_0002742
432 Ga0495645_0001680
433 Ga0495633_0059626
434 Ga0495667_0000098
435 Ga0495656_0001616
436 Ga0495588_0037953
437 Ga0495588_0074779
438 Ga0495657_0038332
439 Ga0495623_0122755
440 Ga0495613_0171263
441 Ga0495670_0000935
442 Ga0495670_0006096
443 Ga0495670_0095759
444 Ga0495600_0003639
445 Ga0495581_0016294
446 Ga0495604_0226902
447 Ga0495680_0030928
448 Ga0495675_0009100
449 Ga0495677_0055423
450 Ga0495685_076592
451 Ga0495684_0240511
452 Ga0495615_0028138
453 Ga0496100_0067694
454 Ga0496100_0211531
455 Ga0496101_0012205
456 Ga0496102_0013659
457 Ga0496102_0323010
458 Ga0496102_0428895
459 Ga0496103_0013983
460 Ga0496103_0051521
461 Ga0496103_0061310
462 Ga0496103_0158207
463 Ga0496105_0129001
464 Ga0496106_0009246
465 Ga0496106_0211381
466 Ga0496108_0157333
467 Ga0496109_0000380
468 Ga0496109_0164389
469 Ga0496110_0513119
470 Ga0496110_0567674
471 Ga0496111_0038683
472 Ga0496111_0080580
473 Ga0496112_0180068
474 Ga0496112_0191778
475 Ga0496113_0049351
476 Ga0496113_0186610
477 Ga0496114_0074628
478 Ga0496115_0041464
479 Ga0496124_0030134
480 Ga0501032_0000340
481 Ga0501032_0138967
482 Ga0501034_0000057
483 Ga0501036_0340719
484 Ga0501037_0002741
485 Ga0501037_0078453
486 Ga0501037_0116550
487 Ga0501038_0009141
488 Ga0501038_0136511
489 Ga0501039_0141494
490 Ga0501043_0005462
491 Ga0501043_0050843
492 Ga0587090_004356
493 2537898041
494 2691512558
495 2775657675
496 2808829811
497 2808850992
498 2808876499
499 2808894065
500 2808898009
501 2810362994
502 2812318493
503 2833711015
504 2844851437
505 2857741863
506 2904497711
507 2905930704
508 2910812502
509 2919038641
510 2919054877
511 2919062529
512 2919391827
513 2919539630
514 2932428498
515 2933419861
516 2939600773
517 2939676567
518 2945916248
519 2945923616
520 2945944710
521 2945957082
522 2946006829
523 2946024534
524 2946060049
525 2954001903
526 2974304198
527 8004022624
528 8004026362
529 8054708576
530 8054730800

MSA Aligner

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3kav-assembly1.cif.gz_A crystal structure of the mutant (l80m) pa2107 protein from pseudomonas aeruginosa, northeast structural genomics consortium target par198 0.409 172 260
3kaw-assembly1.cif.gz_A crystal structure of pa2107 protein from pseudomonas aeruginosa, northeast structural genomics consortium target par198 0.4036 172 260
4qh4-assembly1.cif.gz_B the glic pentameric ligand-gated ion channel (wild-type) crystallized in acetate buffer at ph3 0.3693 58 264
3kaw-assembly1.cif.gz_A crystal structure of pa2107 protein from pseudomonas aeruginosa, northeast structural genomics consortium target par198 0.365 172 260
6f0j-assembly1.cif.gz_A glic mutant e26a 0.363 58 264
ID Description Score Start End Superfamily
af_A0A1D8PQ93_287_481_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.5018 172 269 1.20.1070.10
1sziA02 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Flagellar protein FliS 0.4336 65 258 1.20.120.340
af_Q61140_453_614_1.20.120.830 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Serine-rich domain 0.4206 75 257 1.20.120.830
af_G3V9U5_1_118_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.4188 140 257 1.20.1070.10
3kawC00 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2; 0.4147 172 260 1.20.1270.360
ID Description Score Start End GO Terms
AF-A0A0Q7K8S7-F1-model_v4 Uncharacterized protein 0.9858 175 262
AF-A0A073AY53-F1-model_v4 Uncharacterized protein 0.9639 179 263
AF-A0A378WQR5-F1-model_v4 3-methyladenine DNA glycosylase 0.9574 177 262
AF-A0A5N5EAZ7-F1-model_v4 3-methyladenine DNA glycosylase 0.9568 168 262
AF-A0A7Y9RU97-F1-model_v4 Uncharacterized protein 0.9546 177 262

Map