F373430

General Info

Members Datasets Scaffolds Average Seq Length
265 166 530 182

Family's Representative Sequence

Representative Sequence 3300031711|Ga0265314_10020553|Ga0265314_100205536
Length 197
Sequence VRRVSAKENHTMASPFSHAVAALSIGTCFYRPQIPKRMWIAGAVCSVIPDLDVIGFRFGIHYGDFWGHRGFTHSLVFAALLAGVVTVVLFRLGTSEIGRFALFAYLFLATASHGVLDAMTNGGLGVAFFSPFDNRRYFLPWRPILVSPIAVTRFFSPRGYAILRCELLWIWLPAILFGSMLLMLRRKSQPDVAIPNE

Samples

Sample ID Description Type Environment
1 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
57 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
58 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
59 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
91 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
127 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
128 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
129 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
130 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
131 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
132 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
133 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
134 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
135 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
136 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
137 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
138 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
139 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
140 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
141 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
142 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
143 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
144 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
145 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
150 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
151 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
152 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
153 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
154 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
155 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
156 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
157 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
158 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
159 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
160 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
161 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
162 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
163 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
164 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
165 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
166 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.66
Rhizosphere 94.34
Stem 0
Stem Tuber 0
Unclassified 20.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265314_10020553 3300031711 Bacteria 5096
2 MRS1b_contig_9336606 2162886011 Unclassified 887
3 LJNas_1001160 3300000546 Bacteria 4007
4 Ga0065712_10245468 3300005290 Unclassified 973
5 Ga0065715_10103636 3300005293 Bacteria 3019
6 Ga0070683_100023279 3300005329 Bacteria 5540
7 Ga0070670_100073525 3300005331 Bacteria 2936
8 Ga0068869_100568796 3300005334 Unclassified 954
9 Ga0070666_10126803 3300005335 Bacteria 1772
10 Ga0070680_100034030 3300005336 Bacteria 4109
11 Ga0070680_100283779 3300005336 Unclassified 1403
12 Ga0070682_100159125 3300005337 Bacteria 1558
13 Ga0068868_100144700 3300005338 Bacteria 1954
14 Ga0068868_100178844 3300005338 Bacteria 1759
15 Ga0070660_100320011 3300005339 Unclassified 1274
16 Ga0070691_10082783 3300005341 Bacteria 1573
17 Ga0070691_10118485 3300005341 Bacteria 1331
18 Ga0070661_100015432 3300005344 Bacteria 5392
19 Ga0070669_101072059 3300005353 Bacteria 693
20 Ga0070671_100219155 3300005355 Bacteria 1614
21 Ga0070673_100081929 3300005364 Bacteria 2618
22 Ga0070688_100318096 3300005365 Unclassified 1130
23 Ga0070667_100601293 3300005367 Unclassified 1013
24 Ga0070714_100304072 3300005435 Bacteria 1488
25 Ga0070713_100024957 3300005436 Bacteria 4665
26 Ga0070713_100099539 3300005436 Bacteria 2515
27 Ga0070713_100105692 3300005436 Unclassified 2446
28 Ga0070711_101075086 3300005439 Unclassified 692
29 Ga0070705_101181907 3300005440 Unclassified 629
30 Ga0070708_100059514 3300005445 Bacteria 3406
31 Ga0070708_100074500 3300005445 Bacteria 3062
32 Ga0070708_100160096 3300005445 Bacteria 2097
33 Ga0070708_100887638 3300005445 Bacteria 837
34 Ga0070681_10000205 3300005458 Bacteria 46132
35 Ga0070681_10000295 3300005458 Bacteria 40358
36 Ga0070681_10196257 3300005458 Bacteria 1937
37 Ga0068867_100117324 3300005459 Bacteria 2052
38 Ga0070685_10473501 3300005466 Bacteria 881
39 Ga0070706_100077308 3300005467 Bacteria 3081
40 Ga0070706_100450052 3300005467 Bacteria 1198
41 Ga0070706_100451059 3300005467 Bacteria 1197
42 Ga0070707_100579865 3300005468 Unclassified 1084
43 Ga0070707_100620133 3300005468 Unclassified 1044
44 Ga0070707_100691401 3300005468 Bacteria 983
45 Ga0070698_100104578 3300005471 Bacteria 2801
46 Ga0070698_100565209 3300005471 Bacteria 1077
47 Ga0070699_100150729 3300005518 Bacteria 2056
48 Ga0070679_100017252 3300005530 Bacteria 6984
49 Ga0070679_100023311 3300005530 Bacteria 6057
50 Ga0070679_100088897 3300005530 Bacteria 3076
51 Ga0070679_100210159 3300005530 Bacteria 1910
52 Ga0070684_100096266 3300005535 Bacteria 2638
53 Ga0070684_100139299 3300005535 Bacteria 2193
54 Ga0070697_100311372 3300005536 Bacteria 1355
55 Ga0068853_100025935 3300005539 Bacteria 4919
56 Ga0068853_100396920 3300005539 Bacteria 1290
57 Ga0070695_100292484 3300005545 Unclassified 1201
58 Ga0070695_100545656 3300005545 Bacteria 903
59 Ga0070696_100053063 3300005546 Unclassified 2821
60 Ga0070693_100006088 3300005547 Bacteria 5843
61 Ga0070665_100001184 3300005548 Bacteria 31842
62 Ga0070665_100143452 3300005548 Bacteria 2391
63 Ga0070704_100317842 3300005549 Unclassified 1303
64 Ga0070704_100736394 3300005549 Bacteria 877
65 Ga0068855_100000372 3300005563 Bacteria 55390
66 Ga0068855_100016134 3300005563 Bacteria 8982
67 Ga0070664_100006148 3300005564 Bacteria 9710
68 Ga0068857_100000581 3300005577 Bacteria 26730
69 Ga0068857_100002330 3300005577 Bacteria 15443
70 Ga0068857_100039430 3300005577 Bacteria 4184
71 Ga0068854_100027841 3300005578 Unclassified 3898
72 Ga0068856_100001026 3300005614 Bacteria 29725
73 Ga0068856_100001279 3300005614 Bacteria 26465
74 Ga0068852_100016121 3300005616 Bacteria 5817
75 Ga0068859_100338241 3300005617 Unclassified 1599
76 Ga0068861_100117010 3300005719 Bacteria 2144
77 Ga0068861_100348517 3300005719 Bacteria 1298
78 Ga0068861_101113781 3300005719 Unclassified 759
79 Ga0068851_10017903 3300005834 Unclassified 3410
80 Ga0068863_100030260 3300005841 Bacteria 5171
81 Ga0068863_100222227 3300005841 Bacteria 1820
82 Ga0068858_100008527 3300005842 Bacteria 9849
83 Ga0068858_100020656 3300005842 Bacteria 6152
84 Ga0068858_100399945 3300005842 Bacteria 1320
85 Ga0068860_100033173 3300005843 Bacteria 4956
86 Ga0068860_100398987 3300005843 Unclassified 1360
87 Ga0068862_100087112 3300005844 Bacteria 2716
88 Ga0081455_10665551 3300005937 Bacteria 668
89 Ga0070717_10059351 3300006028 Bacteria 3165
90 Ga0070715_10222572 3300006163 Bacteria 971
91 Ga0070716_100364457 3300006173 Unclassified 1027
92 Ga0070712_100051037 3300006175 Bacteria 2880
93 Ga0097621_100000064 3300006237 Bacteria 54855
94 Ga0097621_100000851 3300006237 Bacteria 21527
95 Ga0097621_100180171 3300006237 Bacteria 1826
96 Ga0068871_100000224 3300006358 Bacteria 39982
97 Ga0068871_100001111 3300006358 Bacteria 18051
98 Ga0075428_100068363 3300006844 Bacteria 3886
99 Ga0075428_100299763 3300006844 Bacteria 1728
100 Ga0075428_100390207 3300006844 Bacteria 1492
101 Ga0075428_100452095 3300006844 Bacteria 1376
102 Ga0075431_100265091 3300006847 Bacteria 1742
103 Ga0075433_10144693 3300006852 Bacteria 2113
104 Ga0075433_10184633 3300006852 Bacteria 1855
105 Ga0075433_10246543 3300006852 Bacteria 1585
106 Ga0075433_10661703 3300006852 Bacteria 915
107 Ga0075434_100014933 3300006871 Bacteria 7431
108 Ga0075434_100115394 3300006871 Bacteria 2698
109 Ga0075434_102001361 3300006871 Bacteria 585
110 Ga0075429_100335869 3300006880 Bacteria 1322
111 Ga0068865_100023075 3300006881 Bacteria 4069
112 Ga0068865_100121930 3300006881 Unclassified 1940
113 Ga0068865_100462606 3300006881 Unclassified 1051
114 Ga0075436_100073847 3300006914 Bacteria 2361
115 Ga0097620_100338243 3300006931 Unclassified 1599
116 Ga0075435_100104679 3300007076 Bacteria 2348
117 Ga0075435_100631450 3300007076 Unclassified 929
118 Ga0105240_10636459 3300009093 Bacteria 1171
119 Ga0105240_10781676 3300009093 Unclassified 1035
120 Ga0105247_10063661 3300009101 Bacteria 2290
121 Ga0105247_10210748 3300009101 Unclassified 1310
122 Ga0114129_10033027 3300009147 Bacteria 7313
123 Ga0114129_10465564 3300009147 Bacteria 1656
124 Ga0105241_10244662 3300009174 Unclassified 1518
125 Ga0105241_10254261 3300009174 Bacteria 1491
126 Ga0105242_10234221 3300009176 Unclassified 1647
127 Ga0105248_10550175 3300009177 Bacteria 1302
128 Ga0105248_11405183 3300009177 Unclassified 790
129 Ga0105238_10000073 3300009551 Bacteria 112101
130 Ga0105249_10507103 3300009553 Bacteria 1252
131 Ga0105239_10132780 3300010375 Unclassified 2770
132 Ga0105246_10051680 3300011119 Bacteria 2823
133 Ga0157369_10198332 3300013105 Bacteria 2107
134 Ga0157369_10426242 3300013105 Bacteria 1375
135 Ga0157374_10000326 3300013296 Bacteria 44006
136 Ga0157374_10030433 3300013296 Bacteria 4901
137 Ga0157378_10000323 3300013297 Bacteria 47134
138 Ga0163162_10023094 3300013306 Bacteria 6135
139 Ga0163162_11133585 3300013306 Bacteria 887
140 Ga0157372_10345094 3300013307 Bacteria 1735
141 Ga0157372_10385478 3300013307 Unclassified 1633
142 Ga0157372_11193684 3300013307 Bacteria 879
143 Ga0157375_10453822 3300013308 Unclassified 1447
144 Ga0157375_10655993 3300013308 Unclassified 1205
145 Ga0157375_11580749 3300013308 Bacteria 775
146 Ga0163163_10619761 3300014325 Bacteria 1145
147 Ga0157379_10035599 3300014968 Bacteria 4439
148 Ga0157379_10072516 3300014968 Unclassified 3081
149 Ga0157379_10338664 3300014968 Unclassified 1375
150 Ga0157376_10052755 3300014969 Bacteria 3382
151 Ga0224572_1003998 3300024225 Unclassified 2534
152 Ga0207697_10009589 3300025315 Bacteria 4175
153 Ga0207710_10147469 3300025900 Bacteria 1139
154 Ga0207684_10122525 3300025910 Bacteria 2229
155 Ga0207684_10675500 3300025910 Bacteria 879
156 Ga0207684_10726478 3300025910 Unclassified 843
157 Ga0207654_10027781 3300025911 Bacteria 3079
158 Ga0207707_10004062 3300025912 Bacteria 12962
159 Ga0207707_10004214 3300025912 Bacteria 12729
160 Ga0207695_10009574 3300025913 Bacteria 11972
161 Ga0207695_10508182 3300025913 Bacteria 1087
162 Ga0207671_10077305 3300025914 Bacteria 2491
163 Ga0207693_10034876 3300025915 Bacteria 3968
164 Ga0207660_10234937 3300025917 Bacteria 1442
165 Ga0207657_10299432 3300025919 Unclassified 1274
166 Ga0207649_10004772 3300025920 Bacteria 7331
167 Ga0207652_10037748 3300025921 Bacteria 4090
168 Ga0207652_10329225 3300025921 Bacteria 1379
169 Ga0207652_10392636 3300025921 Bacteria 1252
170 Ga0207646_10580562 3300025922 Bacteria 1007
171 Ga0207646_10589812 3300025922 Unclassified 998
172 Ga0207681_10518307 3300025923 Bacteria 978
173 Ga0207694_10662267 3300025924 Unclassified 880
174 Ga0207650_10038545 3300025925 Bacteria 3491
175 Ga0207659_10518400 3300025926 Bacteria 1010
176 Ga0207700_10107392 3300025928 Bacteria 2240
177 Ga0207700_10150915 3300025928 Bacteria 1920
178 Ga0207644_10184742 3300025931 Bacteria 1636
179 Ga0207704_10032760 3300025938 Bacteria 2946
180 Ga0207704_10127230 3300025938 Unclassified 1756
181 Ga0207711_10042353 3300025941 Bacteria 3880
182 Ga0207661_10114418 3300025944 Bacteria 2287
183 Ga0207679_10040919 3300025945 Bacteria 3320
184 Ga0207679_10232348 3300025945 Bacteria 1558
185 Ga0207667_10018842 3300025949 Bacteria 7728
186 Ga0207640_10036483 3300025981 Bacteria 3087
187 Ga0207658_10499906 3300025986 Bacteria 1083
188 Ga0207677_10092266 3300026023 Bacteria 2205
189 Ga0207703_10016424 3300026035 Bacteria 5773
190 Ga0207703_10119456 3300026035 Bacteria 2261
191 Ga0207639_10067577 3300026041 Bacteria 2781
192 Ga0207639_10355858 3300026041 Bacteria 1309
193 Ga0207702_10005465 3300026078 Bacteria 11119
194 Ga0207702_10051151 3300026078 Unclassified 3490
195 Ga0207641_10687489 3300026088 Bacteria 1007
196 Ga0207674_10000678 3300026116 Bacteria 44204
197 Ga0207674_10007764 3300026116 Bacteria 12481
198 Ga0207674_10050414 3300026116 Bacteria 4253
199 Ga0207698_10009957 3300026142 Bacteria 6081
200 Ga0207698_11098256 3300026142 Bacteria 808
201 Ga0268266_10000194 3300028379 Bacteria 106020
202 Ga0268266_10011363 3300028379 Bacteria 7742
203 Ga0268264_10024146 3300028381 Bacteria 4962
204 Ga0268264_10362081 3300028381 Unclassified 1384
205 Ga0265326_10021421 3300028558 Bacteria 1853
206 Ga0265324_10000041 3300029957 Bacteria 113679
207 Ga0373957_0377262 3300035120 Unclassified 608
208 Ga0395900_1011363 3300037418 Bacteria 751
209 Ga0451802_1347406 3300041460 Unclassified 661
210 Ga0466963_0052346 3300044694 Bacteria 2709
211 Ga0466964_0476446 3300044706 Bacteria 666
212 Ga0495580_0178227 3300046472 Bacteria 1468
213 Ga0495594_0031559 3300046499 Bacteria 2873
214 Ga0496100_0764660 3300048903 Unclassified 756
215 Ga0496102_0001393 3300048905 Bacteria 21478
216 Ga0496102_0044954 3300048905 Unclassified 4008
217 Ga0496103_0086059 3300048906 Unclassified 1981
218 Ga0496104_0076213 3300048907 Bacteria 3194
219 Ga0496104_0212870 3300048907 Bacteria 1844
220 Ga0496104_0309394 3300048907 Unclassified 1493
221 Ga0496104_0375719 3300048907 Bacteria 1334
222 Ga0496106_0143384 3300048909 Bacteria 1880
223 Ga0496107_0555263 3300048910 Unclassified 850
224 Ga0496109_0084369 3300048912 Bacteria 2931
225 Ga0496110_0459139 3300048913 Unclassified 1161
226 Ga0496112_0072924 3300048915 Bacteria 3394
227 Ga0496114_0335271 3300048917 Bacteria 1337
228 Ga0501040_0008913 3300049576 Bacteria 6525
229 Ga0501041_0067524 3300049577 Bacteria 2192
230 Ga0501046_0863541 3300049580 Unclassified 632
231 Ga0501048_0080685 3300049582 Bacteria 2295
232 Ga0501048_0845208 3300049582 Bacteria 658
233 Ga0501071_0319663 3300049587 Bacteria 1179
234 Ga0501072_0005238 3300049588 Bacteria 9873
235 Ga0501075_0095911 3300049591 Bacteria 2251
236 Ga0501079_0301336 3300049741 Bacteria 1254
237 Ga0501079_0332017 3300049741 Bacteria 1191
238 Ga0501081_0064723 3300049743 Bacteria 2540
239 Ga0501081_0221791 3300049743 Bacteria 1375
240 Ga0501045_0259141 3300049824 Bacteria 1294
241 nmdc:mga05p37_112224_c1 3300050507 Bacteria 3352
242 nmdc:mga05p37_126676_c1 3300050507 Bacteria 3136
243 nmdc:mga05p37_173217_c1 3300050507 Bacteria 2631
244 nmdc:mga05p37_549087_c1 3300050507 Bacteria 1315
245 nmdc:mga05p37_84688_c1 3300050507 Bacteria 3906
246 nmdc:mga09592_92784_c1 3300050508 Bacteria 2581
247 nmdc:mga08y16_693479_c1 3300050511 Bacteria 1019
248 nmdc:mga08y16_913686_c1 3300050511 Bacteria 863
249 nmdc:mga0n895_17045_c1 3300050512 Bacteria 6686
250 nmdc:mga0n895_20208_c1 3300050512 Bacteria 6206
251 nmdc:mga0n895_285957_c1 3300050512 Bacteria 1672
252 nmdc:mga0n895_405692_c1 3300050512 Bacteria 1378
253 nmdc:mga0rr50_4850_c1 3300050513 Bacteria 7953
254 nmdc:mga0rr50_79476_c1 3300050513 Bacteria 2526
255 nmdc:mga08x19_53727_c1 3300050514 Unclassified 2592
256 nmdc:mga0a205_129651_c1 3300050515 Bacteria 2422
257 nmdc:mga0a205_136703_c1 3300050515 Bacteria 2351
258 nmdc:mga0a205_314964_c1 3300050515 Bacteria 1436
259 nmdc:mga0a205_331308_c1 3300050515 Bacteria 1392
260 Ga0501084_0869624 3300054114 Unclassified 758
261 Ga0590071_002226 3300059421 Bacteria 4928
262 Ga0590077_020157 3300059426 Bacteria 1415
263 Ga0501082_0128325 3300060353 Bacteria 2200
264 Ga0530510_0148963 3300061734 Bacteria 1727
265 Ga0530510_0855380 3300061734 Bacteria 694
266 Ga0265314_10020553
267 MRS1b_contig_9336606
268 LJNas_1001160
269 Ga0065712_10245468
270 Ga0065715_10103636
271 Ga0070683_100023279
272 Ga0070670_100073525
273 Ga0068869_100568796
274 Ga0070666_10126803
275 Ga0070680_100034030
276 Ga0070680_100283779
277 Ga0070682_100159125
278 Ga0068868_100144700
279 Ga0068868_100178844
280 Ga0070660_100320011
281 Ga0070691_10082783
282 Ga0070691_10118485
283 Ga0070661_100015432
284 Ga0070669_101072059
285 Ga0070671_100219155
286 Ga0070673_100081929
287 Ga0070688_100318096
288 Ga0070667_100601293
289 Ga0070714_100304072
290 Ga0070713_100024957
291 Ga0070713_100099539
292 Ga0070713_100105692
293 Ga0070711_101075086
294 Ga0070705_101181907
295 Ga0070708_100059514
296 Ga0070708_100074500
297 Ga0070708_100160096
298 Ga0070708_100887638
299 Ga0070681_10000205
300 Ga0070681_10000295
301 Ga0070681_10196257
302 Ga0068867_100117324
303 Ga0070685_10473501
304 Ga0070706_100077308
305 Ga0070706_100450052
306 Ga0070706_100451059
307 Ga0070707_100579865
308 Ga0070707_100620133
309 Ga0070707_100691401
310 Ga0070698_100104578
311 Ga0070698_100565209
312 Ga0070699_100150729
313 Ga0070679_100017252
314 Ga0070679_100023311
315 Ga0070679_100088897
316 Ga0070679_100210159
317 Ga0070684_100096266
318 Ga0070684_100139299
319 Ga0070697_100311372
320 Ga0068853_100025935
321 Ga0068853_100396920
322 Ga0070695_100292484
323 Ga0070695_100545656
324 Ga0070696_100053063
325 Ga0070693_100006088
326 Ga0070665_100001184
327 Ga0070665_100143452
328 Ga0070704_100317842
329 Ga0070704_100736394
330 Ga0068855_100000372
331 Ga0068855_100016134
332 Ga0070664_100006148
333 Ga0068857_100000581
334 Ga0068857_100002330
335 Ga0068857_100039430
336 Ga0068854_100027841
337 Ga0068856_100001026
338 Ga0068856_100001279
339 Ga0068852_100016121
340 Ga0068859_100338241
341 Ga0068861_100117010
342 Ga0068861_100348517
343 Ga0068861_101113781
344 Ga0068851_10017903
345 Ga0068863_100030260
346 Ga0068863_100222227
347 Ga0068858_100008527
348 Ga0068858_100020656
349 Ga0068858_100399945
350 Ga0068860_100033173
351 Ga0068860_100398987
352 Ga0068862_100087112
353 Ga0081455_10665551
354 Ga0070717_10059351
355 Ga0070715_10222572
356 Ga0070716_100364457
357 Ga0070712_100051037
358 Ga0097621_100000064
359 Ga0097621_100000851
360 Ga0097621_100180171
361 Ga0068871_100000224
362 Ga0068871_100001111
363 Ga0075428_100068363
364 Ga0075428_100299763
365 Ga0075428_100390207
366 Ga0075428_100452095
367 Ga0075431_100265091
368 Ga0075433_10144693
369 Ga0075433_10184633
370 Ga0075433_10246543
371 Ga0075433_10661703
372 Ga0075434_100014933
373 Ga0075434_100115394
374 Ga0075434_102001361
375 Ga0075429_100335869
376 Ga0068865_100023075
377 Ga0068865_100121930
378 Ga0068865_100462606
379 Ga0075436_100073847
380 Ga0097620_100338243
381 Ga0075435_100104679
382 Ga0075435_100631450
383 Ga0105240_10636459
384 Ga0105240_10781676
385 Ga0105247_10063661
386 Ga0105247_10210748
387 Ga0114129_10033027
388 Ga0114129_10465564
389 Ga0105241_10244662
390 Ga0105241_10254261
391 Ga0105242_10234221
392 Ga0105248_10550175
393 Ga0105248_11405183
394 Ga0105238_10000073
395 Ga0105249_10507103
396 Ga0105239_10132780
397 Ga0105246_10051680
398 Ga0157369_10198332
399 Ga0157369_10426242
400 Ga0157374_10000326
401 Ga0157374_10030433
402 Ga0157378_10000323
403 Ga0163162_10023094
404 Ga0163162_11133585
405 Ga0157372_10345094
406 Ga0157372_10385478
407 Ga0157372_11193684
408 Ga0157375_10453822
409 Ga0157375_10655993
410 Ga0157375_11580749
411 Ga0163163_10619761
412 Ga0157379_10035599
413 Ga0157379_10072516
414 Ga0157379_10338664
415 Ga0157376_10052755
416 Ga0224572_1003998
417 Ga0207697_10009589
418 Ga0207710_10147469
419 Ga0207684_10122525
420 Ga0207684_10675500
421 Ga0207684_10726478
422 Ga0207654_10027781
423 Ga0207707_10004062
424 Ga0207707_10004214
425 Ga0207695_10009574
426 Ga0207695_10508182
427 Ga0207671_10077305
428 Ga0207693_10034876
429 Ga0207660_10234937
430 Ga0207657_10299432
431 Ga0207649_10004772
432 Ga0207652_10037748
433 Ga0207652_10329225
434 Ga0207652_10392636
435 Ga0207646_10580562
436 Ga0207646_10589812
437 Ga0207681_10518307
438 Ga0207694_10662267
439 Ga0207650_10038545
440 Ga0207659_10518400
441 Ga0207700_10107392
442 Ga0207700_10150915
443 Ga0207644_10184742
444 Ga0207704_10032760
445 Ga0207704_10127230
446 Ga0207711_10042353
447 Ga0207661_10114418
448 Ga0207679_10040919
449 Ga0207679_10232348
450 Ga0207667_10018842
451 Ga0207640_10036483
452 Ga0207658_10499906
453 Ga0207677_10092266
454 Ga0207703_10016424
455 Ga0207703_10119456
456 Ga0207639_10067577
457 Ga0207639_10355858
458 Ga0207702_10005465
459 Ga0207702_10051151
460 Ga0207641_10687489
461 Ga0207674_10000678
462 Ga0207674_10007764
463 Ga0207674_10050414
464 Ga0207698_10009957
465 Ga0207698_11098256
466 Ga0268266_10000194
467 Ga0268266_10011363
468 Ga0268264_10024146
469 Ga0268264_10362081
470 Ga0265326_10021421
471 Ga0265324_10000041
472 Ga0373957_0377262
473 Ga0395900_1011363
474 Ga0451802_1347406
475 Ga0466963_0052346
476 Ga0466964_0476446
477 Ga0495580_0178227
478 Ga0495594_0031559
479 Ga0496100_0764660
480 Ga0496102_0001393
481 Ga0496102_0044954
482 Ga0496103_0086059
483 Ga0496104_0076213
484 Ga0496104_0212870
485 Ga0496104_0309394
486 Ga0496104_0375719
487 Ga0496106_0143384
488 Ga0496107_0555263
489 Ga0496109_0084369
490 Ga0496110_0459139
491 Ga0496112_0072924
492 Ga0496114_0335271
493 Ga0501040_0008913
494 Ga0501041_0067524
495 Ga0501046_0863541
496 Ga0501048_0080685
497 Ga0501048_0845208
498 Ga0501071_0319663
499 Ga0501072_0005238
500 Ga0501075_0095911
501 Ga0501079_0301336
502 Ga0501079_0332017
503 Ga0501081_0064723
504 Ga0501081_0221791
505 Ga0501045_0259141
506 nmdc:mga05p37_112224_c1
507 nmdc:mga05p37_126676_c1
508 nmdc:mga05p37_173217_c1
509 nmdc:mga05p37_549087_c1
510 nmdc:mga05p37_84688_c1
511 nmdc:mga09592_92784_c1
512 nmdc:mga08y16_693479_c1
513 nmdc:mga08y16_913686_c1
514 nmdc:mga0n895_17045_c1
515 nmdc:mga0n895_20208_c1
516 nmdc:mga0n895_285957_c1
517 nmdc:mga0n895_405692_c1
518 nmdc:mga0rr50_4850_c1
519 nmdc:mga0rr50_79476_c1
520 nmdc:mga08x19_53727_c1
521 nmdc:mga0a205_129651_c1
522 nmdc:mga0a205_136703_c1
523 nmdc:mga0a205_314964_c1
524 nmdc:mga0a205_331308_c1
525 Ga0501084_0869624
526 Ga0590071_002226
527 Ga0590077_020157
528 Ga0501082_0128325
529 Ga0530510_0148963
530 Ga0530510_0855380

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04307

YdjM

LexA-binding, inner membrane-associated putative hydrolase

12

188

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
6n3q-assembly1.cif.gz_A cryo-em structure of the yeast sec complex 0.4407 5 104
5edl-assembly1.cif.gz_A crystal structure of an s-component of ecf transporter 0.4239 28 103
8gs7-assembly1.cif.gz_A solution nmr structure of n-terminal domain of triconephila clavipes major ampullate spidroin 2 0.4187 6 103
5iz2-assembly1.cif.gz_B crystal structure of the n. clavipes spidroin ntd at ph 6.5 0.3915 5 101
6n4n-assembly2.cif.gz_C crystal structure of the designed protein dncr2/danoprevir/ns3a complex 0.3407 4 102
ID Description Score Start End Superfamily
af_Q10MT3_41_141_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.6298 60 105 1.10.10.1740
af_P91341_758_863_1.25.40.90 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat; 0.4711 64 101 1.25.40.90
af_I1LP70_44_159_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.4663 64 105 1.10.10.1740
af_Q6ZGV9_11_120_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.4414 59 105 1.10.10.1740
af_F4HZF4_333_543_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.4278 4 113 1.10.3210.10
ID Description Score Start End GO Terms
AF-A0A256WZZ1-F1-model_v4 deleted 0.9626 1 173
AF-A0A525VF36-F1-model_v4 Metal-dependent hydrolase 0.9589 1 181 GO:0016020
GO:0016787
AF-A0A239DWF7-F1-model_v4 Inner membrane protein 0.9566 1 175 GO:0016020
AF-A0A2E8I4Q4-F1-model_v4 deleted 0.9547 1 184
AF-A0A0S4LRB1-F1-model_v4 Membrane-bound metal-dependent hydrolase 0.9504 1 183 GO:0016020

Map