F373342

General Info

Members Datasets Scaffolds Average Seq Length
265 181 242 182

Family's Representative Sequence

Representative Sequence 3300021361|Ga0213872_10006502|Ga0213872_100065025
Length 209
Sequence MIAMQYSFTLPADYDMDIIRRRIAERGHFTDDFPLLGFKAYVYAESAQGRSRDNLYAPFYLWEDNEGMNAFLGGPGFAALVASFGRPAISVWSVWHAQRPNDAGAARYATREIVAIPPEASLEAWREAETVWLKQDIAMRDAVGGVVAFEPSTWTLVSFRLWAHQPRTLDTERAQCYAVGHVSVPTNGRDARDTVLTRSASADHVTASV

Samples

Sample ID Description Type Environment
1 2508501071 Serratia proteamaculans S4 Isolate Rhizosphere
2 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
3 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
4 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
5 2585427591 Rahnella aquatilis OV744 Isolate Rhizosphere
6 2585427592 Rahnella aquatilis OV588 Isolate Rhizosphere
7 2667528173 Rahnella sp. NFIX50 Isolate Rhizoplane
8 2687453109 Bacillus pumilus SH-B11 Isolate Unclassified
9 2739367700 Dyella sp. YR388 Isolate Unclassified
10 2772190666 Serratia surfactantfaciens YD25 Isolate Unclassified
11 2806310673 Serratia quinivorans NCTC 13189 Isolate Rhizosphere
12 2811994870 Bacillus sp. JB4 Isolate Unclassified
13 2823526263 Bacillus altitudinis P-10 Isolate Unclassified
14 2884411467 Dyella sp. AD56 Isolate Rhizosphere
15 2904474040 Rahnella aquatilis 4485 Isolate Rhizosphere
16 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
17 2919150387 Rahnella aceris 1817 Isolate Unclassified
18 2927143783 Rahnella sp. 2050 Isolate Unclassified
19 2928963466 Dyella japonica 1073 Isolate Unclassified
20 2937967321 Serratia sp. YC16 Isolate Unclassified
21 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
22 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
23 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
24 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
25 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
26 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
27 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
28 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
29 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
30 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
31 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
32 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
33 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
34 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
35 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
36 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
37 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
38 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
39 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
40 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
41 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
42 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
43 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
44 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
45 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
46 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
47 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
48 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
49 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
50 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
51 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
52 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
53 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
54 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
55 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
56 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
57 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
58 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
59 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
60 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
64 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
65 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
66 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
67 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
79 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
80 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
81 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
82 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
83 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
84 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
90 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
91 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
93 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
94 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
95 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
98 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
99 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
100 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
102 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
103 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
104 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
105 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
106 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
107 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
108 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
123 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
124 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
125 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
126 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
127 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
128 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
129 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
130 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
131 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
132 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
133 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
134 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
135 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
136 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
137 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
138 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
139 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
140 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
141 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
142 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
143 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
144 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
145 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
146 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
147 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
148 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
149 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
150 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
151 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
152 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
153 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
154 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
155 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
156 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
157 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
158 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
159 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
160 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
161 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
162 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
163 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
164 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
165 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
166 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
167 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
168 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
169 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
170 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
173 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
174 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
175 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
176 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
177 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
178 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
179 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
180 640753048 Serratia proteamaculans 568 Isolate Endosphere
181 8015394850 Serratia sp. PGPR-27 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.94
Metatranscriptomes 0.38
Isolates 8.68

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 31.7
Nodule 0.75
Rhizoplane 3.4
Rhizosphere 44.53
Stem 0
Stem Tuber 0
Unclassified 19.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10000803 3300002067 Bacteria 11182
2 JGI25162J39368_1000521 3300002737 Bacteria 28709
3 JGI25162J39368_1003364 3300002737 Bacteria 4740
4 JGI25158J39367_1000180 3300002739 Bacteria 14916
5 JGI25157J39369_1000434 3300002741 Bacteria 27188
6 JGI25163J39215_1000064 3300002771 Bacteria 47794
7 JGI25163J39215_1001632 3300002771 Bacteria 3338
8 JGI25164J39214_1000006 3300002772 Bacteria 342675
9 JGI25164J39214_1000288 3300002772 Bacteria 35469
10 JGI25152J39213_1001981 3300002773 Bacteria 8104
11 JGI25152J39213_1014175 3300002773 Bacteria 1627
12 JGI25159J45721_1001406 3300002987 Bacteria 9996
13 JGI25151J46595_10016424 3300003187 Bacteria 3237
14 JGI25165J46597_1000532 3300003214 Bacteria 35455
15 JGI25153J46596_10003024 3300003215 Bacteria 9511
16 JGI25153J46596_10035163 3300003215 Bacteria 1627
17 JGI25153J46596_10036896 3300003215 Bacteria 1560
18 rootH2_10044954 3300003320 Bacteria 11828
19 rootH2_10102738 3300003320 Bacteria 1830
20 rootH2_10159621 3300003320 Bacteria 1096
21 rootL2_10008532 3300003322 Bacteria 2497
22 rootH1_10078253 3300003323 Bacteria 2975
23 JGI25160J50197_1038817 3300003354 Bacteria 1122
24 JGI25161J50226_1000114 3300003374 Bacteria 62957
25 Ga0006562J51391_1001226 3300003578 Bacteria 12640
26 Ga0055538_1000003 3300003751 Bacteria 663004
27 Ga0055538_1001162 3300003751 Bacteria 5585
28 Ga0055539_1000003 3300003752 Bacteria 663004
29 Ga0055533_1000005 3300003756 Bacteria 663004
30 Ga0055533_1000410 3300003756 Bacteria 16685
31 Ga0055525_1000005 3300003759 Bacteria 663004
32 Ga0055535_1000429 3300003761 Bacteria 39272
33 Ga0055535_1007899 3300003761 Bacteria 1974
34 Ga0055542_1000292 3300003762 Bacteria 56160
35 Ga0055542_1000648 3300003762 Bacteria 28709
36 Ga0055529_1000467 3300003763 Bacteria 39162
37 Ga0055526_1002600 3300003771 Bacteria 12067
38 Ga0055524_1014713 3300003775 Bacteria 2885
39 Ga0055528_1019582 3300003790 Bacteria 2235
40 Ga0055540_1001218 3300003792 Bacteria 15814
41 Ga0055541_1000003 3300003841 Bacteria 663004
42 Ga0055543_1000077 3300004625 Bacteria 86457
43 Ga0065165_1020441 3300005262 Bacteria 2329
44 Ga0065703_1020905 3300005272 Bacteria 1490
45 Ga0065704_10000011 3300005289 Bacteria 56608
46 Ga0070682_100245349 3300005337 Bacteria 1288
47 Ga0070668_100360476 3300005347 Bacteria 1232
48 Ga0070688_100331253 3300005365 Bacteria 1109
49 Ga0070710_10931639 3300005437 Bacteria 629
50 Ga0070663_100187018 3300005455 Bacteria 1610
51 Ga0070685_10010846 3300005466 Bacteria 4749
52 Ga0070665_100056753 3300005548 Bacteria 3926
53 Ga0070665_100164099 3300005548 Bacteria 2224
54 Ga0070665_100347106 3300005548 Bacteria 1489
55 Ga0068860_100232443 3300005843 Bacteria 1792
56 Ga0081455_10028180 3300005937 Bacteria 5134
57 Ga0079104_1006595 3300006946 Bacteria 4356
58 Ga0079104_1043406 3300006946 Bacteria 1036
59 Ga0105251_10015616 3300009011 Bacteria 4141
60 Ga0105251_10152530 3300009011 Bacteria 1043
61 Ga0105244_10000276 3300009036 Bacteria 51408
62 Ga0105244_10001366 3300009036 Bacteria 19816
63 Ga0105244_10350280 3300009036 Unclassified 681
64 Ga0105250_10000141 3300009092 Bacteria 62782
65 Ga0105240_10027351 3300009093 Bacteria 7467
66 Ga0105240_10059422 3300009093 Bacteria 4771
67 Ga0105240_10347369 3300009093 Bacteria 1684
68 Ga0105237_10762044 3300009545 Bacteria 974
69 Ga0105238_10231768 3300009551 Bacteria 1823
70 Ga0105238_10633277 3300009551 Bacteria 1079
71 Ga0105249_10552507 3300009553 Bacteria 1202
72 Ga0157371_10000134 3300013102 Bacteria 108562
73 Ga0157369_10334811 3300013105 Bacteria 1572
74 Ga0157369_10990739 3300013105 Bacteria 861
75 Ga0163162_10028268 3300013306 Bacteria 5547
76 Ga0163163_10585375 3300014325 Bacteria 1179
77 Ga0182008_10136890 3300014497 Bacteria 1223
78 Ga0182008_10534885 3300014497 Bacteria 649
79 Ga0157379_10052887 3300014968 Bacteria 3628
80 Ga0182007_10005061 3300015262 Bacteria 5854
81 Ga0183368_1002 3300015687 Bacteria 1865598
82 Ga0213872_10001721 3300021361 Bacteria 13758
83 Ga0213872_10006502 3300021361 Bacteria 5853
84 Ga0209435_102371 3300025206 Bacteria 2215
85 Ga0209760_100062 3300025207 Bacteria 92359
86 Ga0209436_100050 3300025208 Bacteria 65942
87 Ga0209784_100001 3300025224 Bacteria 3600592
88 Ga0209784_100216 3300025224 Bacteria 39416
89 Ga0209566_100001 3300025225 Bacteria 3600765
90 Ga0209566_102232 3300025225 Bacteria 3811
91 Ga0209674_100002 3300025226 Bacteria 3600592
92 Ga0209674_100014 3300025226 Bacteria 704989
93 Ga0209672_100994 3300025228 Bacteria 12455
94 Ga0209672_107210 3300025228 Bacteria 1731
95 Ga0209563_100002 3300025230 Bacteria 2045675
96 Ga0207427_100009 3300025231 Bacteria 663036
97 Ga0207427_100267 3300025231 Bacteria 39803
98 Ga0209437_100001 3300025233 Bacteria 2045675
99 Ga0209437_100037 3300025233 Bacteria 459730
100 Ga0209437_100138 3300025233 Bacteria 172839
101 Ga0209258_100034 3300025242 Bacteria 437372
102 Ga0209258_100620 3300025242 Bacteria 28259
103 Ga0209258_102433 3300025242 Bacteria 4813
104 Ga0207425_1002635 3300025245 Bacteria 6193
105 Ga0207425_1009621 3300025245 Bacteria 2394
106 Ga0207425_1019085 3300025245 Bacteria 1481
107 Ga0209646_1000436 3300025246 Bacteria 22879
108 Ga0209026_1000255 3300025250 Bacteria 66879
109 Ga0209026_1001319 3300025250 Bacteria 11179
110 Ga0209677_100002 3300025253 Bacteria 2045675
111 Ga0209148_1000001 3300025254 Bacteria 2545271
112 Ga0209148_1000002 3300025254 Bacteria 2399500
113 Ga0209759_1000678 3300025256 Bacteria 31063
114 Ga0209759_1005908 3300025256 Bacteria 4188
115 Ga0209129_1001687 3300025258 Bacteria 11953
116 Ga0209129_1002355 3300025258 Bacteria 9336
117 Ga0209129_1003334 3300025258 Bacteria 7075
118 Ga0209233_1000002 3300025261 Bacteria 2501366
119 Ga0209233_1005855 3300025261 Bacteria 4035
120 Ga0209455_1000054 3300025272 Bacteria 358936
121 Ga0209455_1002220 3300025272 Bacteria 7665
122 Ga0209673_1003647 3300025273 Bacteria 8902
123 Ga0209130_1000030 3300025284 Bacteria 323323
124 Ga0209025_1019307 3300025294 Bacteria 3795
125 Ga0209564_1000364 3300025295 Bacteria 84138
126 Ga0209758_1000357 3300025297 Bacteria 82792
127 Ga0209758_1001342 3300025297 Bacteria 29705
128 Ga0209758_1001459 3300025297 Bacteria 27768
129 Ga0209256_1002320 3300025299 Bacteria 15934
130 Ga0207426_1000047 3300025302 Bacteria 417011
131 Ga0209051_1001764 3300025303 Bacteria 17175
132 Ga0209257_1016732 3300025304 Bacteria 2944
133 Ga0207696_1000258 3300025711 Bacteria 68746
134 Ga0207655_1000011 3300025728 Bacteria 643321
135 Ga0207655_1000349 3300025728 Bacteria 66933
136 Ga0207713_1002024 3300025735 Bacteria 15188
137 Ga0207713_1152821 3300025735 Bacteria 743
138 Ga0207647_10105232 3300025904 Bacteria 1672
139 Ga0207647_10222766 3300025904 Bacteria 1087
140 Ga0207645_10267676 3300025907 Unclassified 1133
141 Ga0207695_10230850 3300025913 Bacteria 1755
142 Ga0207695_10472573 3300025913 Bacteria 1136
143 Ga0207671_10546234 3300025914 Bacteria 924
144 Ga0207664_11474847 3300025929 Bacteria 602
145 Ga0207668_10275284 3300025972 Bacteria 1378
146 Ga0207678_10079153 3300026067 Bacteria 2815
147 Ga0268266_10000234 3300028379 Bacteria 94817
148 Ga0268266_10122780 3300028379 Bacteria 2313
149 Ga0268264_10168760 3300028381 Bacteria 1977
150 Ga0265330_10047385 3300031235 Bacteria 1892
151 Ga0265330_10054526 3300031235 Bacteria 1747
152 Ga0265328_10020319 3300031239 Bacteria 2543
153 Ga0265325_10031541 3300031241 Bacteria 2835
154 Ga0265325_10231792 3300031241 Bacteria 841
155 Ga0265340_10216815 3300031247 Bacteria 858
156 Ga0265339_10009553 3300031249 Bacteria 6082
157 Ga0265339_10048976 3300031249 Bacteria 2315
158 Ga0265316_10213031 3300031344 Bacteria 1428
159 Ga0265316_10536957 3300031344 Bacteria 833
160 Ga0265314_10058763 3300031711 Bacteria 2634
161 Ga0265342_10141173 3300031712 Bacteria 1344
162 Ga0316576_10209157 3300031727 Bacteria 1469
163 Ga0316578_10052050 3300031728 Bacteria 2399
164 Ga0316583_10038843 3300032133 Unclassified 1686
165 Ga0316583_10071905 3300032133 Bacteria 1210
166 Ga0316574_0024092 3300035398 Bacteria 3639
167 Ga0316584_0023303 3300036712 Bacteria 4523
168 Ga0436361_0001950 3300039447 Bacteria 15059
169 Ga0436361_0053779 3300039447 Bacteria 8562
170 Ga0436361_0471854 3300039447 Bacteria 1568
171 Ga0436361_0858438 3300039447 Bacteria 992
172 Ga0439465_0007535 3300041413 Bacteria 3457
173 Ga0439465_0065673 3300041413 Bacteria 1208
174 Ga0466961_0257796 3300044693 Bacteria 1070
175 Ga0466959_0065897 3300045049 Bacteria 2628
176 Ga0495590_0026811 3300046457 Bacteria 2022
177 Ga0495638_0000116 3300046460 Bacteria 128087
178 Ga0495650_0000064 3300046471 Bacteria 275412
179 Ga0495650_0000404 3300046471 Bacteria 71360
180 Ga0495583_0065248 3300046506 Bacteria 1613
181 Ga0495606_0005316 3300046507 Bacteria 12390
182 Ga0495610_0019884 3300046512 Bacteria 3743
183 Ga0495643_0009269 3300046522 Bacteria 6132
184 Ga0495643_0214107 3300046522 Unclassified 918
185 Ga0495642_0034381 3300046528 Bacteria 2041
186 Ga0495654_0000540 3300046530 Bacteria 30505
187 Ga0495633_0001360 3300046558 Bacteria 19136
188 Ga0495633_0129161 3300046558 Unclassified 1169
189 Ga0495625_0097369 3300046660 Bacteria 2025
190 Ga0495649_0004914 3300046694 Bacteria 8616
191 Ga0495649_0422948 3300046694 Bacteria 667
192 Ga0495589_0000002 3300046794 Bacteria 758846
193 Ga0495660_0000004 3300046810 Bacteria 1003183
194 Ga0496102_0002998 3300048905 Bacteria 14302
195 Ga0496104_0000367 3300048907 Bacteria 39923
196 Ga0496106_0000106 3300048909 Bacteria 64785
197 Ga0496115_0000413 3300048918 Bacteria 34949
198 Ga0496115_0000455 3300048918 Bacteria 32821
199 Ga0496115_0003925 3300048918 Bacteria 10713
200 Ga0496115_0035557 3300048918 Bacteria 3941
201 Ga0496115_0521956 3300048918 Bacteria 952
202 Ga0496116_0000074 3300048919 Bacteria 231767
203 Ga0496116_0036053 3300048919 Bacteria 3467
204 Ga0496117_0003119 3300048920 Bacteria 19789
205 Ga0496117_0020870 3300048920 Bacteria 5328
206 Ga0496117_0042063 3300048920 Bacteria 3339
207 Ga0496117_0046265 3300048920 Bacteria 3131
208 Ga0496118_0001323 3300048921 Bacteria 37559
209 Ga0496118_0016317 3300048921 Bacteria 6819
210 Ga0496118_0020746 3300048921 Bacteria 5817
211 Ga0496119_0000885 3300048922 Bacteria 39222
212 Ga0496119_0004212 3300048922 Bacteria 14445
213 Ga0496119_0010571 3300048922 Bacteria 7744
214 Ga0496120_0000084 3300048923 Bacteria 156678
215 Ga0496120_0000275 3300048923 Bacteria 86166
216 Ga0496120_0029344 3300048923 Bacteria 3358
217 Ga0496121_0033035 3300048924 Bacteria 4691
218 Ga0496121_0102395 3300048924 Bacteria 2206
219 Ga0496122_0000064 3300048925 Bacteria 239959
220 Ga0496122_0029057 3300048925 Bacteria 4674
221 Ga0496123_0000049 3300048926 Bacteria 239949
222 Ga0496123_0030152 3300048926 Bacteria 3975
223 Ga0496124_0000017 3300048927 Bacteria 444389
224 Ga0496124_0000027 3300048927 Bacteria 376097
225 Ga0496124_0079899 3300048927 Bacteria 2692
226 Ga0496125_0013718 3300048928 Bacteria 7948
227 Ga0496126_0001207 3300048929 Bacteria 42120
228 Ga0496126_0002616 3300048929 Bacteria 23990
229 Ga0496126_0002718 3300048929 Bacteria 23385
230 Ga0496126_0010047 3300048929 Bacteria 9987
231 Ga0495678_124288 3300049459 Bacteria 862
232 Ga0495682_0003389 3300049460 Bacteria 7102
233 Ga0501043_0075005 3300049579 Bacteria 2657
234 Ga0501047_0247125 3300049581 Bacteria 1633
235 Ga0501068_0380815 3300049584 Bacteria 908
236 Ga0501073_0535694 3300049589 Bacteria 809
237 Ga0500658_0125606 3300053134 Bacteria 1140
238 Ga0500568_0002618 3300053139 Bacteria 10468
239 Ga0500586_001283 3300053145 Bacteria 5267
240 Ga0500622_0000237 3300053156 Bacteria 57253
241 Ga0500633_0003057 3300053160 Bacteria 3579
242 Ga0501082_0072958 3300060353 Bacteria 2956

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046694 Ga0495649_0422948 Ga0495649_0422948_191_649 140
2 iso_pu_bacteria 2823526263 2823526733 146
3 3300046558 Ga0495633_0129161 Ga0495633_0129161_638_1159 155
4 3300048918 Ga0496115_0003925 Ga0496115_0003925_2469_3005 158
5 3300009011 Ga0105251_10152530 Ga0105251_101525301 160
6 3300025735 Ga0207713_1152821 Ga0207713_11528211 160
7 3300048907 Ga0496104_0000367 Ga0496104_0000367_38229_38771 160
8 3300002771 JGI25163J39215_1000064 JGI25163J39215_100006418 161
9 3300002772 JGI25164J39214_1000006 JGI25164J39214_1000006188 161
10 3300003751 Ga0055538_1000003 Ga0055538_1000003303 161
11 3300003752 Ga0055539_1000003 Ga0055539_1000003315 161
12 3300003756 Ga0055533_1000005 Ga0055533_1000005315 161
13 3300003759 Ga0055525_1000005 Ga0055525_1000005303 161
14 3300003841 Ga0055541_1000003 Ga0055541_1000003303 161
15 3300005289 Ga0065704_10000011 Ga0065704_1000001121 161
16 3300009036 Ga0105244_10001366 Ga0105244_1000136612 161
17 3300009092 Ga0105250_10000141 Ga0105250_1000014116 161
18 3300013306 Ga0163162_10028268 Ga0163162_100282684 161
19 3300025207 Ga0209760_100062 Ga0209760_10006264 161
20 3300025224 Ga0209784_100001 Ga0209784_1000013072 161
21 3300025225 Ga0209566_100001 Ga0209566_1000013072 161
22 3300025226 Ga0209674_100002 Ga0209674_1000023072 161
23 3300025230 Ga0209563_100002 Ga0209563_1000021607 161
24 3300025231 Ga0207427_100009 Ga0207427_100009301 161
25 3300025233 Ga0209437_100001 Ga0209437_1000011607 161
26 3300025253 Ga0209677_100002 Ga0209677_1000021607 161
27 3300025711 Ga0207696_1000258 Ga0207696_100025855 161
28 3300025728 Ga0207655_1000349 Ga0207655_100034956 161
29 3300046471 Ga0495650_0000404 Ga0495650_0000404_24435_24977 161
30 3300046810 Ga0495660_0000004 Ga0495660_0000004_212340_212882 161
31 3300048919 Ga0496116_0000074 Ga0496116_0000074_17542_18084 161
32 3300048920 Ga0496117_0003119 Ga0496117_0003119_7449_7991 161
33 3300048921 Ga0496118_0020746 Ga0496118_0020746_615_1157 161
34 3300048922 Ga0496119_0010571 Ga0496119_0010571_4826_5368 161
35 3300048923 Ga0496120_0029344 Ga0496120_0029344_440_982 161
36 3300048925 Ga0496122_0000064 Ga0496122_0000064_28065_28607 161
37 3300048926 Ga0496123_0000049 Ga0496123_0000049_211343_211885 161
38 3300048927 Ga0496124_0000027 Ga0496124_0000027_203884_204426 161
39 3300048929 Ga0496126_0001207 Ga0496126_0001207_28112_28654 161
40 iso_pu_bacteria 2585427591 2585827648 165
41 iso_pu_bacteria 2585427592 2585834757 165
42 iso_pu_bacteria 2667528173 2671107192 165
43 iso_pu_bacteria 2904474040 2904476130 165
44 iso_pu_bacteria 2919150387 2919152299 165
45 iso_pu_bacteria 2927143783 2927144968 165
46 3300006946 Ga0079104_1043406 Ga0079104_10434061 169
47 3300013102 Ga0157371_10000134 Ga0157371_10000134109 169
48 3300046522 Ga0495643_0214107 Ga0495643_0214107_292_837 169
49 3300048920 Ga0496117_0020870 Ga0496117_0020870_4648_5193 169
50 3300048921 Ga0496118_0001323 Ga0496118_0001323_4847_5392 169
51 iso_pu_bacteria 2687453109 2687496860 169
52 iso_pu_bacteria 2811994870 2812314762 169
53 3300031241 Ga0265325_10031541 Ga0265325_100315413 171
54 iso_pu_bacteria 2508501071 2508851405 172
55 iso_pu_bacteria 2772190666 2772437971 172
56 iso_pu_bacteria 2806310673 2807177040 172
57 iso_pu_bacteria 2937967321 2937969714 172
58 iso_pu_bacteria 640753048 640936962 172
59 iso_pu_bacteria 8015394850 8015394956 172
60 3300003578 Ga0006562J51391_1001226 Ga0006562J51391_10012265 173
61 3300005937 Ga0081455_10028180 Ga0081455_100281807 173
62 3300003320 rootH2_10159621 rootH2_101596212 175
63 3300005272 Ga0065703_1020905 Ga0065703_10209052 176
64 3300006946 Ga0079104_1006595 Ga0079104_10065955 176
65 3300009011 Ga0105251_10015616 Ga0105251_100156166 176
66 3300009036 Ga0105244_10000276 Ga0105244_1000027652 176
67 3300025728 Ga0207655_1000011 Ga0207655_1000011476 176
68 3300025735 Ga0207713_1002024 Ga0207713_100202417 176
69 3300031241 Ga0265325_10231792 Ga0265325_102317921 176
70 3300031247 Ga0265340_10216815 Ga0265340_102168151 176
71 3300031249 Ga0265339_10048976 Ga0265339_100489763 176
72 3300046530 Ga0495654_0000540 Ga0495654_0000540_7382_7987 176
73 3300046794 Ga0495589_0000002 Ga0495589_0000002_418601_419206 176
74 3300048920 Ga0496117_0046265 Ga0496117_0046265_1829_2398 176
75 3300048922 Ga0496119_0000885 Ga0496119_0000885_34465_35034 176
76 3300048922 Ga0496119_0004212 Ga0496119_0004212_9117_9686 176
77 3300048923 Ga0496120_0000084 Ga0496120_0000084_51507_52076 176
78 3300048923 Ga0496120_0000275 Ga0496120_0000275_20666_21235 176
79 3300048927 Ga0496124_0000017 Ga0496124_0000017_339168_339737 176
80 3300005347 Ga0070668_100360476 Ga0070668_1003604762 177
81 3300009551 Ga0105238_10633277 Ga0105238_106332772 177
82 3300009553 Ga0105249_10552507 Ga0105249_105525072 177
83 3300025907 Ga0207645_10267676 Ga0207645_102676761 177
84 3300025972 Ga0207668_10275284 Ga0207668_102752842 177
85 3300031235 Ga0265330_10047385 Ga0265330_100473852 177
86 3300031235 Ga0265330_10054526 Ga0265330_100545262 177
87 3300031239 Ga0265328_10020319 Ga0265328_100203192 177
88 3300031249 Ga0265339_10009553 Ga0265339_100095533 177
89 3300031344 Ga0265316_10536957 Ga0265316_105369571 177
90 3300031711 Ga0265314_10058763 Ga0265314_100587633 177
91 3300031712 Ga0265342_10141173 Ga0265342_101411732 177
92 3300039447 Ga0436361_0858438 Ga0436361_0858438_219_779 177
93 3300048905 Ga0496102_0002998 Ga0496102_0002998_3271_3816 177
94 iso_pu_bacteria 2510917030 2511198468 177
95 iso_pu_bacteria 2582581298 2585224847 177
96 iso_pu_bacteria 2585427529 2585547403 177
97 iso_pu_bacteria 2739367700 2739733459 177
98 iso_pu_bacteria 2884411467 2884412743 177
99 iso_pu_bacteria 2919100787 2919104499 177
100 iso_pu_bacteria 2928963466 2928966744 177
101 iso_pu_bacteria 3005445848 3005449214 177
102 3300003762 Ga0055542_1000292 Ga0055542_10002924 178
103 3300046460 Ga0495638_0000116 Ga0495638_0000116_10272_10808 178
104 3300046471 Ga0495650_0000064 Ga0495650_0000064_121554_122090 178
105 3300046507 Ga0495606_0005316 Ga0495606_0005316_1732_2268 178
106 3300046660 Ga0495625_0097369 Ga0495625_0097369_1179_1715 178
107 3300046694 Ga0495649_0004914 Ga0495649_0004914_6752_7288 178
108 3300048918 Ga0496115_0000455 Ga0496115_0000455_30570_31106 178
109 3300048918 Ga0496115_0035557 Ga0496115_0035557_401_937 178
110 3300048918 Ga0496115_0521956 Ga0496115_0521956_242_778 178
111 3300048924 Ga0496121_0102395 Ga0496121_0102395_313_849 178
112 3300048929 Ga0496126_0002616 Ga0496126_0002616_12703_13239 178
113 3300048929 Ga0496126_0010047 Ga0496126_0010047_9330_9866 178
114 3300049459 Ga0495678_124288 Ga0495678_124288_284_820 178
115 3300049460 Ga0495682_0003389 Ga0495682_0003389_2221_2757 178
116 3300049579 Ga0501043_0075005 Ga0501043_0075005_381_923 178
117 3300049581 Ga0501047_0247125 Ga0501047_0247125_372_914 178
118 3300049584 Ga0501068_0380815 Ga0501068_0380815_311_853 178
119 3300049589 Ga0501073_0535694 Ga0501073_0535694_65_607 178
120 3300060353 Ga0501082_0072958 Ga0501082_0072958_402_944 178
121 3300009093 Ga0105240_10027351 Ga0105240_100273514 179
122 3300009093 Ga0105240_10347369 Ga0105240_103473692 179
123 3300009545 Ga0105237_10762044 Ga0105237_107620441 179
124 3300009551 Ga0105238_10231768 Ga0105238_102317683 179
125 3300014968 Ga0157379_10052887 Ga0157379_100528872 179
126 3300048929 Ga0496126_0002718 Ga0496126_0002718_10168_10719 179
127 3300002737 JGI25162J39368_1000521 JGI25162J39368_100052118 181
128 3300002737 JGI25162J39368_1003364 JGI25162J39368_10033644 181
129 3300002739 JGI25158J39367_1000180 JGI25158J39367_100018013 181
130 3300002741 JGI25157J39369_1000434 JGI25157J39369_10004341 181
131 3300002771 JGI25163J39215_1001632 JGI25163J39215_10016324 181
132 3300002772 JGI25164J39214_1000288 JGI25164J39214_100028824 181
133 3300002773 JGI25152J39213_1001981 JGI25152J39213_10019817 181
134 3300002773 JGI25152J39213_1014175 JGI25152J39213_10141752 181
135 3300002987 JGI25159J45721_1001406 JGI25159J45721_100140610 181
136 3300003187 JGI25151J46595_10016424 JGI25151J46595_100164244 181
137 3300003214 JGI25165J46597_1000532 JGI25165J46597_100053224 181
138 3300003215 JGI25153J46596_10003024 JGI25153J46596_1000302410 181
139 3300003215 JGI25153J46596_10035163 JGI25153J46596_100351632 181
140 3300003215 JGI25153J46596_10036896 JGI25153J46596_100368962 181
141 3300003320 rootH2_10044954 rootH2_100449544 181
142 3300003320 rootH2_10102738 rootH2_101027382 181
143 3300003322 rootL2_10008532 rootL2_100085323 181
144 3300003323 rootH1_10078253 rootH1_100782532 181
145 3300003354 JGI25160J50197_1038817 JGI25160J50197_10388172 181
146 3300003374 JGI25161J50226_1000114 JGI25161J50226_100011435 181
147 3300003751 Ga0055538_1001162 Ga0055538_10011625 181
148 3300003761 Ga0055535_1000429 Ga0055535_100042928 181
149 3300003762 Ga0055542_1000648 Ga0055542_100064818 181
150 3300003763 Ga0055529_1000467 Ga0055529_100046728 181
151 3300003771 Ga0055526_1002600 Ga0055526_10026008 181
152 3300003775 Ga0055524_1014713 Ga0055524_10147134 181
153 3300003790 Ga0055528_1019582 Ga0055528_10195822 181
154 3300003792 Ga0055540_1001218 Ga0055540_10012186 181
155 3300004625 Ga0055543_1000077 Ga0055543_100007730 181
156 3300005262 Ga0065165_1020441 Ga0065165_10204412 181
157 3300005337 Ga0070682_100245349 Ga0070682_1002453493 181
158 3300005365 Ga0070688_100331253 Ga0070688_1003312531 181
159 3300005455 Ga0070663_100187018 Ga0070663_1001870183 181
160 3300005466 Ga0070685_10010846 Ga0070685_100108464 181
161 3300005548 Ga0070665_100164099 Ga0070665_1001640992 181
162 3300005548 Ga0070665_100347106 Ga0070665_1003471062 181
163 3300005843 Ga0068860_100232443 Ga0068860_1002324433 181
164 3300009036 Ga0105244_10350280 Ga0105244_103502801 181
165 3300014497 Ga0182008_10534885 Ga0182008_105348851 181
166 3300025208 Ga0209436_100050 Ga0209436_10005035 181
167 3300025224 Ga0209784_100216 Ga0209784_10021628 181
168 3300025225 Ga0209566_102232 Ga0209566_1022323 181
169 3300025228 Ga0209672_100994 Ga0209672_1009948 181
170 3300025228 Ga0209672_107210 Ga0209672_1072103 181
171 3300025231 Ga0207427_100267 Ga0207427_10026728 181
172 3300025233 Ga0209437_100037 Ga0209437_10003718 181
173 3300025233 Ga0209437_100138 Ga0209437_10013893 181
174 3300025242 Ga0209258_100034 Ga0209258_100034212 181
175 3300025242 Ga0209258_102433 Ga0209258_1024333 181
176 3300025245 Ga0207425_1002635 Ga0207425_10026357 181
177 3300025245 Ga0207425_1009621 Ga0207425_10096212 181
178 3300025245 Ga0207425_1019085 Ga0207425_10190852 181
179 3300025246 Ga0209646_1000436 Ga0209646_100043614 181
180 3300025250 Ga0209026_1000255 Ga0209026_100025522 181
181 3300025250 Ga0209026_1001319 Ga0209026_10013196 181
182 3300025254 Ga0209148_1000001 Ga0209148_1000001492 181
183 3300025254 Ga0209148_1000002 Ga0209148_1000002460 181
184 3300025256 Ga0209759_1000678 Ga0209759_100067821 181
185 3300025256 Ga0209759_1005908 Ga0209759_10059082 181
186 3300025258 Ga0209129_1001687 Ga0209129_10016877 181
187 3300025258 Ga0209129_1002355 Ga0209129_10023558 181
188 3300025258 Ga0209129_1003334 Ga0209129_10033344 181
189 3300025261 Ga0209233_1000002 Ga0209233_10000021739 181
190 3300025261 Ga0209233_1005855 Ga0209233_10058553 181
191 3300025272 Ga0209455_1000054 Ga0209455_1000054181 181
192 3300025272 Ga0209455_1002220 Ga0209455_10022208 181
193 3300025273 Ga0209673_1003647 Ga0209673_10036477 181
194 3300025284 Ga0209130_1000030 Ga0209130_1000030231 181
195 3300025294 Ga0209025_1019307 Ga0209025_10193074 181
196 3300025295 Ga0209564_1000364 Ga0209564_100036411 181
197 3300025297 Ga0209758_1000357 Ga0209758_10003573 181
198 3300025297 Ga0209758_1001342 Ga0209758_100134213 181
199 3300025297 Ga0209758_1001459 Ga0209758_100145923 181
200 3300025299 Ga0209256_1002320 Ga0209256_100232019 181
201 3300025302 Ga0207426_1000047 Ga0207426_1000047170 181
202 3300025303 Ga0209051_1001764 Ga0209051_100176410 181
203 3300025304 Ga0209257_1016732 Ga0209257_10167325 181
204 3300026067 Ga0207678_10079153 Ga0207678_100791534 181
205 3300028379 Ga0268266_10122780 Ga0268266_101227802 181
206 3300028381 Ga0268264_10168760 Ga0268264_101687602 181
207 3300031344 Ga0265316_10213031 Ga0265316_102130311 181
208 3300041413 Ga0439465_0007535 Ga0439465_0007535_1649_2200 181
209 3300041413 Ga0439465_0065673 Ga0439465_0065673_266_817 181
210 3300046457 Ga0495590_0026811 Ga0495590_0026811_798_1349 181
211 3300046506 Ga0495583_0065248 Ga0495583_0065248_51_602 181
212 3300046512 Ga0495610_0019884 Ga0495610_0019884_2372_2923 181
213 3300046522 Ga0495643_0009269 Ga0495643_0009269_514_1065 181
214 3300046558 Ga0495633_0001360 Ga0495633_0001360_8589_9143 181
215 3300048909 Ga0496106_0000106 Ga0496106_0000106_7028_7579 181
216 3300048919 Ga0496116_0036053 Ga0496116_0036053_2296_2847 181
217 3300048920 Ga0496117_0042063 Ga0496117_0042063_2519_3070 181
218 3300048921 Ga0496118_0016317 Ga0496118_0016317_757_1308 181
219 3300048924 Ga0496121_0033035 Ga0496121_0033035_617_1168 181
220 3300048925 Ga0496122_0029057 Ga0496122_0029057_3924_4475 181
221 3300048926 Ga0496123_0030152 Ga0496123_0030152_3150_3701 181
222 3300048927 Ga0496124_0079899 Ga0496124_0079899_736_1287 181
223 3300048928 Ga0496125_0013718 Ga0496125_0013718_6880_7431 181
224 3300053134 Ga0500658_0125606 Ga0500658_0125606_453_1004 181
225 3300053139 Ga0500568_0002618 Ga0500568_0002618_9746_10297 181
226 3300053145 Ga0500586_001283 Ga0500586_001283_433_987 181
227 3300053156 Ga0500622_0000237 Ga0500622_0000237_1591_2142 181
228 3300053160 Ga0500633_0003057 Ga0500633_0003057_154_705 181
229 3300003761 Ga0055535_1007899 Ga0055535_10078993 182
230 3300005437 Ga0070710_10931639 Ga0070710_109316391 182
231 3300005548 Ga0070665_100056753 Ga0070665_1000567534 182
232 3300009093 Ga0105240_10059422 Ga0105240_100594222 182
233 3300013105 Ga0157369_10990739 Ga0157369_109907391 182
234 3300014325 Ga0163163_10585375 Ga0163163_105853751 182
235 3300025206 Ga0209435_102371 Ga0209435_1023713 182
236 3300025242 Ga0209258_100620 Ga0209258_10062025 182
237 3300025904 Ga0207647_10222766 Ga0207647_102227662 182
238 3300025913 Ga0207695_10230850 Ga0207695_102308503 182
239 3300025913 Ga0207695_10472573 Ga0207695_104725732 182
240 3300025914 Ga0207671_10546234 Ga0207671_105462342 182
241 3300025929 Ga0207664_11474847 Ga0207664_114748471 182
242 3300028379 Ga0268266_10000234 Ga0268266_1000023421 182
243 3300046528 Ga0495642_0034381 Ga0495642_0034381_1034_1618 182
244 3300002067 JGI24735J21928_10000803 JGI24735J21928_100008038 183
245 3300003756 Ga0055533_1000410 Ga0055533_10004105 183
246 3300013105 Ga0157369_10334811 Ga0157369_103348112 183
247 3300014497 Ga0182008_10136890 Ga0182008_101368901 183
248 3300015262 Ga0182007_10005061 Ga0182007_100050611 183
249 3300015687 Ga0183368_1002 Ga0183368_10021107 183
250 3300021361 Ga0213872_10001721 Ga0213872_100017217 183
251 3300021361 Ga0213872_10006502 Ga0213872_100065025 183
252 3300025226 Ga0209674_100014 Ga0209674_100014355 183
253 3300025904 Ga0207647_10105232 Ga0207647_101052323 183
254 3300031727 Ga0316576_10209157 Ga0316576_102091571 183
255 3300031728 Ga0316578_10052050 Ga0316578_100520502 183
256 3300032133 Ga0316583_10038843 Ga0316583_100388432 183
257 3300032133 Ga0316583_10071905 Ga0316583_100719051 183
258 3300035398 Ga0316574_0024092 Ga0316574_0024092_1684_2268 183
259 3300036712 Ga0316584_0023303 Ga0316584_0023303_501_1085 183
260 3300039447 Ga0436361_0001950 Ga0436361_0001950_7967_8542 183
261 3300039447 Ga0436361_0053779 Ga0436361_0053779_3873_4502 183
262 3300039447 Ga0436361_0471854 Ga0436361_0471854_535_1161 183
263 3300044693 Ga0466961_0257796 Ga0466961_0257796_230_805 183
264 3300045049 Ga0466959_0065897 Ga0466959_0065897_29_604 183
265 3300048918 Ga0496115_0000413 Ga0496115_0000413_33407_33958 183

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF16157

DUF4865

Domain of unknown function (DUF4865)

1

183

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
2pd1-assembly1.cif.gz_A crystal structure of ne2512 protein of unknown function from nitrosomonas europaea 0.7638 2 99
1r6y-assembly1.cif.gz_A crystal structure of ygin from escherichia coli 0.7509 1 92
3bgu-assembly1.cif.gz_A crystal structure of a dimeric ferredoxin-like protein of unknown function (tfu_0763) from thermobifida fusca yx at 1.50 a resolution 0.7476 2 90
3kng-assembly1.cif.gz_B crystal structure of snoab, a cofactor-independent oxygenase from streptomyces nogalater, determined to 1.9 resolution 0.7439 2 92
4dpo-assembly1.cif.gz_B crystal structure of a conserved protein mm_1583 from methanosarcina mazei go1 0.7343 2 91
ID Description Score Start End Superfamily
af_Q2G1Q7_1_176_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8951 1 181 3.30.70.100
af_Q2G1Q7_1_176_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8901 1 181 3.30.70.100
af_P9WLA3_114_212_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7739 91 162 3.30.70.100
2pd1D01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7618 2 90 3.30.70.100
3bguB01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.746 1 90 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A3N7D8T0-F1-model_v4 DUF4865 domain-containing protein 0.9786 2 182
AF-A0A0G9H484-F1-model_v4 DUF4865 domain-containing protein 0.9785 1 183
AF-A0A0G9H484-F1-model_v4 DUF4865 domain-containing protein 0.9732 1 183
AF-A0A2K4MQY7-F1-model_v4 DUF4865 domain-containing protein 0.9697 1 182
AF-A0A370X6G0-F1-model_v4 DUF4865 family protein 0.9686 1 183

Feature Viewer

pLDDT pTM Quality
94.21 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map