F373438
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 265 | 203 | 255 | 250 |
Family's Representative Sequence
| Representative Sequence | 3300031901|Ga0307406_10017189|Ga0307406_100171893 |
| Length | 287 |
| Sequence | MTTVRTERSGAVVTVILDRPHVRNAVDRPTAQALADAFRAFDADDTASVAVLWGAGGTFCAGADLHAIAAGDGNRIAPDGDGPMGPTRLRLSKPVIAAVSGHAVAGGLELAIWCDLRVVEADAVLGVFCRRWGVPLIDGGTVRLPRLIGVGRALDLILTGRPVDAEEAHRIGLADRVVPSGRSRAAAEELAAQLAALPQACLRNDRAAVYDALGRDEADALAVEFAHGLRSLAAGAAQGARRFSSRAGSPRTASPPGQADPCCATWPRRRAGCRCGRPAVPWLPWCG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2558860112 | Pseudonocardia acaciae DSM 45401 | Isolate | Unclassified |
| 2 | 2643221692 | Nocardia sp. Root136 | Isolate | Unclassified |
| 3 | 2643221715 | Mycobacterium sp. Root265 | Isolate | Unclassified |
| 4 | 2739367654 | Promicromonospora sp. YR516 | Isolate | Unclassified |
| 5 | 2758568522 | Promicromonospora thailandica SAI-039 | Isolate | Unclassified |
| 6 | 2791354901 | Actinophytocola xanthii 11-183 | Isolate | Rhizosphere |
| 7 | 2808606394 | Promicromonospora sp. C35 | Isolate | Unclassified |
| 8 | 2867475112 | Streptomyces sp. TM32 | Isolate | Unclassified |
| 9 | 2902810491 | Mycolicibacterium sp. P9-22 | Isolate | Unclassified |
| 10 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 14 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 33 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 43 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 44 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 45 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 46 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 47 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 48 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 49 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 50 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 51 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 53 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 56 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 57 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 59 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 60 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 61 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 62 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 79 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 80 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 81 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 124 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 126 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 127 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 128 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 129 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 130 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 131 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 132 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 133 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 134 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 135 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 136 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 137 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 138 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 139 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 140 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 141 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 142 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 143 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 144 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 145 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 146 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 147 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 148 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 149 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 150 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 151 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 152 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 153 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 154 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 155 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 156 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 157 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 158 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 167 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 168 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 169 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 170 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 171 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 172 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 173 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 174 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 175 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 176 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 177 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 178 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 179 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 180 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 181 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 182 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 183 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 184 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 185 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 186 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 187 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 188 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 189 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 190 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 191 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 192 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 193 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 194 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 195 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 196 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 197 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 198 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 199 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 200 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 201 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 202 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 203 | 8056829672 | Streptomyces barringtoniae JA03 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.85 |
| Metatranscriptomes | 0.38 |
| Isolates | 3.77 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.77 |
| Nodule | 0 |
| Rhizoplane | 3.4 |
| Rhizosphere | 88.68 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.15 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070690_100069978 | 3300005330 | Bacteria | 2278 |
| 2 | Ga0070670_100220793 | 3300005331 | Bacteria | 1649 |
| 3 | Ga0070677_10023487 | 3300005333 | Bacteria | 2284 |
| 4 | Ga0068869_100030798 | 3300005334 | Bacteria | 3770 |
| 5 | Ga0070687_100026371 | 3300005343 | Bacteria | 2797 |
| 6 | Ga0070668_100020223 | 3300005347 | Bacteria | 5021 |
| 7 | Ga0070669_100149269 | 3300005353 | Bacteria | 1808 |
| 8 | Ga0070675_100000243 | 3300005354 | Bacteria | 35354 |
| 9 | Ga0070671_100006003 | 3300005355 | Bacteria | 9679 |
| 10 | Ga0070674_100136299 | 3300005356 | Bacteria | 1836 |
| 11 | Ga0070674_100198209 | 3300005356 | Bacteria | 1549 |
| 12 | Ga0070673_100010639 | 3300005364 | Bacteria | 6237 |
| 13 | Ga0070688_100012924 | 3300005365 | Bacteria | 4693 |
| 14 | Ga0070667_100010689 | 3300005367 | Bacteria | 7584 |
| 15 | Ga0070714_100015168 | 3300005435 | Bacteria | 6196 |
| 16 | Ga0070714_100027005 | 3300005435 | Bacteria | 4750 |
| 17 | Ga0070714_100037894 | 3300005435 | Bacteria | 4053 |
| 18 | Ga0070713_100000720 | 3300005436 | Bacteria | 21232 |
| 19 | Ga0070710_10000002 | 3300005437 | Bacteria | 290371 |
| 20 | Ga0070710_10000371 | 3300005437 | Bacteria | 21027 |
| 21 | Ga0070711_100001527 | 3300005439 | Bacteria | 12751 |
| 22 | Ga0070711_100352447 | 3300005439 | Bacteria | 1184 |
| 23 | Ga0070694_100008979 | 3300005444 | Bacteria | 6123 |
| 24 | Ga0070708_100100341 | 3300005445 | Bacteria | 2649 |
| 25 | Ga0070708_100136245 | 3300005445 | Bacteria | 2275 |
| 26 | Ga0070663_100179590 | 3300005455 | Bacteria | 1641 |
| 27 | Ga0070678_100003356 | 3300005456 | Bacteria | 8919 |
| 28 | Ga0070678_100019136 | 3300005456 | Bacteria | 4455 |
| 29 | Ga0070662_100030422 | 3300005457 | Bacteria | 3777 |
| 30 | Ga0068867_100141913 | 3300005459 | Bacteria | 1878 |
| 31 | Ga0068867_100174503 | 3300005459 | Bacteria | 1705 |
| 32 | Ga0070685_10371612 | 3300005466 | Bacteria | 983 |
| 33 | Ga0070706_100006046 | 3300005467 | Bacteria | 11438 |
| 34 | Ga0070706_100014020 | 3300005467 | Bacteria | 7405 |
| 35 | Ga0070706_100145659 | 3300005467 | Bacteria | 2212 |
| 36 | Ga0070707_100008360 | 3300005468 | Bacteria | 9608 |
| 37 | Ga0070707_100020763 | 3300005468 | Bacteria | 6200 |
| 38 | Ga0070707_100021636 | 3300005468 | Bacteria | 6080 |
| 39 | Ga0070707_100141940 | 3300005468 | Bacteria | 2337 |
| 40 | Ga0070698_100001809 | 3300005471 | Bacteria | 23789 |
| 41 | Ga0070698_100057344 | 3300005471 | Bacteria | 3941 |
| 42 | Ga0070698_100093359 | 3300005471 | Bacteria | 2989 |
| 43 | Ga0070698_100272551 | 3300005471 | Bacteria | 1624 |
| 44 | Ga0070698_100272679 | 3300005471 | Bacteria | 1623 |
| 45 | Ga0070699_100004853 | 3300005518 | Bacteria | 11868 |
| 46 | Ga0070697_100164529 | 3300005536 | Bacteria | 1875 |
| 47 | Ga0070672_100052314 | 3300005543 | Bacteria | 3188 |
| 48 | Ga0070672_100170965 | 3300005543 | Bacteria | 1807 |
| 49 | Ga0070695_100001699 | 3300005545 | Bacteria | 12390 |
| 50 | Ga0070704_100286931 | 3300005549 | Bacteria | 1366 |
| 51 | Ga0068856_100296568 | 3300005614 | Bacteria | 1634 |
| 52 | Ga0068859_100000664 | 3300005617 | Bacteria | 34524 |
| 53 | Ga0068864_100000649 | 3300005618 | Bacteria | 29069 |
| 54 | Ga0068866_10151164 | 3300005718 | Bacteria | 1345 |
| 55 | Ga0068866_10272453 | 3300005718 | Bacteria | 1045 |
| 56 | Ga0068863_100014376 | 3300005841 | Bacteria | 7623 |
| 57 | Ga0068858_100000753 | 3300005842 | Bacteria | 33946 |
| 58 | Ga0068862_100229824 | 3300005844 | Bacteria | 1682 |
| 59 | Ga0081455_10000459 | 3300005937 | Bacteria | 53464 |
| 60 | Ga0081538_10009530 | 3300005981 | Bacteria | 8087 |
| 61 | Ga0070717_10007260 | 3300006028 | Bacteria | 8217 |
| 62 | Ga0075364_10005690 | 3300006051 | Bacteria | 7267 |
| 63 | Ga0070716_100000224 | 3300006173 | Bacteria | 22741 |
| 64 | Ga0070712_100001576 | 3300006175 | Bacteria | 13961 |
| 65 | Ga0075362_10082083 | 3300006177 | Bacteria | 1487 |
| 66 | Ga0075367_10050847 | 3300006178 | Bacteria | 2448 |
| 67 | Ga0097621_100163804 | 3300006237 | Bacteria | 1913 |
| 68 | Ga0068871_100077007 | 3300006358 | Bacteria | 2756 |
| 69 | Ga0075428_100127406 | 3300006844 | Bacteria | 2770 |
| 70 | Ga0075428_100143016 | 3300006844 | Bacteria | 2600 |
| 71 | Ga0075428_100450959 | 3300006844 | Bacteria | 1378 |
| 72 | Ga0075433_10031317 | 3300006852 | Bacteria | 4546 |
| 73 | Ga0075433_10075741 | 3300006852 | Bacteria | 2962 |
| 74 | Ga0075434_100072804 | 3300006871 | Bacteria | 3428 |
| 75 | Ga0075434_100189670 | 3300006871 | Bacteria | 2076 |
| 76 | Ga0097620_100000664 | 3300006931 | Bacteria | 34524 |
| 77 | Ga0111539_10000446 | 3300009094 | Bacteria | 51962 |
| 78 | Ga0111539_10011435 | 3300009094 | Bacteria | 11141 |
| 79 | Ga0114129_11083315 | 3300009147 | Bacteria | 1004 |
| 80 | Ga0105243_10083781 | 3300009148 | Bacteria | 2609 |
| 81 | Ga0105242_10222049 | 3300009176 | Bacteria | 1689 |
| 82 | Ga0105248_10011097 | 3300009177 | Bacteria | 9940 |
| 83 | Ga0105249_10096278 | 3300009553 | Bacteria | 2777 |
| 84 | Ga0157374_10044666 | 3300013296 | Bacteria | 4095 |
| 85 | Ga0157378_10116962 | 3300013297 | Bacteria | 2452 |
| 86 | Ga0163162_10145689 | 3300013306 | Bacteria | 2484 |
| 87 | Ga0157375_10083417 | 3300013308 | Bacteria | 3241 |
| 88 | Ga0157375_10557242 | 3300013308 | Bacteria | 1307 |
| 89 | Ga0163163_10024826 | 3300014325 | Bacteria | 5707 |
| 90 | Ga0157377_10041560 | 3300014745 | Bacteria | 2551 |
| 91 | Ga0157379_10000301 | 3300014968 | Bacteria | 39095 |
| 92 | Ga0157376_10508880 | 3300014969 | Bacteria | 1185 |
| 93 | Ga0163161_10058570 | 3300017792 | Bacteria | 2800 |
| 94 | Ga0163161_10144004 | 3300017792 | Bacteria | 1806 |
| 95 | Ga0206356_10256915 | 3300020070 | Bacteria | 1934 |
| 96 | Ga0209758_1023976 | 3300025297 | Bacteria | 2736 |
| 97 | Ga0207426_1038626 | 3300025302 | Bacteria | 1502 |
| 98 | Ga0207682_10105680 | 3300025893 | Bacteria | 1235 |
| 99 | Ga0207692_10000005 | 3300025898 | Bacteria | 370169 |
| 100 | Ga0207692_10000351 | 3300025898 | Bacteria | 15843 |
| 101 | Ga0207680_10000566 | 3300025903 | Bacteria | 17497 |
| 102 | Ga0207699_10005948 | 3300025906 | Bacteria | 5872 |
| 103 | Ga0207645_10037446 | 3300025907 | Bacteria | 3112 |
| 104 | Ga0207643_10065983 | 3300025908 | Bacteria | 2075 |
| 105 | Ga0207684_10039728 | 3300025910 | Bacteria | 3989 |
| 106 | Ga0207707_10009634 | 3300025912 | Bacteria | 8380 |
| 107 | Ga0207707_10030343 | 3300025912 | Bacteria | 4730 |
| 108 | Ga0207693_10001227 | 3300025915 | Bacteria | 22867 |
| 109 | Ga0207663_10010654 | 3300025916 | Bacteria | 4903 |
| 110 | Ga0207663_10441592 | 3300025916 | Bacteria | 1002 |
| 111 | Ga0207652_10223284 | 3300025921 | Bacteria | 1697 |
| 112 | Ga0207646_10013388 | 3300025922 | Bacteria | 7847 |
| 113 | Ga0207646_10023379 | 3300025922 | Bacteria | 5678 |
| 114 | Ga0207646_10102252 | 3300025922 | Bacteria | 2569 |
| 115 | Ga0207650_10199857 | 3300025925 | Bacteria | 1601 |
| 116 | Ga0207659_10000413 | 3300025926 | Bacteria | 25819 |
| 117 | Ga0207700_10000573 | 3300025928 | Bacteria | 21562 |
| 118 | Ga0207664_10000689 | 3300025929 | Bacteria | 23132 |
| 119 | Ga0207644_10010403 | 3300025931 | Bacteria | 6129 |
| 120 | Ga0207706_10025812 | 3300025933 | Bacteria | 5263 |
| 121 | Ga0207706_10047357 | 3300025933 | Bacteria | 3804 |
| 122 | Ga0207669_10045342 | 3300025937 | Bacteria | 2590 |
| 123 | Ga0207665_10000475 | 3300025939 | Bacteria | 27234 |
| 124 | Ga0207691_10218425 | 3300025940 | Bacteria | 1654 |
| 125 | Ga0207711_10008859 | 3300025941 | Bacteria | 8413 |
| 126 | Ga0207689_10015963 | 3300025942 | Bacteria | 6356 |
| 127 | Ga0207661_10035423 | 3300025944 | Bacteria | 3889 |
| 128 | Ga0207651_10004313 | 3300025960 | Bacteria | 7141 |
| 129 | Ga0207658_10093195 | 3300025986 | Bacteria | 2341 |
| 130 | Ga0207677_10001957 | 3300026023 | Bacteria | 10902 |
| 131 | Ga0207703_10002030 | 3300026035 | Bacteria | 17878 |
| 132 | Ga0207678_10028204 | 3300026067 | Bacteria | 4902 |
| 133 | Ga0207641_10005904 | 3300026088 | Bacteria | 10385 |
| 134 | Ga0207648_10219244 | 3300026089 | Bacteria | 1690 |
| 135 | Ga0207676_10000325 | 3300026095 | Bacteria | 41139 |
| 136 | Ga0207675_100072051 | 3300026118 | Bacteria | 3231 |
| 137 | Ga0207675_100315128 | 3300026118 | Bacteria | 1526 |
| 138 | Ga0207683_10002615 | 3300026121 | Bacteria | 15719 |
| 139 | Ga0207683_10008809 | 3300026121 | Bacteria | 8612 |
| 140 | Ga0207698_10047812 | 3300026142 | Bacteria | 3244 |
| 141 | Ga0209968_1000934 | 3300027526 | Bacteria | 4517 |
| 142 | Ga0209999_1006610 | 3300027543 | Bacteria | 2083 |
| 143 | Ga0209970_1001518 | 3300027614 | Bacteria | 4050 |
| 144 | Ga0209983_1003541 | 3300027665 | Bacteria | 3321 |
| 145 | Ga0209971_1000203 | 3300027682 | Bacteria | 17744 |
| 146 | Ga0209966_1000352 | 3300027695 | Bacteria | 14073 |
| 147 | Ga0209998_10000156 | 3300027717 | Bacteria | 25705 |
| 148 | Ga0207428_10003284 | 3300027907 | Bacteria | 15730 |
| 149 | Ga0268264_10079255 | 3300028381 | Bacteria | 2802 |
| 150 | Ga0268264_10437454 | 3300028381 | Bacteria | 1264 |
| 151 | Ga0265327_10028410 | 3300031251 | Bacteria | 3200 |
| 152 | Ga0307405_10427136 | 3300031731 | Bacteria | 1044 |
| 153 | Ga0307413_10612140 | 3300031824 | Bacteria | 893 |
| 154 | Ga0307406_10017189 | 3300031901 | Bacteria | 4211 |
| 155 | Ga0307406_10018493 | 3300031901 | Bacteria | 4073 |
| 156 | Ga0307406_10075502 | 3300031901 | Bacteria | 2224 |
| 157 | Ga0307415_100085474 | 3300032126 | Bacteria | 2267 |
| 158 | Ga0307510_10259362 | 3300033180 | Bacteria | 1220 |
| 159 | Ga0395899_0007450 | 3300037312 | Bacteria | 8454 |
| 160 | Ga0395898_0023132 | 3300037466 | Bacteria | 6282 |
| 161 | Ga0436364_0168363 | 3300037853 | Bacteria | 2501 |
| 162 | Ga0395901_0175694 | 3300038443 | Bacteria | 2246 |
| 163 | Ga0395901_0186661 | 3300038443 | Bacteria | 2174 |
| 164 | Ga0436363_1117054 | 3300039450 | Bacteria | 1193 |
| 165 | Ga0436362_1119315 | 3300039453 | Bacteria | 5372 |
| 166 | Ga0439466_0015765 | 3300041411 | Bacteria | 2743 |
| 167 | Ga0439431_0006604 | 3300041997 | Bacteria | 2570 |
| 168 | Ga0439445_0000258 | 3300042004 | Bacteria | 10129 |
| 169 | Ga0439449_0015364 | 3300042007 | Bacteria | 2876 |
| 170 | Ga0439434_0001385 | 3300042435 | Bacteria | 6992 |
| 171 | Ga0439464_0029403 | 3300042439 | Bacteria | 1535 |
| 172 | Ga0439460_0078943 | 3300042461 | Bacteria | 1030 |
| 173 | Ga0451577_0002182 | 3300042876 | Bacteria | 23872 |
| 174 | Ga0466972_0120266 | 3300044658 | Bacteria | 1239 |
| 175 | Ga0453683_0017655 | 3300044673 | Bacteria | 4592 |
| 176 | Ga0466963_0045195 | 3300044694 | Bacteria | 2900 |
| 177 | Ga0466963_0078488 | 3300044694 | Bacteria | 2232 |
| 178 | Ga0466963_0534571 | 3300044694 | Bacteria | 828 |
| 179 | Ga0466964_0052001 | 3300044706 | Bacteria | 1683 |
| 180 | Ga0453684_0008392 | 3300044712 | Bacteria | 18535 |
| 181 | Ga0466971_0059567 | 3300044719 | Bacteria | 1725 |
| 182 | Ga0466968_0006746 | 3300044735 | Bacteria | 4340 |
| 183 | Ga0466970_0134545 | 3300044765 | Bacteria | 1359 |
| 184 | Ga0466957_0399363 | 3300044842 | Bacteria | 940 |
| 185 | Ga0466960_0000994 | 3300044901 | Bacteria | 10109 |
| 186 | Ga0466960_0015824 | 3300044901 | Bacteria | 3260 |
| 187 | Ga0451576_0002647 | 3300045051 | Bacteria | 26164 |
| 188 | Ga0466958_0199676 | 3300045836 | Bacteria | 1273 |
| 189 | Ga0466967_0077719 | 3300045976 | Bacteria | 2988 |
| 190 | Ga0466967_0147932 | 3300045976 | Bacteria | 2192 |
| 191 | Ga0495621_0058957 | 3300046539 | Bacteria | 1390 |
| 192 | Ga0495667_0426255 | 3300046559 | Bacteria | 835 |
| 193 | Ga0495588_0000001 | 3300046674 | Eukaryota | 1451569 |
| 194 | Ga0495674_0193616 | 3300047319 | Bacteria | 1689 |
| 195 | Ga0495683_0002748 | 3300047323 | Bacteria | 10478 |
| 196 | Ga0495687_000577 | 3300047443 | Bacteria | 43073 |
| 197 | Ga0495685_001653 | 3300047447 | Bacteria | 6878 |
| 198 | Ga0495686_0005496 | 3300047472 | Bacteria | 9971 |
| 199 | Ga0496100_0000973 | 3300048903 | Bacteria | 13761 |
| 200 | Ga0496101_0004293 | 3300048904 | Bacteria | 8943 |
| 201 | Ga0496101_0439822 | 3300048904 | Bacteria | 1029 |
| 202 | Ga0496102_0040010 | 3300048905 | Bacteria | 4239 |
| 203 | Ga0496108_0107820 | 3300048911 | Bacteria | 2379 |
| 204 | Ga0496108_0121590 | 3300048911 | Bacteria | 2240 |
| 205 | Ga0496109_0008268 | 3300048912 | Bacteria | 8835 |
| 206 | Ga0496109_0013610 | 3300048912 | Bacteria | 7065 |
| 207 | Ga0496112_0536642 | 3300048915 | Bacteria | 1104 |
| 208 | Ga0501034_0569662 | 3300049571 | Bacteria | 1040 |
| 209 | Ga0501036_0327369 | 3300049572 | Bacteria | 1280 |
| 210 | Ga0501036_0444862 | 3300049572 | Bacteria | 1080 |
| 211 | Ga0501038_0231191 | 3300049574 | Bacteria | 1471 |
| 212 | Ga0501039_0014768 | 3300049575 | Bacteria | 5974 |
| 213 | Ga0501040_0002350 | 3300049576 | Bacteria | 12148 |
| 214 | Ga0501040_0092131 | 3300049576 | Bacteria | 2107 |
| 215 | Ga0501041_0042630 | 3300049577 | Bacteria | 2758 |
| 216 | Ga0501042_0047192 | 3300049578 | Bacteria | 3071 |
| 217 | Ga0501042_0186325 | 3300049578 | Bacteria | 1497 |
| 218 | Ga0501043_0508014 | 3300049579 | Bacteria | 900 |
| 219 | Ga0501046_0000084 | 3300049580 | Bacteria | 100971 |
| 220 | Ga0501047_0000023 | 3300049581 | Bacteria | 240478 |
| 221 | Ga0501047_0021355 | 3300049581 | Bacteria | 6214 |
| 222 | Ga0501047_0188913 | 3300049581 | Bacteria | 1924 |
| 223 | Ga0501048_0035318 | 3300049582 | Bacteria | 3599 |
| 224 | Ga0501068_0031710 | 3300049584 | Bacteria | 3139 |
| 225 | Ga0501070_0090721 | 3300049586 | Bacteria | 2529 |
| 226 | Ga0501071_0149905 | 3300049587 | Bacteria | 1739 |
| 227 | Ga0501073_0116240 | 3300049589 | Bacteria | 1854 |
| 228 | Ga0501075_0006855 | 3300049591 | Bacteria | 7866 |
| 229 | Ga0501075_0047273 | 3300049591 | Bacteria | 3234 |
| 230 | Ga0501076_0011191 | 3300049592 | Bacteria | 6678 |
| 231 | Ga0501077_0028161 | 3300049593 | Bacteria | 3570 |
| 232 | Ga0501077_0205701 | 3300049593 | Bacteria | 1251 |
| 233 | Ga0501080_0342468 | 3300049742 | Bacteria | 1351 |
| 234 | Ga0501081_0006568 | 3300049743 | Bacteria | 7557 |
| 235 | Ga0501081_0403202 | 3300049743 | Bacteria | 1012 |
| 236 | Ga0501044_0048945 | 3300049823 | Bacteria | 4363 |
| 237 | Ga0501044_0429614 | 3300049823 | Bacteria | 1230 |
| 238 | Ga0501045_0002899 | 3300049824 | Bacteria | 11717 |
| 239 | nmdc:mga00v17_119926_c1 | 3300050491 | Bacteria | 1674 |
| 240 | nmdc:mga00v17_124785_c1 | 3300050491 | Bacteria | 1642 |
| 241 | nmdc:mga00v17_241178_c1 | 3300050491 | Bacteria | 1172 |
| 242 | nmdc:mga06z11_125304_c1 | 3300050494 | Bacteria | 1437 |
| 243 | nmdc:mga08y16_2861_c1 | 3300050511 | Bacteria | 17751 |
| 244 | nmdc:mga08y16_81814_c1 | 3300050511 | Bacteria | 3366 |
| 245 | nmdc:mga0n895_233776_c1 | 3300050512 | Bacteria | 1865 |
| 246 | nmdc:mga0n895_247591_c1 | 3300050512 | Bacteria | 1809 |
| 247 | nmdc:mga0n895_42765_c1 | 3300050512 | Bacteria | 4410 |
| 248 | nmdc:mga0n895_492734_c1 | 3300050512 | Bacteria | 1235 |
| 249 | nmdc:mga0a205_1677_c1 | 3300050515 | Bacteria | 19104 |
| 250 | nmdc:mga0a205_35284_c1 | 3300050515 | Bacteria | 4802 |
| 251 | Ga0500616_0124112 | 3300053153 | Bacteria | 1229 |
| 252 | Ga0501084_0274011 | 3300054114 | Bacteria | 1425 |
| 253 | Ga0501082_0000528 | 3300060353 | Bacteria | 34016 |
| 254 | Ga0530510_0195056 | 3300061734 | Bacteria | 1504 |
| 255 | Ga0530510_0278531 | 3300061734 | Bacteria | 1249 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300041411 | Ga0439466_0015765 | Ga0439466_0015765_1259_1987 | 210 |
| 2 | 3300042004 | Ga0439445_0000258 | Ga0439445_0000258_7090_7818 | 210 |
| 3 | 3300042435 | Ga0439434_0001385 | Ga0439434_0001385_4814_5542 | 210 |
| 4 | 3300005467 | Ga0070706_100006046 | Ga0070706_1000060466 | 212 |
| 5 | 3300005468 | Ga0070707_100008360 | Ga0070707_1000083603 | 212 |
| 6 | 3300005471 | Ga0070698_100057344 | Ga0070698_1000573442 | 212 |
| 7 | 3300005518 | Ga0070699_100004853 | Ga0070699_1000048539 | 212 |
| 8 | 3300005536 | Ga0070697_100164529 | Ga0070697_1001645292 | 212 |
| 9 | 3300025910 | Ga0207684_10039728 | Ga0207684_100397282 | 212 |
| 10 | 3300025922 | Ga0207646_10023379 | Ga0207646_100233793 | 212 |
| 11 | 3300006177 | Ga0075362_10082083 | Ga0075362_100820832 | 215 |
| 12 | 3300009176 | Ga0105242_10222049 | Ga0105242_102220492 | 217 |
| 13 | 3300044694 | Ga0466963_0534571 | Ga0466963_0534571_61_810 | 217 |
| 14 | 3300044765 | Ga0466970_0134545 | Ga0466970_0134545_333_1097 | 217 |
| 15 | 3300045976 | Ga0466967_0077719 | Ga0466967_0077719_674_1423 | 217 |
| 16 | 3300025944 | Ga0207661_10035423 | Ga0207661_100354235 | 218 |
| 17 | 3300047319 | Ga0495674_0193616 | Ga0495674_0193616_345_1091 | 218 |
| 18 | 3300048912 | Ga0496109_0013610 | Ga0496109_0013610_3077_3823 | 218 |
| 19 | 3300049584 | Ga0501068_0031710 | Ga0501068_0031710_2289_3092 | 218 |
| 20 | 3300048911 | Ga0496108_0107820 | Ga0496108_0107820_896_1657 | 219 |
| 21 | 3300048915 | Ga0496112_0536642 | Ga0496112_0536642_209_979 | 219 |
| 22 | iso_pu_bacteria | 2558860112 | 2558908431 | 219 |
| 23 | iso_pu_bacteria | 2739367654 | 2739606448 | 219 |
| 24 | iso_pu_bacteria | 2758568522 | 2760306756 | 219 |
| 25 | iso_pu_bacteria | 2808606394 | 2809029675 | 219 |
| 26 | iso_pu_bacteria | 2902810491 | 2902813771 | 219 |
| 27 | 3300005455 | Ga0070663_100179590 | Ga0070663_1001795902 | 220 |
| 28 | 3300005981 | Ga0081538_10009530 | Ga0081538_100095304 | 220 |
| 29 | 3300026067 | Ga0207678_10028204 | Ga0207678_100282045 | 220 |
| 30 | iso_pu_bacteria | 2643221715 | 2644635611 | 220 |
| 31 | iso_pu_bacteria | 2791354901 | 2791913659 | 220 |
| 32 | iso_pu_bacteria | 2867475112 | 2867476910 | 220 |
| 33 | iso_pu_bacteria | 8056829672 | 8056836213 | 220 |
| 34 | 3300005356 | Ga0070674_100198209 | Ga0070674_1001982092 | 221 |
| 35 | 3300005456 | Ga0070678_100019136 | Ga0070678_1000191363 | 221 |
| 36 | 3300005466 | Ga0070685_10371612 | Ga0070685_103716121 | 221 |
| 37 | 3300005471 | Ga0070698_100001809 | Ga0070698_1000018096 | 221 |
| 38 | 3300005549 | Ga0070704_100286931 | Ga0070704_1002869312 | 221 |
| 39 | 3300005718 | Ga0068866_10272453 | Ga0068866_102724532 | 221 |
| 40 | 3300006051 | Ga0075364_10005690 | Ga0075364_100056904 | 221 |
| 41 | 3300006178 | Ga0075367_10050847 | Ga0075367_100508474 | 221 |
| 42 | 3300025921 | Ga0207652_10223284 | Ga0207652_102232842 | 221 |
| 43 | 3300026121 | Ga0207683_10002615 | Ga0207683_100026153 | 221 |
| 44 | 3300031901 | Ga0307406_10018493 | Ga0307406_100184934 | 221 |
| 45 | 3300032126 | Ga0307415_100085474 | Ga0307415_1000854741 | 221 |
| 46 | 3300037312 | Ga0395899_0007450 | Ga0395899_0007450_2848_3603 | 221 |
| 47 | 3300038443 | Ga0395901_0175694 | Ga0395901_0175694_1418_2173 | 221 |
| 48 | 3300039450 | Ga0436363_1117054 | Ga0436363_1117054_190_1023 | 221 |
| 49 | 3300041997 | Ga0439431_0006604 | Ga0439431_0006604_540_1367 | 221 |
| 50 | 3300044901 | Ga0466960_0000994 | Ga0466960_0000994_2285_3040 | 221 |
| 51 | 3300047472 | Ga0495686_0005496 | Ga0495686_0005496_349_1104 | 221 |
| 52 | 3300049571 | Ga0501034_0569662 | Ga0501034_0569662_214_969 | 221 |
| 53 | 3300049572 | Ga0501036_0444862 | Ga0501036_0444862_44_799 | 221 |
| 54 | 3300049579 | Ga0501043_0508014 | Ga0501043_0508014_28_783 | 221 |
| 55 | 3300049581 | Ga0501047_0021355 | Ga0501047_0021355_3388_4143 | 221 |
| 56 | 3300049581 | Ga0501047_0188913 | Ga0501047_0188913_18_773 | 221 |
| 57 | 3300049586 | Ga0501070_0090721 | Ga0501070_0090721_487_1242 | 221 |
| 58 | 3300049823 | Ga0501044_0048945 | Ga0501044_0048945_17_772 | 221 |
| 59 | 3300050491 | nmdc:mga00v17_119926_c1 | nmdc:mga00v17_119926_c1_26_817 | 221 |
| 60 | 3300050491 | nmdc:mga00v17_241178_c1 | nmdc:mga00v17_241178_c1_210_986 | 221 |
| 61 | 3300050494 | nmdc:mga06z11_125304_c1 | nmdc:mga06z11_125304_c1_345_1121 | 221 |
| 62 | 3300005437 | Ga0070710_10000002 | Ga0070710_10000002112 | 222 |
| 63 | 3300009148 | Ga0105243_10083781 | Ga0105243_100837813 | 222 |
| 64 | 3300025898 | Ga0207692_10000005 | Ga0207692_1000000512 | 222 |
| 65 | 3300044735 | Ga0466968_0006746 | Ga0466968_0006746_1324_2091 | 222 |
| 66 | 3300045976 | Ga0466967_0147932 | Ga0466967_0147932_209_967 | 222 |
| 67 | 3300048903 | Ga0496100_0000973 | Ga0496100_0000973_928_1686 | 222 |
| 68 | 3300048904 | Ga0496101_0004293 | Ga0496101_0004293_3620_4378 | 222 |
| 69 | 3300005435 | Ga0070714_100027005 | Ga0070714_1000270052 | 223 |
| 70 | 3300005444 | Ga0070694_100008979 | Ga0070694_1000089792 | 223 |
| 71 | 3300005445 | Ga0070708_100100341 | Ga0070708_1001003413 | 223 |
| 72 | 3300005468 | Ga0070707_100141940 | Ga0070707_1001419402 | 223 |
| 73 | 3300005471 | Ga0070698_100272551 | Ga0070698_1002725513 | 223 |
| 74 | 3300005471 | Ga0070698_100272679 | Ga0070698_1002726792 | 223 |
| 75 | 3300005545 | Ga0070695_100001699 | Ga0070695_1000016991 | 223 |
| 76 | 3300005937 | Ga0081455_10000459 | Ga0081455_1000045939 | 223 |
| 77 | 3300006844 | Ga0075428_100450959 | Ga0075428_1004509592 | 223 |
| 78 | 3300009147 | Ga0114129_11083315 | Ga0114129_110833152 | 223 |
| 79 | 3300025922 | Ga0207646_10102252 | Ga0207646_101022522 | 223 |
| 80 | 3300027526 | Ga0209968_1000934 | Ga0209968_10009342 | 223 |
| 81 | 3300027543 | Ga0209999_1006610 | Ga0209999_10066102 | 223 |
| 82 | 3300027614 | Ga0209970_1001518 | Ga0209970_10015182 | 223 |
| 83 | 3300027665 | Ga0209983_1003541 | Ga0209983_10035411 | 223 |
| 84 | 3300027682 | Ga0209971_1000203 | Ga0209971_100020315 | 223 |
| 85 | 3300027695 | Ga0209966_1000352 | Ga0209966_100035213 | 223 |
| 86 | 3300027717 | Ga0209998_10000156 | Ga0209998_100001567 | 223 |
| 87 | 3300042439 | Ga0439464_0029403 | Ga0439464_0029403_666_1427 | 223 |
| 88 | 3300042461 | Ga0439460_0078943 | Ga0439460_0078943_217_978 | 223 |
| 89 | 3300048911 | Ga0496108_0121590 | Ga0496108_0121590_1021_1782 | 223 |
| 90 | 3300048912 | Ga0496109_0008268 | Ga0496109_0008268_815_1576 | 223 |
| 91 | 3300049572 | Ga0501036_0327369 | Ga0501036_0327369_44_805 | 223 |
| 92 | 3300049574 | Ga0501038_0231191 | Ga0501038_0231191_386_1204 | 223 |
| 93 | 3300049575 | Ga0501039_0014768 | Ga0501039_0014768_2133_2951 | 223 |
| 94 | 3300049576 | Ga0501040_0002350 | Ga0501040_0002350_10028_10846 | 223 |
| 95 | 3300049576 | Ga0501040_0092131 | Ga0501040_0092131_425_1186 | 223 |
| 96 | 3300049577 | Ga0501041_0042630 | Ga0501041_0042630_1524_2342 | 223 |
| 97 | 3300049578 | Ga0501042_0186325 | Ga0501042_0186325_59_820 | 223 |
| 98 | 3300049580 | Ga0501046_0000084 | Ga0501046_0000084_97401_98219 | 223 |
| 99 | 3300049582 | Ga0501048_0035318 | Ga0501048_0035318_572_1390 | 223 |
| 100 | 3300049587 | Ga0501071_0149905 | Ga0501071_0149905_70_888 | 223 |
| 101 | 3300049589 | Ga0501073_0116240 | Ga0501073_0116240_829_1647 | 223 |
| 102 | 3300049591 | Ga0501075_0006855 | Ga0501075_0006855_6853_7671 | 223 |
| 103 | 3300049591 | Ga0501075_0047273 | Ga0501075_0047273_499_1260 | 223 |
| 104 | 3300049592 | Ga0501076_0011191 | Ga0501076_0011191_717_1535 | 223 |
| 105 | 3300049593 | Ga0501077_0028161 | Ga0501077_0028161_49_867 | 223 |
| 106 | 3300049593 | Ga0501077_0205701 | Ga0501077_0205701_425_1186 | 223 |
| 107 | 3300049742 | Ga0501080_0342468 | Ga0501080_0342468_374_1135 | 223 |
| 108 | 3300049743 | Ga0501081_0006568 | Ga0501081_0006568_5021_5839 | 223 |
| 109 | 3300049743 | Ga0501081_0403202 | Ga0501081_0403202_134_895 | 223 |
| 110 | 3300049824 | Ga0501045_0002899 | Ga0501045_0002899_10501_11319 | 223 |
| 111 | 3300050512 | nmdc:mga0n895_233776_c1 | nmdc:mga0n895_233776_c1_902_1663 | 223 |
| 112 | 3300054114 | Ga0501084_0274011 | Ga0501084_0274011_324_1085 | 223 |
| 113 | 3300060353 | Ga0501082_0000528 | Ga0501082_0000528_3739_4557 | 223 |
| 114 | 3300061734 | Ga0530510_0195056 | Ga0530510_0195056_470_1231 | 223 |
| 115 | 3300061734 | Ga0530510_0278531 | Ga0530510_0278531_109_837 | 223 |
| 116 | 3300005435 | Ga0070714_100015168 | Ga0070714_1000151683 | 224 |
| 117 | 3300005435 | Ga0070714_100037894 | Ga0070714_1000378943 | 224 |
| 118 | 3300005436 | Ga0070713_100000720 | Ga0070713_1000007204 | 224 |
| 119 | 3300005437 | Ga0070710_10000371 | Ga0070710_100003714 | 224 |
| 120 | 3300005439 | Ga0070711_100001527 | Ga0070711_1000015276 | 224 |
| 121 | 3300005467 | Ga0070706_100145659 | Ga0070706_1001456591 | 224 |
| 122 | 3300005468 | Ga0070707_100021636 | Ga0070707_1000216361 | 224 |
| 123 | 3300005471 | Ga0070698_100093359 | Ga0070698_1000933591 | 224 |
| 124 | 3300006028 | Ga0070717_10007260 | Ga0070717_100072606 | 224 |
| 125 | 3300006173 | Ga0070716_100000224 | Ga0070716_1000002246 | 224 |
| 126 | 3300006175 | Ga0070712_100001576 | Ga0070712_1000015763 | 224 |
| 127 | 3300025297 | Ga0209758_1023976 | Ga0209758_10239762 | 224 |
| 128 | 3300025302 | Ga0207426_1038626 | Ga0207426_10386262 | 224 |
| 129 | 3300025898 | Ga0207692_10000351 | Ga0207692_1000035110 | 224 |
| 130 | 3300025906 | Ga0207699_10005948 | Ga0207699_100059484 | 224 |
| 131 | 3300025915 | Ga0207693_10001227 | Ga0207693_1000122712 | 224 |
| 132 | 3300025916 | Ga0207663_10010654 | Ga0207663_100106542 | 224 |
| 133 | 3300025922 | Ga0207646_10013388 | Ga0207646_100133883 | 224 |
| 134 | 3300025928 | Ga0207700_10000573 | Ga0207700_100005734 | 224 |
| 135 | 3300025929 | Ga0207664_10000689 | Ga0207664_100006897 | 224 |
| 136 | 3300025939 | Ga0207665_10000475 | Ga0207665_1000047512 | 224 |
| 137 | 3300033180 | Ga0307510_10259362 | Ga0307510_102593622 | 224 |
| 138 | 3300037466 | Ga0395898_0023132 | Ga0395898_0023132_4771_5535 | 224 |
| 139 | 3300042007 | Ga0439449_0015364 | Ga0439449_0015364_331_1095 | 224 |
| 140 | 3300044658 | Ga0466972_0120266 | Ga0466972_0120266_345_1118 | 224 |
| 141 | 3300044719 | Ga0466971_0059567 | Ga0466971_0059567_225_989 | 224 |
| 142 | 3300044901 | Ga0466960_0015824 | Ga0466960_0015824_1150_1932 | 224 |
| 143 | 3300046559 | Ga0495667_0426255 | Ga0495667_0426255_58_822 | 224 |
| 144 | 3300047323 | Ga0495683_0002748 | Ga0495683_0002748_2816_3580 | 224 |
| 145 | 3300047443 | Ga0495687_000577 | Ga0495687_000577_445_1227 | 224 |
| 146 | 3300047447 | Ga0495685_001653 | Ga0495685_001653_910_1692 | 224 |
| 147 | 3300049578 | Ga0501042_0047192 | Ga0501042_0047192_2206_2979 | 224 |
| 148 | 3300049581 | Ga0501047_0000023 | Ga0501047_0000023_199342_200115 | 224 |
| 149 | 3300049823 | Ga0501044_0429614 | Ga0501044_0429614_43_816 | 224 |
| 150 | 3300005439 | Ga0070711_100352447 | Ga0070711_1003524471 | 225 |
| 151 | 3300005445 | Ga0070708_100136245 | Ga0070708_1001362452 | 225 |
| 152 | 3300005467 | Ga0070706_100014020 | Ga0070706_1000140204 | 225 |
| 153 | 3300005468 | Ga0070707_100020763 | Ga0070707_1000207631 | 225 |
| 154 | 3300025916 | Ga0207663_10441592 | Ga0207663_104415921 | 225 |
| 155 | 3300031824 | Ga0307413_10612140 | Ga0307413_106121401 | 225 |
| 156 | 3300031901 | Ga0307406_10075502 | Ga0307406_100755022 | 225 |
| 157 | 3300037853 | Ga0436364_0168363 | Ga0436364_0168363_1035_1805 | 225 |
| 158 | 3300044842 | Ga0466957_0399363 | Ga0466957_0399363_94_873 | 225 |
| 159 | iso_pu_bacteria | 2643221692 | 2644513973 | 225 |
| 160 | 3300005718 | Ga0068866_10151164 | Ga0068866_101511642 | 226 |
| 161 | 3300006844 | Ga0075428_100127406 | Ga0075428_1001274063 | 226 |
| 162 | 3300006844 | Ga0075428_100143016 | Ga0075428_1001430162 | 226 |
| 163 | 3300006852 | Ga0075433_10031317 | Ga0075433_100313175 | 226 |
| 164 | 3300006852 | Ga0075433_10075741 | Ga0075433_100757415 | 226 |
| 165 | 3300006871 | Ga0075434_100072804 | Ga0075434_1000728045 | 226 |
| 166 | 3300006871 | Ga0075434_100189670 | Ga0075434_1001896702 | 226 |
| 167 | 3300009094 | Ga0111539_10000446 | Ga0111539_1000044634 | 226 |
| 168 | 3300009094 | Ga0111539_10011435 | Ga0111539_100114359 | 226 |
| 169 | 3300025933 | Ga0207706_10047357 | Ga0207706_100473573 | 226 |
| 170 | 3300027907 | Ga0207428_10003284 | Ga0207428_100032848 | 226 |
| 171 | 3300031251 | Ga0265327_10028410 | Ga0265327_100284101 | 226 |
| 172 | 3300031731 | Ga0307405_10427136 | Ga0307405_104271362 | 226 |
| 173 | 3300031901 | Ga0307406_10017189 | Ga0307406_100171893 | 226 |
| 174 | 3300042876 | Ga0451577_0002182 | Ga0451577_0002182_16600_17373 | 226 |
| 175 | 3300044673 | Ga0453683_0017655 | Ga0453683_0017655_670_1443 | 226 |
| 176 | 3300044694 | Ga0466963_0045195 | Ga0466963_0045195_784_1572 | 226 |
| 177 | 3300044694 | Ga0466963_0078488 | Ga0466963_0078488_1076_1855 | 226 |
| 178 | 3300044706 | Ga0466964_0052001 | Ga0466964_0052001_626_1405 | 226 |
| 179 | 3300044712 | Ga0453684_0008392 | Ga0453684_0008392_6712_7485 | 226 |
| 180 | 3300045051 | Ga0451576_0002647 | Ga0451576_0002647_8174_8947 | 226 |
| 181 | 3300045836 | Ga0466958_0199676 | Ga0466958_0199676_182_970 | 226 |
| 182 | 3300050491 | nmdc:mga00v17_124785_c1 | nmdc:mga00v17_124785_c1_770_1549 | 226 |
| 183 | 3300050511 | nmdc:mga08y16_2861_c1 | nmdc:mga08y16_2861_c1_10923_11696 | 226 |
| 184 | 3300050511 | nmdc:mga08y16_81814_c1 | nmdc:mga08y16_81814_c1_1226_1999 | 226 |
| 185 | 3300050512 | nmdc:mga0n895_247591_c1 | nmdc:mga0n895_247591_c1_94_867 | 226 |
| 186 | 3300050512 | nmdc:mga0n895_42765_c1 | nmdc:mga0n895_42765_c1_269_1042 | 226 |
| 187 | 3300050512 | nmdc:mga0n895_492734_c1 | nmdc:mga0n895_492734_c1_110_883 | 226 |
| 188 | 3300050515 | nmdc:mga0a205_1677_c1 | nmdc:mga0a205_1677_c1_2675_3448 | 226 |
| 189 | 3300050515 | nmdc:mga0a205_35284_c1 | nmdc:mga0a205_35284_c1_1071_1844 | 226 |
| 190 | 3300053153 | Ga0500616_0124112 | Ga0500616_0124112_302_1108 | 226 |
| 191 | 3300005614 | Ga0068856_100296568 | Ga0068856_1002965683 | 227 |
| 192 | 3300020070 | Ga0206356_10256915 | Ga0206356_102569152 | 227 |
| 193 | 3300025912 | Ga0207707_10009634 | Ga0207707_100096347 | 227 |
| 194 | 3300025912 | Ga0207707_10030343 | Ga0207707_100303435 | 227 |
| 195 | 3300038443 | Ga0395901_0186661 | Ga0395901_0186661_344_1144 | 227 |
| 196 | 3300039453 | Ga0436362_1119315 | Ga0436362_1119315_841_1695 | 227 |
| 197 | 3300048905 | Ga0496102_0040010 | Ga0496102_0040010_65_862 | 228 |
| 198 | 3300005347 | Ga0070668_100020223 | Ga0070668_1000202236 | 232 |
| 199 | 3300005356 | Ga0070674_100136299 | Ga0070674_1001362992 | 232 |
| 200 | 3300005459 | Ga0068867_100141913 | Ga0068867_1001419133 | 232 |
| 201 | 3300005543 | Ga0070672_100170965 | Ga0070672_1001709652 | 232 |
| 202 | 3300028381 | Ga0268264_10437454 | Ga0268264_104374542 | 232 |
| 203 | 3300005353 | Ga0070669_100149269 | Ga0070669_1001492692 | 233 |
| 204 | 3300005844 | Ga0068862_100229824 | Ga0068862_1002298242 | 233 |
| 205 | 3300009553 | Ga0105249_10096278 | Ga0105249_100962783 | 233 |
| 206 | 3300013308 | Ga0157375_10557242 | Ga0157375_105572422 | 233 |
| 207 | 3300017792 | Ga0163161_10058570 | Ga0163161_100585703 | 233 |
| 208 | 3300046539 | Ga0495621_0058957 | Ga0495621_0058957_176_991 | 233 |
| 209 | 3300046674 | Ga0495588_0000001 | Ga0495588_0000001_1450100_1450951 | 236 |
| 210 | 3300005330 | Ga0070690_100069978 | Ga0070690_1000699783 | 241 |
| 211 | 3300005331 | Ga0070670_100220793 | Ga0070670_1002207932 | 241 |
| 212 | 3300005333 | Ga0070677_10023487 | Ga0070677_100234871 | 241 |
| 213 | 3300005334 | Ga0068869_100030798 | Ga0068869_1000307982 | 241 |
| 214 | 3300005343 | Ga0070687_100026371 | Ga0070687_1000263713 | 241 |
| 215 | 3300005354 | Ga0070675_100000243 | Ga0070675_1000002437 | 241 |
| 216 | 3300005355 | Ga0070671_100006003 | Ga0070671_1000060037 | 241 |
| 217 | 3300005364 | Ga0070673_100010639 | Ga0070673_1000106395 | 241 |
| 218 | 3300005365 | Ga0070688_100012924 | Ga0070688_1000129245 | 241 |
| 219 | 3300005367 | Ga0070667_100010689 | Ga0070667_1000106893 | 241 |
| 220 | 3300005456 | Ga0070678_100003356 | Ga0070678_1000033563 | 241 |
| 221 | 3300005457 | Ga0070662_100030422 | Ga0070662_1000304224 | 241 |
| 222 | 3300005459 | Ga0068867_100174503 | Ga0068867_1001745032 | 241 |
| 223 | 3300005543 | Ga0070672_100052314 | Ga0070672_1000523143 | 241 |
| 224 | 3300005617 | Ga0068859_100000664 | Ga0068859_10000066423 | 241 |
| 225 | 3300005618 | Ga0068864_100000649 | Ga0068864_10000064919 | 241 |
| 226 | 3300005841 | Ga0068863_100014376 | Ga0068863_1000143763 | 241 |
| 227 | 3300005842 | Ga0068858_100000753 | Ga0068858_10000075317 | 241 |
| 228 | 3300006237 | Ga0097621_100163804 | Ga0097621_1001638042 | 241 |
| 229 | 3300006358 | Ga0068871_100077007 | Ga0068871_1000770073 | 241 |
| 230 | 3300006931 | Ga0097620_100000664 | Ga0097620_10000066423 | 241 |
| 231 | 3300009177 | Ga0105248_10011097 | Ga0105248_100110976 | 241 |
| 232 | 3300013296 | Ga0157374_10044666 | Ga0157374_100446664 | 241 |
| 233 | 3300013297 | Ga0157378_10116962 | Ga0157378_101169623 | 241 |
| 234 | 3300013306 | Ga0163162_10145689 | Ga0163162_101456893 | 241 |
| 235 | 3300013308 | Ga0157375_10083417 | Ga0157375_100834172 | 241 |
| 236 | 3300014325 | Ga0163163_10024826 | Ga0163163_100248266 | 241 |
| 237 | 3300014745 | Ga0157377_10041560 | Ga0157377_100415603 | 241 |
| 238 | 3300014968 | Ga0157379_10000301 | Ga0157379_1000030110 | 241 |
| 239 | 3300014969 | Ga0157376_10508880 | Ga0157376_105088802 | 241 |
| 240 | 3300017792 | Ga0163161_10144004 | Ga0163161_101440042 | 241 |
| 241 | 3300025893 | Ga0207682_10105680 | Ga0207682_101056802 | 241 |
| 242 | 3300025903 | Ga0207680_10000566 | Ga0207680_1000056610 | 241 |
| 243 | 3300025907 | Ga0207645_10037446 | Ga0207645_100374462 | 241 |
| 244 | 3300025908 | Ga0207643_10065983 | Ga0207643_100659831 | 241 |
| 245 | 3300025925 | Ga0207650_10199857 | Ga0207650_101998572 | 241 |
| 246 | 3300025926 | Ga0207659_10000413 | Ga0207659_1000041313 | 241 |
| 247 | 3300025931 | Ga0207644_10010403 | Ga0207644_100104033 | 241 |
| 248 | 3300025933 | Ga0207706_10025812 | Ga0207706_100258126 | 241 |
| 249 | 3300025937 | Ga0207669_10045342 | Ga0207669_100453423 | 241 |
| 250 | 3300025940 | Ga0207691_10218425 | Ga0207691_102184252 | 241 |
| 251 | 3300025941 | Ga0207711_10008859 | Ga0207711_100088595 | 241 |
| 252 | 3300025942 | Ga0207689_10015963 | Ga0207689_100159632 | 241 |
| 253 | 3300025960 | Ga0207651_10004313 | Ga0207651_100043134 | 241 |
| 254 | 3300025986 | Ga0207658_10093195 | Ga0207658_100931952 | 241 |
| 255 | 3300026023 | Ga0207677_10001957 | Ga0207677_100019579 | 241 |
| 256 | 3300026035 | Ga0207703_10002030 | Ga0207703_1000203021 | 241 |
| 257 | 3300026088 | Ga0207641_10005904 | Ga0207641_100059049 | 241 |
| 258 | 3300026089 | Ga0207648_10219244 | Ga0207648_102192442 | 241 |
| 259 | 3300026095 | Ga0207676_10000325 | Ga0207676_1000032521 | 241 |
| 260 | 3300026118 | Ga0207675_100072051 | Ga0207675_1000720511 | 241 |
| 261 | 3300026118 | Ga0207675_100315128 | Ga0207675_1003151282 | 241 |
| 262 | 3300026121 | Ga0207683_10008809 | Ga0207683_100088093 | 241 |
| 263 | 3300026142 | Ga0207698_10047812 | Ga0207698_100478121 | 241 |
| 264 | 3300028381 | Ga0268264_10079255 | Ga0268264_100792553 | 241 |
| 265 | 3300048904 | Ga0496101_0439822 | Ga0496101_0439822_134_949 | 241 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6xyw-assembly1.cif.gz_BE | structure of the plant mitochondrial ribosome | 0.8124 | 4 | 160 |
| 3t8b-assembly1.cif.gz_B | crystal structure of mycobacterium tuberculosis menb with altered hexameric assembly | 0.7956 | 1 | 172 |
| 7uzj-assembly1.cif.gz_L | rat kidney v1 complex with sidk and ncoa7b, state 1 | 0.7907 | 30 | 53 |
| 1wdm-assembly1.cif.gz_B | fatty acid beta-oxidation multienzyme complex from pseudomonas fragi, form i (native3) | 0.7693 | 1 | 229 |
| 1wdm-assembly1.cif.gz_A | fatty acid beta-oxidation multienzyme complex from pseudomonas fragi, form i (native3) | 0.7663 | 1 | 229 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3rsiC01 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3; | 0.9598 | 1 | 59 | 3.30.300.220 |
| 3rsiC01 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3; | 0.9444 | 1 | 59 | 3.30.300.220 |
| af_P31551_1_198_3.90.226.10 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.9018 | 1 | 170 | 3.90.226.10 |
| af_O06536_1_113_3.90.226.10 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.8981 | 14 | 136 | 3.90.226.10 |
| 3r9sB01 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.8963 | 1 | 170 | 3.90.226.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1K2F691-F1-model_v4 | Enoyl-CoA hydratase/isomerase | 0.9938 | 1 | 67 |
GO:0006631
GO:0016853 |
| AF-A0A0F8Y2U9-F1-model_v4 | Enoyl-CoA hydratase | 0.9921 | 1 | 64 |
GO:0004165
GO:0005777 |
| AF-A0A7Y1TAP8-F1-model_v4 | Enoyl-CoA hydratase (EC 4.2.1.17) | 0.9836 | 3 | 163 |
GO:0004300
|
| AF-A0A4V1V7M4-F1-model_v4 | Enoyl-CoA hydratase/isomerase family protein | 0.9798 | 1 | 70 |
GO:0008300
GO:0016853 |
| AF-A0A7X9Q1G4-F1-model_v4 | Enoyl-CoA hydratase (EC 4.2.1.17) | 0.9788 | 3 | 115 |
GO:0004300
GO:0006631 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar