F373438

General Info

Members Datasets Scaffolds Average Seq Length
265 203 255 250

Family's Representative Sequence

Representative Sequence 3300031901|Ga0307406_10017189|Ga0307406_100171893
Length 287
Sequence MTTVRTERSGAVVTVILDRPHVRNAVDRPTAQALADAFRAFDADDTASVAVLWGAGGTFCAGADLHAIAAGDGNRIAPDGDGPMGPTRLRLSKPVIAAVSGHAVAGGLELAIWCDLRVVEADAVLGVFCRRWGVPLIDGGTVRLPRLIGVGRALDLILTGRPVDAEEAHRIGLADRVVPSGRSRAAAEELAAQLAALPQACLRNDRAAVYDALGRDEADALAVEFAHGLRSLAAGAAQGARRFSSRAGSPRTASPPGQADPCCATWPRRRAGCRCGRPAVPWLPWCG

Samples

Sample ID Description Type Environment
1 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
2 2643221692 Nocardia sp. Root136 Isolate Unclassified
3 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
4 2739367654 Promicromonospora sp. YR516 Isolate Unclassified
5 2758568522 Promicromonospora thailandica SAI-039 Isolate Unclassified
6 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
7 2808606394 Promicromonospora sp. C35 Isolate Unclassified
8 2867475112 Streptomyces sp. TM32 Isolate Unclassified
9 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
50 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
51 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
52 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
53 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
54 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
55 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
56 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
78 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
80 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
81 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
124 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
126 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
127 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
128 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
129 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
130 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
131 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
132 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
133 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
134 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
135 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
136 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
137 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
138 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
139 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
140 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
141 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
142 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
143 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
144 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
145 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
146 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
147 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
148 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
149 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
150 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
151 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
152 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
153 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
154 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
155 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
156 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
157 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
158 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
159 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
160 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
161 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
162 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
163 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
164 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
165 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
166 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
167 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
168 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
169 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
170 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
171 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
172 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
184 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
185 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
186 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
187 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
188 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
189 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
190 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
191 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
192 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
194 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
195 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
196 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
197 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
198 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
199 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
200 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
201 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
202 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
203 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.85
Metatranscriptomes 0.38
Isolates 3.77

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.77
Nodule 0
Rhizoplane 3.4
Rhizosphere 88.68
Stem 0
Stem Tuber 0
Unclassified 4.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070690_100069978 3300005330 Bacteria 2278
2 Ga0070670_100220793 3300005331 Bacteria 1649
3 Ga0070677_10023487 3300005333 Bacteria 2284
4 Ga0068869_100030798 3300005334 Bacteria 3770
5 Ga0070687_100026371 3300005343 Bacteria 2797
6 Ga0070668_100020223 3300005347 Bacteria 5021
7 Ga0070669_100149269 3300005353 Bacteria 1808
8 Ga0070675_100000243 3300005354 Bacteria 35354
9 Ga0070671_100006003 3300005355 Bacteria 9679
10 Ga0070674_100136299 3300005356 Bacteria 1836
11 Ga0070674_100198209 3300005356 Bacteria 1549
12 Ga0070673_100010639 3300005364 Bacteria 6237
13 Ga0070688_100012924 3300005365 Bacteria 4693
14 Ga0070667_100010689 3300005367 Bacteria 7584
15 Ga0070714_100015168 3300005435 Bacteria 6196
16 Ga0070714_100027005 3300005435 Bacteria 4750
17 Ga0070714_100037894 3300005435 Bacteria 4053
18 Ga0070713_100000720 3300005436 Bacteria 21232
19 Ga0070710_10000002 3300005437 Bacteria 290371
20 Ga0070710_10000371 3300005437 Bacteria 21027
21 Ga0070711_100001527 3300005439 Bacteria 12751
22 Ga0070711_100352447 3300005439 Bacteria 1184
23 Ga0070694_100008979 3300005444 Bacteria 6123
24 Ga0070708_100100341 3300005445 Bacteria 2649
25 Ga0070708_100136245 3300005445 Bacteria 2275
26 Ga0070663_100179590 3300005455 Bacteria 1641
27 Ga0070678_100003356 3300005456 Bacteria 8919
28 Ga0070678_100019136 3300005456 Bacteria 4455
29 Ga0070662_100030422 3300005457 Bacteria 3777
30 Ga0068867_100141913 3300005459 Bacteria 1878
31 Ga0068867_100174503 3300005459 Bacteria 1705
32 Ga0070685_10371612 3300005466 Bacteria 983
33 Ga0070706_100006046 3300005467 Bacteria 11438
34 Ga0070706_100014020 3300005467 Bacteria 7405
35 Ga0070706_100145659 3300005467 Bacteria 2212
36 Ga0070707_100008360 3300005468 Bacteria 9608
37 Ga0070707_100020763 3300005468 Bacteria 6200
38 Ga0070707_100021636 3300005468 Bacteria 6080
39 Ga0070707_100141940 3300005468 Bacteria 2337
40 Ga0070698_100001809 3300005471 Bacteria 23789
41 Ga0070698_100057344 3300005471 Bacteria 3941
42 Ga0070698_100093359 3300005471 Bacteria 2989
43 Ga0070698_100272551 3300005471 Bacteria 1624
44 Ga0070698_100272679 3300005471 Bacteria 1623
45 Ga0070699_100004853 3300005518 Bacteria 11868
46 Ga0070697_100164529 3300005536 Bacteria 1875
47 Ga0070672_100052314 3300005543 Bacteria 3188
48 Ga0070672_100170965 3300005543 Bacteria 1807
49 Ga0070695_100001699 3300005545 Bacteria 12390
50 Ga0070704_100286931 3300005549 Bacteria 1366
51 Ga0068856_100296568 3300005614 Bacteria 1634
52 Ga0068859_100000664 3300005617 Bacteria 34524
53 Ga0068864_100000649 3300005618 Bacteria 29069
54 Ga0068866_10151164 3300005718 Bacteria 1345
55 Ga0068866_10272453 3300005718 Bacteria 1045
56 Ga0068863_100014376 3300005841 Bacteria 7623
57 Ga0068858_100000753 3300005842 Bacteria 33946
58 Ga0068862_100229824 3300005844 Bacteria 1682
59 Ga0081455_10000459 3300005937 Bacteria 53464
60 Ga0081538_10009530 3300005981 Bacteria 8087
61 Ga0070717_10007260 3300006028 Bacteria 8217
62 Ga0075364_10005690 3300006051 Bacteria 7267
63 Ga0070716_100000224 3300006173 Bacteria 22741
64 Ga0070712_100001576 3300006175 Bacteria 13961
65 Ga0075362_10082083 3300006177 Bacteria 1487
66 Ga0075367_10050847 3300006178 Bacteria 2448
67 Ga0097621_100163804 3300006237 Bacteria 1913
68 Ga0068871_100077007 3300006358 Bacteria 2756
69 Ga0075428_100127406 3300006844 Bacteria 2770
70 Ga0075428_100143016 3300006844 Bacteria 2600
71 Ga0075428_100450959 3300006844 Bacteria 1378
72 Ga0075433_10031317 3300006852 Bacteria 4546
73 Ga0075433_10075741 3300006852 Bacteria 2962
74 Ga0075434_100072804 3300006871 Bacteria 3428
75 Ga0075434_100189670 3300006871 Bacteria 2076
76 Ga0097620_100000664 3300006931 Bacteria 34524
77 Ga0111539_10000446 3300009094 Bacteria 51962
78 Ga0111539_10011435 3300009094 Bacteria 11141
79 Ga0114129_11083315 3300009147 Bacteria 1004
80 Ga0105243_10083781 3300009148 Bacteria 2609
81 Ga0105242_10222049 3300009176 Bacteria 1689
82 Ga0105248_10011097 3300009177 Bacteria 9940
83 Ga0105249_10096278 3300009553 Bacteria 2777
84 Ga0157374_10044666 3300013296 Bacteria 4095
85 Ga0157378_10116962 3300013297 Bacteria 2452
86 Ga0163162_10145689 3300013306 Bacteria 2484
87 Ga0157375_10083417 3300013308 Bacteria 3241
88 Ga0157375_10557242 3300013308 Bacteria 1307
89 Ga0163163_10024826 3300014325 Bacteria 5707
90 Ga0157377_10041560 3300014745 Bacteria 2551
91 Ga0157379_10000301 3300014968 Bacteria 39095
92 Ga0157376_10508880 3300014969 Bacteria 1185
93 Ga0163161_10058570 3300017792 Bacteria 2800
94 Ga0163161_10144004 3300017792 Bacteria 1806
95 Ga0206356_10256915 3300020070 Bacteria 1934
96 Ga0209758_1023976 3300025297 Bacteria 2736
97 Ga0207426_1038626 3300025302 Bacteria 1502
98 Ga0207682_10105680 3300025893 Bacteria 1235
99 Ga0207692_10000005 3300025898 Bacteria 370169
100 Ga0207692_10000351 3300025898 Bacteria 15843
101 Ga0207680_10000566 3300025903 Bacteria 17497
102 Ga0207699_10005948 3300025906 Bacteria 5872
103 Ga0207645_10037446 3300025907 Bacteria 3112
104 Ga0207643_10065983 3300025908 Bacteria 2075
105 Ga0207684_10039728 3300025910 Bacteria 3989
106 Ga0207707_10009634 3300025912 Bacteria 8380
107 Ga0207707_10030343 3300025912 Bacteria 4730
108 Ga0207693_10001227 3300025915 Bacteria 22867
109 Ga0207663_10010654 3300025916 Bacteria 4903
110 Ga0207663_10441592 3300025916 Bacteria 1002
111 Ga0207652_10223284 3300025921 Bacteria 1697
112 Ga0207646_10013388 3300025922 Bacteria 7847
113 Ga0207646_10023379 3300025922 Bacteria 5678
114 Ga0207646_10102252 3300025922 Bacteria 2569
115 Ga0207650_10199857 3300025925 Bacteria 1601
116 Ga0207659_10000413 3300025926 Bacteria 25819
117 Ga0207700_10000573 3300025928 Bacteria 21562
118 Ga0207664_10000689 3300025929 Bacteria 23132
119 Ga0207644_10010403 3300025931 Bacteria 6129
120 Ga0207706_10025812 3300025933 Bacteria 5263
121 Ga0207706_10047357 3300025933 Bacteria 3804
122 Ga0207669_10045342 3300025937 Bacteria 2590
123 Ga0207665_10000475 3300025939 Bacteria 27234
124 Ga0207691_10218425 3300025940 Bacteria 1654
125 Ga0207711_10008859 3300025941 Bacteria 8413
126 Ga0207689_10015963 3300025942 Bacteria 6356
127 Ga0207661_10035423 3300025944 Bacteria 3889
128 Ga0207651_10004313 3300025960 Bacteria 7141
129 Ga0207658_10093195 3300025986 Bacteria 2341
130 Ga0207677_10001957 3300026023 Bacteria 10902
131 Ga0207703_10002030 3300026035 Bacteria 17878
132 Ga0207678_10028204 3300026067 Bacteria 4902
133 Ga0207641_10005904 3300026088 Bacteria 10385
134 Ga0207648_10219244 3300026089 Bacteria 1690
135 Ga0207676_10000325 3300026095 Bacteria 41139
136 Ga0207675_100072051 3300026118 Bacteria 3231
137 Ga0207675_100315128 3300026118 Bacteria 1526
138 Ga0207683_10002615 3300026121 Bacteria 15719
139 Ga0207683_10008809 3300026121 Bacteria 8612
140 Ga0207698_10047812 3300026142 Bacteria 3244
141 Ga0209968_1000934 3300027526 Bacteria 4517
142 Ga0209999_1006610 3300027543 Bacteria 2083
143 Ga0209970_1001518 3300027614 Bacteria 4050
144 Ga0209983_1003541 3300027665 Bacteria 3321
145 Ga0209971_1000203 3300027682 Bacteria 17744
146 Ga0209966_1000352 3300027695 Bacteria 14073
147 Ga0209998_10000156 3300027717 Bacteria 25705
148 Ga0207428_10003284 3300027907 Bacteria 15730
149 Ga0268264_10079255 3300028381 Bacteria 2802
150 Ga0268264_10437454 3300028381 Bacteria 1264
151 Ga0265327_10028410 3300031251 Bacteria 3200
152 Ga0307405_10427136 3300031731 Bacteria 1044
153 Ga0307413_10612140 3300031824 Bacteria 893
154 Ga0307406_10017189 3300031901 Bacteria 4211
155 Ga0307406_10018493 3300031901 Bacteria 4073
156 Ga0307406_10075502 3300031901 Bacteria 2224
157 Ga0307415_100085474 3300032126 Bacteria 2267
158 Ga0307510_10259362 3300033180 Bacteria 1220
159 Ga0395899_0007450 3300037312 Bacteria 8454
160 Ga0395898_0023132 3300037466 Bacteria 6282
161 Ga0436364_0168363 3300037853 Bacteria 2501
162 Ga0395901_0175694 3300038443 Bacteria 2246
163 Ga0395901_0186661 3300038443 Bacteria 2174
164 Ga0436363_1117054 3300039450 Bacteria 1193
165 Ga0436362_1119315 3300039453 Bacteria 5372
166 Ga0439466_0015765 3300041411 Bacteria 2743
167 Ga0439431_0006604 3300041997 Bacteria 2570
168 Ga0439445_0000258 3300042004 Bacteria 10129
169 Ga0439449_0015364 3300042007 Bacteria 2876
170 Ga0439434_0001385 3300042435 Bacteria 6992
171 Ga0439464_0029403 3300042439 Bacteria 1535
172 Ga0439460_0078943 3300042461 Bacteria 1030
173 Ga0451577_0002182 3300042876 Bacteria 23872
174 Ga0466972_0120266 3300044658 Bacteria 1239
175 Ga0453683_0017655 3300044673 Bacteria 4592
176 Ga0466963_0045195 3300044694 Bacteria 2900
177 Ga0466963_0078488 3300044694 Bacteria 2232
178 Ga0466963_0534571 3300044694 Bacteria 828
179 Ga0466964_0052001 3300044706 Bacteria 1683
180 Ga0453684_0008392 3300044712 Bacteria 18535
181 Ga0466971_0059567 3300044719 Bacteria 1725
182 Ga0466968_0006746 3300044735 Bacteria 4340
183 Ga0466970_0134545 3300044765 Bacteria 1359
184 Ga0466957_0399363 3300044842 Bacteria 940
185 Ga0466960_0000994 3300044901 Bacteria 10109
186 Ga0466960_0015824 3300044901 Bacteria 3260
187 Ga0451576_0002647 3300045051 Bacteria 26164
188 Ga0466958_0199676 3300045836 Bacteria 1273
189 Ga0466967_0077719 3300045976 Bacteria 2988
190 Ga0466967_0147932 3300045976 Bacteria 2192
191 Ga0495621_0058957 3300046539 Bacteria 1390
192 Ga0495667_0426255 3300046559 Bacteria 835
193 Ga0495588_0000001 3300046674 Eukaryota 1451569
194 Ga0495674_0193616 3300047319 Bacteria 1689
195 Ga0495683_0002748 3300047323 Bacteria 10478
196 Ga0495687_000577 3300047443 Bacteria 43073
197 Ga0495685_001653 3300047447 Bacteria 6878
198 Ga0495686_0005496 3300047472 Bacteria 9971
199 Ga0496100_0000973 3300048903 Bacteria 13761
200 Ga0496101_0004293 3300048904 Bacteria 8943
201 Ga0496101_0439822 3300048904 Bacteria 1029
202 Ga0496102_0040010 3300048905 Bacteria 4239
203 Ga0496108_0107820 3300048911 Bacteria 2379
204 Ga0496108_0121590 3300048911 Bacteria 2240
205 Ga0496109_0008268 3300048912 Bacteria 8835
206 Ga0496109_0013610 3300048912 Bacteria 7065
207 Ga0496112_0536642 3300048915 Bacteria 1104
208 Ga0501034_0569662 3300049571 Bacteria 1040
209 Ga0501036_0327369 3300049572 Bacteria 1280
210 Ga0501036_0444862 3300049572 Bacteria 1080
211 Ga0501038_0231191 3300049574 Bacteria 1471
212 Ga0501039_0014768 3300049575 Bacteria 5974
213 Ga0501040_0002350 3300049576 Bacteria 12148
214 Ga0501040_0092131 3300049576 Bacteria 2107
215 Ga0501041_0042630 3300049577 Bacteria 2758
216 Ga0501042_0047192 3300049578 Bacteria 3071
217 Ga0501042_0186325 3300049578 Bacteria 1497
218 Ga0501043_0508014 3300049579 Bacteria 900
219 Ga0501046_0000084 3300049580 Bacteria 100971
220 Ga0501047_0000023 3300049581 Bacteria 240478
221 Ga0501047_0021355 3300049581 Bacteria 6214
222 Ga0501047_0188913 3300049581 Bacteria 1924
223 Ga0501048_0035318 3300049582 Bacteria 3599
224 Ga0501068_0031710 3300049584 Bacteria 3139
225 Ga0501070_0090721 3300049586 Bacteria 2529
226 Ga0501071_0149905 3300049587 Bacteria 1739
227 Ga0501073_0116240 3300049589 Bacteria 1854
228 Ga0501075_0006855 3300049591 Bacteria 7866
229 Ga0501075_0047273 3300049591 Bacteria 3234
230 Ga0501076_0011191 3300049592 Bacteria 6678
231 Ga0501077_0028161 3300049593 Bacteria 3570
232 Ga0501077_0205701 3300049593 Bacteria 1251
233 Ga0501080_0342468 3300049742 Bacteria 1351
234 Ga0501081_0006568 3300049743 Bacteria 7557
235 Ga0501081_0403202 3300049743 Bacteria 1012
236 Ga0501044_0048945 3300049823 Bacteria 4363
237 Ga0501044_0429614 3300049823 Bacteria 1230
238 Ga0501045_0002899 3300049824 Bacteria 11717
239 nmdc:mga00v17_119926_c1 3300050491 Bacteria 1674
240 nmdc:mga00v17_124785_c1 3300050491 Bacteria 1642
241 nmdc:mga00v17_241178_c1 3300050491 Bacteria 1172
242 nmdc:mga06z11_125304_c1 3300050494 Bacteria 1437
243 nmdc:mga08y16_2861_c1 3300050511 Bacteria 17751
244 nmdc:mga08y16_81814_c1 3300050511 Bacteria 3366
245 nmdc:mga0n895_233776_c1 3300050512 Bacteria 1865
246 nmdc:mga0n895_247591_c1 3300050512 Bacteria 1809
247 nmdc:mga0n895_42765_c1 3300050512 Bacteria 4410
248 nmdc:mga0n895_492734_c1 3300050512 Bacteria 1235
249 nmdc:mga0a205_1677_c1 3300050515 Bacteria 19104
250 nmdc:mga0a205_35284_c1 3300050515 Bacteria 4802
251 Ga0500616_0124112 3300053153 Bacteria 1229
252 Ga0501084_0274011 3300054114 Bacteria 1425
253 Ga0501082_0000528 3300060353 Bacteria 34016
254 Ga0530510_0195056 3300061734 Bacteria 1504
255 Ga0530510_0278531 3300061734 Bacteria 1249

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041411 Ga0439466_0015765 Ga0439466_0015765_1259_1987 210
2 3300042004 Ga0439445_0000258 Ga0439445_0000258_7090_7818 210
3 3300042435 Ga0439434_0001385 Ga0439434_0001385_4814_5542 210
4 3300005467 Ga0070706_100006046 Ga0070706_1000060466 212
5 3300005468 Ga0070707_100008360 Ga0070707_1000083603 212
6 3300005471 Ga0070698_100057344 Ga0070698_1000573442 212
7 3300005518 Ga0070699_100004853 Ga0070699_1000048539 212
8 3300005536 Ga0070697_100164529 Ga0070697_1001645292 212
9 3300025910 Ga0207684_10039728 Ga0207684_100397282 212
10 3300025922 Ga0207646_10023379 Ga0207646_100233793 212
11 3300006177 Ga0075362_10082083 Ga0075362_100820832 215
12 3300009176 Ga0105242_10222049 Ga0105242_102220492 217
13 3300044694 Ga0466963_0534571 Ga0466963_0534571_61_810 217
14 3300044765 Ga0466970_0134545 Ga0466970_0134545_333_1097 217
15 3300045976 Ga0466967_0077719 Ga0466967_0077719_674_1423 217
16 3300025944 Ga0207661_10035423 Ga0207661_100354235 218
17 3300047319 Ga0495674_0193616 Ga0495674_0193616_345_1091 218
18 3300048912 Ga0496109_0013610 Ga0496109_0013610_3077_3823 218
19 3300049584 Ga0501068_0031710 Ga0501068_0031710_2289_3092 218
20 3300048911 Ga0496108_0107820 Ga0496108_0107820_896_1657 219
21 3300048915 Ga0496112_0536642 Ga0496112_0536642_209_979 219
22 iso_pu_bacteria 2558860112 2558908431 219
23 iso_pu_bacteria 2739367654 2739606448 219
24 iso_pu_bacteria 2758568522 2760306756 219
25 iso_pu_bacteria 2808606394 2809029675 219
26 iso_pu_bacteria 2902810491 2902813771 219
27 3300005455 Ga0070663_100179590 Ga0070663_1001795902 220
28 3300005981 Ga0081538_10009530 Ga0081538_100095304 220
29 3300026067 Ga0207678_10028204 Ga0207678_100282045 220
30 iso_pu_bacteria 2643221715 2644635611 220
31 iso_pu_bacteria 2791354901 2791913659 220
32 iso_pu_bacteria 2867475112 2867476910 220
33 iso_pu_bacteria 8056829672 8056836213 220
34 3300005356 Ga0070674_100198209 Ga0070674_1001982092 221
35 3300005456 Ga0070678_100019136 Ga0070678_1000191363 221
36 3300005466 Ga0070685_10371612 Ga0070685_103716121 221
37 3300005471 Ga0070698_100001809 Ga0070698_1000018096 221
38 3300005549 Ga0070704_100286931 Ga0070704_1002869312 221
39 3300005718 Ga0068866_10272453 Ga0068866_102724532 221
40 3300006051 Ga0075364_10005690 Ga0075364_100056904 221
41 3300006178 Ga0075367_10050847 Ga0075367_100508474 221
42 3300025921 Ga0207652_10223284 Ga0207652_102232842 221
43 3300026121 Ga0207683_10002615 Ga0207683_100026153 221
44 3300031901 Ga0307406_10018493 Ga0307406_100184934 221
45 3300032126 Ga0307415_100085474 Ga0307415_1000854741 221
46 3300037312 Ga0395899_0007450 Ga0395899_0007450_2848_3603 221
47 3300038443 Ga0395901_0175694 Ga0395901_0175694_1418_2173 221
48 3300039450 Ga0436363_1117054 Ga0436363_1117054_190_1023 221
49 3300041997 Ga0439431_0006604 Ga0439431_0006604_540_1367 221
50 3300044901 Ga0466960_0000994 Ga0466960_0000994_2285_3040 221
51 3300047472 Ga0495686_0005496 Ga0495686_0005496_349_1104 221
52 3300049571 Ga0501034_0569662 Ga0501034_0569662_214_969 221
53 3300049572 Ga0501036_0444862 Ga0501036_0444862_44_799 221
54 3300049579 Ga0501043_0508014 Ga0501043_0508014_28_783 221
55 3300049581 Ga0501047_0021355 Ga0501047_0021355_3388_4143 221
56 3300049581 Ga0501047_0188913 Ga0501047_0188913_18_773 221
57 3300049586 Ga0501070_0090721 Ga0501070_0090721_487_1242 221
58 3300049823 Ga0501044_0048945 Ga0501044_0048945_17_772 221
59 3300050491 nmdc:mga00v17_119926_c1 nmdc:mga00v17_119926_c1_26_817 221
60 3300050491 nmdc:mga00v17_241178_c1 nmdc:mga00v17_241178_c1_210_986 221
61 3300050494 nmdc:mga06z11_125304_c1 nmdc:mga06z11_125304_c1_345_1121 221
62 3300005437 Ga0070710_10000002 Ga0070710_10000002112 222
63 3300009148 Ga0105243_10083781 Ga0105243_100837813 222
64 3300025898 Ga0207692_10000005 Ga0207692_1000000512 222
65 3300044735 Ga0466968_0006746 Ga0466968_0006746_1324_2091 222
66 3300045976 Ga0466967_0147932 Ga0466967_0147932_209_967 222
67 3300048903 Ga0496100_0000973 Ga0496100_0000973_928_1686 222
68 3300048904 Ga0496101_0004293 Ga0496101_0004293_3620_4378 222
69 3300005435 Ga0070714_100027005 Ga0070714_1000270052 223
70 3300005444 Ga0070694_100008979 Ga0070694_1000089792 223
71 3300005445 Ga0070708_100100341 Ga0070708_1001003413 223
72 3300005468 Ga0070707_100141940 Ga0070707_1001419402 223
73 3300005471 Ga0070698_100272551 Ga0070698_1002725513 223
74 3300005471 Ga0070698_100272679 Ga0070698_1002726792 223
75 3300005545 Ga0070695_100001699 Ga0070695_1000016991 223
76 3300005937 Ga0081455_10000459 Ga0081455_1000045939 223
77 3300006844 Ga0075428_100450959 Ga0075428_1004509592 223
78 3300009147 Ga0114129_11083315 Ga0114129_110833152 223
79 3300025922 Ga0207646_10102252 Ga0207646_101022522 223
80 3300027526 Ga0209968_1000934 Ga0209968_10009342 223
81 3300027543 Ga0209999_1006610 Ga0209999_10066102 223
82 3300027614 Ga0209970_1001518 Ga0209970_10015182 223
83 3300027665 Ga0209983_1003541 Ga0209983_10035411 223
84 3300027682 Ga0209971_1000203 Ga0209971_100020315 223
85 3300027695 Ga0209966_1000352 Ga0209966_100035213 223
86 3300027717 Ga0209998_10000156 Ga0209998_100001567 223
87 3300042439 Ga0439464_0029403 Ga0439464_0029403_666_1427 223
88 3300042461 Ga0439460_0078943 Ga0439460_0078943_217_978 223
89 3300048911 Ga0496108_0121590 Ga0496108_0121590_1021_1782 223
90 3300048912 Ga0496109_0008268 Ga0496109_0008268_815_1576 223
91 3300049572 Ga0501036_0327369 Ga0501036_0327369_44_805 223
92 3300049574 Ga0501038_0231191 Ga0501038_0231191_386_1204 223
93 3300049575 Ga0501039_0014768 Ga0501039_0014768_2133_2951 223
94 3300049576 Ga0501040_0002350 Ga0501040_0002350_10028_10846 223
95 3300049576 Ga0501040_0092131 Ga0501040_0092131_425_1186 223
96 3300049577 Ga0501041_0042630 Ga0501041_0042630_1524_2342 223
97 3300049578 Ga0501042_0186325 Ga0501042_0186325_59_820 223
98 3300049580 Ga0501046_0000084 Ga0501046_0000084_97401_98219 223
99 3300049582 Ga0501048_0035318 Ga0501048_0035318_572_1390 223
100 3300049587 Ga0501071_0149905 Ga0501071_0149905_70_888 223
101 3300049589 Ga0501073_0116240 Ga0501073_0116240_829_1647 223
102 3300049591 Ga0501075_0006855 Ga0501075_0006855_6853_7671 223
103 3300049591 Ga0501075_0047273 Ga0501075_0047273_499_1260 223
104 3300049592 Ga0501076_0011191 Ga0501076_0011191_717_1535 223
105 3300049593 Ga0501077_0028161 Ga0501077_0028161_49_867 223
106 3300049593 Ga0501077_0205701 Ga0501077_0205701_425_1186 223
107 3300049742 Ga0501080_0342468 Ga0501080_0342468_374_1135 223
108 3300049743 Ga0501081_0006568 Ga0501081_0006568_5021_5839 223
109 3300049743 Ga0501081_0403202 Ga0501081_0403202_134_895 223
110 3300049824 Ga0501045_0002899 Ga0501045_0002899_10501_11319 223
111 3300050512 nmdc:mga0n895_233776_c1 nmdc:mga0n895_233776_c1_902_1663 223
112 3300054114 Ga0501084_0274011 Ga0501084_0274011_324_1085 223
113 3300060353 Ga0501082_0000528 Ga0501082_0000528_3739_4557 223
114 3300061734 Ga0530510_0195056 Ga0530510_0195056_470_1231 223
115 3300061734 Ga0530510_0278531 Ga0530510_0278531_109_837 223
116 3300005435 Ga0070714_100015168 Ga0070714_1000151683 224
117 3300005435 Ga0070714_100037894 Ga0070714_1000378943 224
118 3300005436 Ga0070713_100000720 Ga0070713_1000007204 224
119 3300005437 Ga0070710_10000371 Ga0070710_100003714 224
120 3300005439 Ga0070711_100001527 Ga0070711_1000015276 224
121 3300005467 Ga0070706_100145659 Ga0070706_1001456591 224
122 3300005468 Ga0070707_100021636 Ga0070707_1000216361 224
123 3300005471 Ga0070698_100093359 Ga0070698_1000933591 224
124 3300006028 Ga0070717_10007260 Ga0070717_100072606 224
125 3300006173 Ga0070716_100000224 Ga0070716_1000002246 224
126 3300006175 Ga0070712_100001576 Ga0070712_1000015763 224
127 3300025297 Ga0209758_1023976 Ga0209758_10239762 224
128 3300025302 Ga0207426_1038626 Ga0207426_10386262 224
129 3300025898 Ga0207692_10000351 Ga0207692_1000035110 224
130 3300025906 Ga0207699_10005948 Ga0207699_100059484 224
131 3300025915 Ga0207693_10001227 Ga0207693_1000122712 224
132 3300025916 Ga0207663_10010654 Ga0207663_100106542 224
133 3300025922 Ga0207646_10013388 Ga0207646_100133883 224
134 3300025928 Ga0207700_10000573 Ga0207700_100005734 224
135 3300025929 Ga0207664_10000689 Ga0207664_100006897 224
136 3300025939 Ga0207665_10000475 Ga0207665_1000047512 224
137 3300033180 Ga0307510_10259362 Ga0307510_102593622 224
138 3300037466 Ga0395898_0023132 Ga0395898_0023132_4771_5535 224
139 3300042007 Ga0439449_0015364 Ga0439449_0015364_331_1095 224
140 3300044658 Ga0466972_0120266 Ga0466972_0120266_345_1118 224
141 3300044719 Ga0466971_0059567 Ga0466971_0059567_225_989 224
142 3300044901 Ga0466960_0015824 Ga0466960_0015824_1150_1932 224
143 3300046559 Ga0495667_0426255 Ga0495667_0426255_58_822 224
144 3300047323 Ga0495683_0002748 Ga0495683_0002748_2816_3580 224
145 3300047443 Ga0495687_000577 Ga0495687_000577_445_1227 224
146 3300047447 Ga0495685_001653 Ga0495685_001653_910_1692 224
147 3300049578 Ga0501042_0047192 Ga0501042_0047192_2206_2979 224
148 3300049581 Ga0501047_0000023 Ga0501047_0000023_199342_200115 224
149 3300049823 Ga0501044_0429614 Ga0501044_0429614_43_816 224
150 3300005439 Ga0070711_100352447 Ga0070711_1003524471 225
151 3300005445 Ga0070708_100136245 Ga0070708_1001362452 225
152 3300005467 Ga0070706_100014020 Ga0070706_1000140204 225
153 3300005468 Ga0070707_100020763 Ga0070707_1000207631 225
154 3300025916 Ga0207663_10441592 Ga0207663_104415921 225
155 3300031824 Ga0307413_10612140 Ga0307413_106121401 225
156 3300031901 Ga0307406_10075502 Ga0307406_100755022 225
157 3300037853 Ga0436364_0168363 Ga0436364_0168363_1035_1805 225
158 3300044842 Ga0466957_0399363 Ga0466957_0399363_94_873 225
159 iso_pu_bacteria 2643221692 2644513973 225
160 3300005718 Ga0068866_10151164 Ga0068866_101511642 226
161 3300006844 Ga0075428_100127406 Ga0075428_1001274063 226
162 3300006844 Ga0075428_100143016 Ga0075428_1001430162 226
163 3300006852 Ga0075433_10031317 Ga0075433_100313175 226
164 3300006852 Ga0075433_10075741 Ga0075433_100757415 226
165 3300006871 Ga0075434_100072804 Ga0075434_1000728045 226
166 3300006871 Ga0075434_100189670 Ga0075434_1001896702 226
167 3300009094 Ga0111539_10000446 Ga0111539_1000044634 226
168 3300009094 Ga0111539_10011435 Ga0111539_100114359 226
169 3300025933 Ga0207706_10047357 Ga0207706_100473573 226
170 3300027907 Ga0207428_10003284 Ga0207428_100032848 226
171 3300031251 Ga0265327_10028410 Ga0265327_100284101 226
172 3300031731 Ga0307405_10427136 Ga0307405_104271362 226
173 3300031901 Ga0307406_10017189 Ga0307406_100171893 226
174 3300042876 Ga0451577_0002182 Ga0451577_0002182_16600_17373 226
175 3300044673 Ga0453683_0017655 Ga0453683_0017655_670_1443 226
176 3300044694 Ga0466963_0045195 Ga0466963_0045195_784_1572 226
177 3300044694 Ga0466963_0078488 Ga0466963_0078488_1076_1855 226
178 3300044706 Ga0466964_0052001 Ga0466964_0052001_626_1405 226
179 3300044712 Ga0453684_0008392 Ga0453684_0008392_6712_7485 226
180 3300045051 Ga0451576_0002647 Ga0451576_0002647_8174_8947 226
181 3300045836 Ga0466958_0199676 Ga0466958_0199676_182_970 226
182 3300050491 nmdc:mga00v17_124785_c1 nmdc:mga00v17_124785_c1_770_1549 226
183 3300050511 nmdc:mga08y16_2861_c1 nmdc:mga08y16_2861_c1_10923_11696 226
184 3300050511 nmdc:mga08y16_81814_c1 nmdc:mga08y16_81814_c1_1226_1999 226
185 3300050512 nmdc:mga0n895_247591_c1 nmdc:mga0n895_247591_c1_94_867 226
186 3300050512 nmdc:mga0n895_42765_c1 nmdc:mga0n895_42765_c1_269_1042 226
187 3300050512 nmdc:mga0n895_492734_c1 nmdc:mga0n895_492734_c1_110_883 226
188 3300050515 nmdc:mga0a205_1677_c1 nmdc:mga0a205_1677_c1_2675_3448 226
189 3300050515 nmdc:mga0a205_35284_c1 nmdc:mga0a205_35284_c1_1071_1844 226
190 3300053153 Ga0500616_0124112 Ga0500616_0124112_302_1108 226
191 3300005614 Ga0068856_100296568 Ga0068856_1002965683 227
192 3300020070 Ga0206356_10256915 Ga0206356_102569152 227
193 3300025912 Ga0207707_10009634 Ga0207707_100096347 227
194 3300025912 Ga0207707_10030343 Ga0207707_100303435 227
195 3300038443 Ga0395901_0186661 Ga0395901_0186661_344_1144 227
196 3300039453 Ga0436362_1119315 Ga0436362_1119315_841_1695 227
197 3300048905 Ga0496102_0040010 Ga0496102_0040010_65_862 228
198 3300005347 Ga0070668_100020223 Ga0070668_1000202236 232
199 3300005356 Ga0070674_100136299 Ga0070674_1001362992 232
200 3300005459 Ga0068867_100141913 Ga0068867_1001419133 232
201 3300005543 Ga0070672_100170965 Ga0070672_1001709652 232
202 3300028381 Ga0268264_10437454 Ga0268264_104374542 232
203 3300005353 Ga0070669_100149269 Ga0070669_1001492692 233
204 3300005844 Ga0068862_100229824 Ga0068862_1002298242 233
205 3300009553 Ga0105249_10096278 Ga0105249_100962783 233
206 3300013308 Ga0157375_10557242 Ga0157375_105572422 233
207 3300017792 Ga0163161_10058570 Ga0163161_100585703 233
208 3300046539 Ga0495621_0058957 Ga0495621_0058957_176_991 233
209 3300046674 Ga0495588_0000001 Ga0495588_0000001_1450100_1450951 236
210 3300005330 Ga0070690_100069978 Ga0070690_1000699783 241
211 3300005331 Ga0070670_100220793 Ga0070670_1002207932 241
212 3300005333 Ga0070677_10023487 Ga0070677_100234871 241
213 3300005334 Ga0068869_100030798 Ga0068869_1000307982 241
214 3300005343 Ga0070687_100026371 Ga0070687_1000263713 241
215 3300005354 Ga0070675_100000243 Ga0070675_1000002437 241
216 3300005355 Ga0070671_100006003 Ga0070671_1000060037 241
217 3300005364 Ga0070673_100010639 Ga0070673_1000106395 241
218 3300005365 Ga0070688_100012924 Ga0070688_1000129245 241
219 3300005367 Ga0070667_100010689 Ga0070667_1000106893 241
220 3300005456 Ga0070678_100003356 Ga0070678_1000033563 241
221 3300005457 Ga0070662_100030422 Ga0070662_1000304224 241
222 3300005459 Ga0068867_100174503 Ga0068867_1001745032 241
223 3300005543 Ga0070672_100052314 Ga0070672_1000523143 241
224 3300005617 Ga0068859_100000664 Ga0068859_10000066423 241
225 3300005618 Ga0068864_100000649 Ga0068864_10000064919 241
226 3300005841 Ga0068863_100014376 Ga0068863_1000143763 241
227 3300005842 Ga0068858_100000753 Ga0068858_10000075317 241
228 3300006237 Ga0097621_100163804 Ga0097621_1001638042 241
229 3300006358 Ga0068871_100077007 Ga0068871_1000770073 241
230 3300006931 Ga0097620_100000664 Ga0097620_10000066423 241
231 3300009177 Ga0105248_10011097 Ga0105248_100110976 241
232 3300013296 Ga0157374_10044666 Ga0157374_100446664 241
233 3300013297 Ga0157378_10116962 Ga0157378_101169623 241
234 3300013306 Ga0163162_10145689 Ga0163162_101456893 241
235 3300013308 Ga0157375_10083417 Ga0157375_100834172 241
236 3300014325 Ga0163163_10024826 Ga0163163_100248266 241
237 3300014745 Ga0157377_10041560 Ga0157377_100415603 241
238 3300014968 Ga0157379_10000301 Ga0157379_1000030110 241
239 3300014969 Ga0157376_10508880 Ga0157376_105088802 241
240 3300017792 Ga0163161_10144004 Ga0163161_101440042 241
241 3300025893 Ga0207682_10105680 Ga0207682_101056802 241
242 3300025903 Ga0207680_10000566 Ga0207680_1000056610 241
243 3300025907 Ga0207645_10037446 Ga0207645_100374462 241
244 3300025908 Ga0207643_10065983 Ga0207643_100659831 241
245 3300025925 Ga0207650_10199857 Ga0207650_101998572 241
246 3300025926 Ga0207659_10000413 Ga0207659_1000041313 241
247 3300025931 Ga0207644_10010403 Ga0207644_100104033 241
248 3300025933 Ga0207706_10025812 Ga0207706_100258126 241
249 3300025937 Ga0207669_10045342 Ga0207669_100453423 241
250 3300025940 Ga0207691_10218425 Ga0207691_102184252 241
251 3300025941 Ga0207711_10008859 Ga0207711_100088595 241
252 3300025942 Ga0207689_10015963 Ga0207689_100159632 241
253 3300025960 Ga0207651_10004313 Ga0207651_100043134 241
254 3300025986 Ga0207658_10093195 Ga0207658_100931952 241
255 3300026023 Ga0207677_10001957 Ga0207677_100019579 241
256 3300026035 Ga0207703_10002030 Ga0207703_1000203021 241
257 3300026088 Ga0207641_10005904 Ga0207641_100059049 241
258 3300026089 Ga0207648_10219244 Ga0207648_102192442 241
259 3300026095 Ga0207676_10000325 Ga0207676_1000032521 241
260 3300026118 Ga0207675_100072051 Ga0207675_1000720511 241
261 3300026118 Ga0207675_100315128 Ga0207675_1003151282 241
262 3300026121 Ga0207683_10008809 Ga0207683_100088093 241
263 3300026142 Ga0207698_10047812 Ga0207698_100478121 241
264 3300028381 Ga0268264_10079255 Ga0268264_100792553 241
265 3300048904 Ga0496101_0439822 Ga0496101_0439822_134_949 241

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00378

ECH_1

Enoyl-CoA hydratase/isomerase

7

237

0.9

PF16113

ECH_2

Enoyl-CoA hydratase/isomerase

12

228

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
6xyw-assembly1.cif.gz_BE structure of the plant mitochondrial ribosome 0.8124 4 160
3t8b-assembly1.cif.gz_B crystal structure of mycobacterium tuberculosis menb with altered hexameric assembly 0.7956 1 172
7uzj-assembly1.cif.gz_L rat kidney v1 complex with sidk and ncoa7b, state 1 0.7907 30 53
1wdm-assembly1.cif.gz_B fatty acid beta-oxidation multienzyme complex from pseudomonas fragi, form i (native3) 0.7693 1 229
1wdm-assembly1.cif.gz_A fatty acid beta-oxidation multienzyme complex from pseudomonas fragi, form i (native3) 0.7663 1 229
ID Description Score Start End Superfamily
3rsiC01 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3; 0.9598 1 59 3.30.300.220
3rsiC01 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3; 0.9444 1 59 3.30.300.220
af_P31551_1_198_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9018 1 170 3.90.226.10
af_O06536_1_113_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.8981 14 136 3.90.226.10
3r9sB01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.8963 1 170 3.90.226.10
ID Description Score Start End GO Terms
AF-A0A1K2F691-F1-model_v4 Enoyl-CoA hydratase/isomerase 0.9938 1 67 GO:0006631
GO:0016853
AF-A0A0F8Y2U9-F1-model_v4 Enoyl-CoA hydratase 0.9921 1 64 GO:0004165
GO:0005777
AF-A0A7Y1TAP8-F1-model_v4 Enoyl-CoA hydratase (EC 4.2.1.17) 0.9836 3 163 GO:0004300
AF-A0A4V1V7M4-F1-model_v4 Enoyl-CoA hydratase/isomerase family protein 0.9798 1 70 GO:0008300
GO:0016853
AF-A0A7X9Q1G4-F1-model_v4 Enoyl-CoA hydratase (EC 4.2.1.17) 0.9788 3 115 GO:0004300
GO:0006631

Feature Viewer

pLDDT pTM Quality
85.93 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map