F373048

General Info

Members Datasets Scaffolds Average Seq Length
265 166 243 364

Family's Representative Sequence

Representative Sequence 3300003781|Ga0055536_1004775|Ga0055536_10047756
Length 393
Sequence MAVTFSRKPAYAAAAPAPGGSGDLRAKLMAALTNPYISASGAACLFLASLATLVLITSDPHAGSPVIRLELTKIGATKNAPEGWREALGGDPGHEAEFVPGQLGLSRNPFAPVQAEEGEATPAEGLANLPPIQQGPGLAQAPIAGLTAPGPGGGPLPIIAADGRTAAEAYARPFTPNGRPKVSVVIGGLGLNAQTTRAAIETLPGEITLSFAPYAEGLQGWIDLARAHGHEVLLETPMEPADYPANDPGPYTLIAANRPEDTVRKLEWLMSRASGYFGLSNYLGARFVESDTAMTTFNAVLKARGLAFVDDGLAQRRGGPIPRASADRVIDDELSATAIDAQLRALENGAAGRGQSLGSGFAYPVTITQVRVWAAGLQARGLQLAPASALAHR

Samples

Sample ID Description Type Environment
1 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
2 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
3 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
4 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
5 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
6 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
7 2643221583 Caulobacter sp. Root655 Isolate Unclassified
8 2643221584 Caulobacter sp. Root656 Isolate Unclassified
9 2643221640 Caulobacter sp. Root342 Isolate Unclassified
10 2643221642 Caulobacter sp. Root343 Isolate Unclassified
11 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
12 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
13 2818991435 Caulobacter henricii 536 Isolate Unclassified
14 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
15 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
16 2849560528 Caulobacter zeae 410 Isolate Unclassified
17 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
18 2851153111 Caulobacter radicis 736 Isolate Unclassified
19 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
20 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
21 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
22 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
23 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
24 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
25 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
26 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
27 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
28 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
29 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
30 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
31 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
32 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
33 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
34 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
50 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
51 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
52 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
53 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
54 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
57 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
65 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
66 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
67 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
69 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
71 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
72 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
74 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
98 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
99 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
100 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
101 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
102 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
103 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
104 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
105 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
106 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
107 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
108 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
109 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
110 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
111 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
112 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
113 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
114 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
115 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
116 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
117 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
118 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
119 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
120 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
121 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
122 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
123 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
124 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
125 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
126 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
127 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
128 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
129 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
130 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
131 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
132 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
133 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
134 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
135 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
136 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
137 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
138 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
139 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
140 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
141 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
142 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
143 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
145 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
146 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
147 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
148 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
149 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
150 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
151 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
152 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
153 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
154 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
155 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
156 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
157 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
158 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
159 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
160 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
161 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
162 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
163 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
164 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
165 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
166 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.7
Metatranscriptomes 0
Isolates 8.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 21.13
Nodule 0.38
Rhizoplane 2.64
Rhizosphere 64.91
Stem 0
Stem Tuber 0
Unclassified 10.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10031078 3300003215 Bacteria 1805
2 Ga0055524_1008359 3300003775 Bacteria 4305
3 Ga0055536_1004775 3300003781 Bacteria 6799
4 Ga0055536_1006298 3300003781 Bacteria 5581
5 Ga0055530_10005997 3300003791 Bacteria 5578
6 Ga0055531_10000528 3300003794 Bacteria 34315
7 Ga0065165_1000711 3300005262 Bacteria 47122
8 Ga0070658_10068309 3300005327 Bacteria 2905
9 Ga0070670_100000022 3300005331 Bacteria 199146
10 Ga0070666_10116274 3300005335 Bacteria 1852
11 Ga0070680_100001019 3300005336 Bacteria 20015
12 Ga0070680_100025991 3300005336 Bacteria 4682
13 Ga0070660_100005603 3300005339 Bacteria 8705
14 Ga0070668_100000042 3300005347 Bacteria 78694
15 Ga0070668_100044230 3300005347 Bacteria 3416
16 Ga0070659_100019649 3300005366 Bacteria 5124
17 Ga0070667_100000508 3300005367 Bacteria 39312
18 Ga0070667_100018027 3300005367 Bacteria 5851
19 Ga0070667_100103782 3300005367 Bacteria 2458
20 Ga0070681_10030836 3300005458 Bacteria 5382
21 Ga0070681_10061447 3300005458 Bacteria 3731
22 Ga0070681_10184968 3300005458 Bacteria 2004
23 Ga0070679_100011485 3300005530 Bacteria 8440
24 Ga0068853_100021697 3300005539 Bacteria 5358
25 Ga0068853_100024558 3300005539 Bacteria 5054
26 Ga0070665_100000418 3300005548 Bacteria 62048
27 Ga0070665_100001884 3300005548 Bacteria 23770
28 Ga0070665_100014450 3300005548 Bacteria 7919
29 Ga0070665_100020455 3300005548 Bacteria 6647
30 Ga0068855_100041023 3300005563 Bacteria 5488
31 Ga0068855_100151958 3300005563 Bacteria 2632
32 Ga0068855_100327410 3300005563 Bacteria 1692
33 Ga0068859_100008132 3300005617 Bacteria 10635
34 Ga0068859_100037204 3300005617 Bacteria 4885
35 Ga0068864_100000757 3300005618 Bacteria 27175
36 Ga0068861_100112854 3300005719 Bacteria 2180
37 Ga0068863_100000066 3300005841 Bacteria 117816
38 Ga0068863_100000119 3300005841 Bacteria 82539
39 Ga0068863_100015421 3300005841 Bacteria 7346
40 Ga0068863_100020615 3300005841 Bacteria 6300
41 Ga0068858_100002124 3300005842 Bacteria 20089
42 Ga0068858_100009974 3300005842 Bacteria 9020
43 Ga0068860_100000133 3300005843 Bacteria 120382
44 Ga0068860_100000212 3300005843 Bacteria 91248
45 Ga0068860_100014882 3300005843 Bacteria 7606
46 Ga0068862_100007242 3300005844 Bacteria 9211
47 Ga0068862_100027340 3300005844 Bacteria 4802
48 Ga0068862_100092991 3300005844 Bacteria 2629
49 Ga0068862_100141830 3300005844 Bacteria 2133
50 Ga0075368_10010296 3300006042 Bacteria 3378
51 Ga0075364_10002819 3300006051 Bacteria 9788
52 Ga0075367_10012466 3300006178 Bacteria 4535
53 Ga0075369_10008315 3300006186 Bacteria 3991
54 Ga0075366_10078928 3300006195 Bacteria 1964
55 Ga0075370_10024881 3300006353 Bacteria 3310
56 Ga0097620_100001582 3300006931 Bacteria 23209
57 Ga0097620_100008132 3300006931 Bacteria 10635
58 Ga0097620_100037205 3300006931 Bacteria 4885
59 Ga0079104_1012982 3300006946 Bacteria 2590
60 Ga0105250_10005952 3300009092 Bacteria 5390
61 Ga0105240_10003732 3300009093 Bacteria 23537
62 Ga0105240_10046037 3300009093 Bacteria 5530
63 Ga0105240_10236718 3300009093 Bacteria 2119
64 Ga0105248_10003646 3300009177 Bacteria 17096
65 Ga0105248_10004488 3300009177 Bacteria 15447
66 Ga0105248_10017964 3300009177 Bacteria 7806
67 Ga0105248_10035909 3300009177 Bacteria 5544
68 Ga0105248_10077036 3300009177 Bacteria 3748
69 Ga0105238_10023706 3300009551 Bacteria 6254
70 Ga0105238_10026036 3300009551 Bacteria 5962
71 Ga0105249_10004052 3300009553 Bacteria 12632
72 Ga0105249_10068726 3300009553 Bacteria 3268
73 Ga0105249_10142996 3300009553 Bacteria 2296
74 Ga0105239_10036093 3300010375 Bacteria 5428
75 Ga0163162_10339850 3300013306 Bacteria 1634
76 Ga0157380_10139602 3300014326 Bacteria 2080
77 Ga0157379_10003056 3300014968 Bacteria 14141
78 Ga0157379_10037451 3300014968 Bacteria 4325
79 Ga0213876_10016980 3300021384 Bacteria 3845
80 Ga0209148_1008455 3300025254 Bacteria 2068
81 Ga0209565_1000149 3300025263 Bacteria 96195
82 Ga0209676_1000295 3300025292 Bacteria 100711
83 Ga0209676_1000414 3300025292 Bacteria 76877
84 Ga0209564_1002321 3300025295 Bacteria 15414
85 Ga0209758_1002036 3300025297 Bacteria 21701
86 Ga0209758_1005596 3300025297 Bacteria 9558
87 Ga0209050_1000362 3300025298 Bacteria 87030
88 Ga0209050_1005917 3300025298 Bacteria 7457
89 Ga0209050_1021187 3300025298 Bacteria 2380
90 Ga0209256_1004236 3300025299 Bacteria 9195
91 Ga0209256_1005495 3300025299 Bacteria 7253
92 Ga0209256_1014605 3300025299 Bacteria 2811
93 Ga0209257_1000036 3300025304 Bacteria 616006
94 Ga0209257_1000282 3300025304 Bacteria 113789
95 Ga0209257_1005655 3300025304 Bacteria 8636
96 Ga0207705_10002027 3300025909 Bacteria 15769
97 Ga0207705_10149115 3300025909 Bacteria 1751
98 Ga0207707_10147627 3300025912 Bacteria 2056
99 Ga0207695_10000837 3300025913 Bacteria 56634
100 Ga0207695_10007867 3300025913 Bacteria 13459
101 Ga0207695_10036928 3300025913 Bacteria 5275
102 Ga0207660_10007742 3300025917 Bacteria 6956
103 Ga0207660_10182944 3300025917 Bacteria 1628
104 Ga0207657_10017426 3300025919 Bacteria 6887
105 Ga0207657_10031047 3300025919 Bacteria 4844
106 Ga0207652_10001554 3300025921 Bacteria 20200
107 Ga0207652_10048861 3300025921 Bacteria 3618
108 Ga0207650_10000016 3300025925 Bacteria 361958
109 Ga0207690_10025165 3300025932 Bacteria 3733
110 Ga0207711_10001468 3300025941 Bacteria 21987
111 Ga0207711_10012799 3300025941 Bacteria 6968
112 Ga0207667_10004404 3300025949 Bacteria 17251
113 Ga0207667_10034966 3300025949 Bacteria 5393
114 Ga0207667_10158385 3300025949 Bacteria 2330
115 Ga0207712_10002726 3300025961 Bacteria 11285
116 Ga0207712_10050903 3300025961 Bacteria 2894
117 Ga0207668_10000019 3300025972 Bacteria 152108
118 Ga0207668_10000241 3300025972 Bacteria 36742
119 Ga0207668_10047301 3300025972 Bacteria 2944
120 Ga0207658_10000295 3300025986 Bacteria 52135
121 Ga0207658_10017791 3300025986 Bacteria 4897
122 Ga0207658_10039033 3300025986 Bacteria 3424
123 Ga0207703_10006921 3300026035 Bacteria 9026
124 Ga0207639_10027411 3300026041 Bacteria 4151
125 Ga0207639_10308749 3300026041 Bacteria 1401
126 Ga0207641_10000011 3300026088 Bacteria 384362
127 Ga0207641_10000612 3300026088 Bacteria 39133
128 Ga0207641_10009691 3300026088 Bacteria 7936
129 Ga0207676_10002400 3300026095 Bacteria 13363
130 Ga0207676_10007791 3300026095 Bacteria 7616
131 Ga0207674_10056120 3300026116 Bacteria 4001
132 Ga0207675_100023654 3300026118 Bacteria 5714
133 Ga0268266_10000003 3300028379 Bacteria 1701703
134 Ga0268266_10001814 3300028379 Bacteria 24161
135 Ga0268266_10003648 3300028379 Bacteria 15221
136 Ga0268266_10022099 3300028379 Bacteria 5423
137 Ga0268265_10001088 3300028380 Bacteria 24179
138 Ga0268265_10002074 3300028380 Bacteria 15637
139 Ga0268265_10007210 3300028380 Bacteria 7513
140 Ga0268265_10033777 3300028380 Bacteria 3722
141 Ga0268264_10000091 3300028381 Bacteria 233338
142 Ga0268264_10000207 3300028381 Bacteria 120086
143 Ga0268264_10008205 3300028381 Bacteria 8673
144 Ga0307517_10058084 3300028786 Bacteria 3735
145 Ga0307515_10018388 3300028794 Bacteria 12655
146 Ga0307515_10090547 3300028794 Bacteria 3835
147 Ga0307515_10198777 3300028794 Bacteria 1888
148 Ga0307513_10000873 3300031456 Bacteria 43622
149 Ga0307516_10000030 3300031730 Bacteria 159694
150 Ga0373947_0051433 3300035725 Bacteria 2479
151 Ga0395899_0108724 3300037312 Bacteria 1995
152 Ga0395900_0021999 3300037418 Bacteria 6520
153 Ga0395898_0244192 3300037466 Bacteria 1712
154 Ga0395905_0013716 3300037471 Bacteria 7759
155 Ga0395905_0030066 3300037471 Bacteria 5120
156 Ga0436365_0656099 3300039437 Bacteria 4996
157 Ga0439465_0037027 3300041413 Bacteria 1568
158 Ga0439446_0008335 3300042156 Bacteria 2748
159 Ga0495627_000879 3300046453 Bacteria 21159
160 Ga0495590_0002209 3300046457 Bacteria 8131
161 Ga0495638_0000441 3300046460 Bacteria 50064
162 Ga0495638_0001712 3300046460 Bacteria 19316
163 Ga0495638_0002843 3300046460 Bacteria 13873
164 Ga0495638_0003079 3300046460 Bacteria 13234
165 Ga0495638_0010399 3300046460 Bacteria 6468
166 Ga0495650_0000046 3300046471 Bacteria 342987
167 Ga0495585_0083047 3300046492 Bacteria 1734
168 Ga0495606_0002829 3300046507 Bacteria 19251
169 Ga0495610_0001569 3300046512 Bacteria 20131
170 Ga0495610_0002476 3300046512 Bacteria 15481
171 Ga0495616_0003030 3300046513 Bacteria 10891
172 Ga0495620_0031642 3300046515 Bacteria 2422
173 Ga0495631_0002465 3300046518 Bacteria 10428
174 Ga0495637_0002096 3300046520 Bacteria 11216
175 Ga0495648_0000553 3300046524 Bacteria 40143
176 Ga0495648_0070267 3300046524 Bacteria 2035
177 Ga0495654_0000039 3300046530 Bacteria 185363
178 Ga0495654_0011576 3300046530 Bacteria 4769
179 Ga0495668_0000141 3300046616 Bacteria 108840
180 Ga0495668_0040182 3300046616 Bacteria 2609
181 Ga0495625_0000854 3300046660 Bacteria 41503
182 Ga0495625_0002619 3300046660 Bacteria 19256
183 Ga0495625_0017757 3300046660 Bacteria 5563
184 Ga0495625_0099695 3300046660 Bacteria 1997
185 Ga0495669_0000014 3300046684 Bacteria 140832
186 Ga0495669_0013682 3300046684 Bacteria 3463
187 Ga0495671_0034481 3300046692 Bacteria 2573
188 Ga0495589_0030741 3300046794 Bacteria 2704
189 Ga0495672_0006648 3300047320 Bacteria 8884
190 Ga0495679_002625 3300047446 Bacteria 9023
191 Ga0495673_0000853 3300047469 Bacteria 28329
192 Ga0495673_0002362 3300047469 Bacteria 13394
193 Ga0495673_0002411 3300047469 Bacteria 13183
194 Ga0495681_0036503 3300047470 Bacteria 2429
195 Ga0495686_0000512 3300047472 Bacteria 56017
196 Ga0495686_0005941 3300047472 Bacteria 9499
197 Ga0495686_0009073 3300047472 Bacteria 7214
198 Ga0496106_0009305 3300048909 Bacteria 7262
199 Ga0496106_0135373 3300048909 Bacteria 1935
200 Ga0496107_0001541 3300048910 Bacteria 14314
201 Ga0496115_0000398 3300048918 Bacteria 35876
202 Ga0496115_0002868 3300048918 Bacteria 12420
203 Ga0496115_0016458 3300048918 Bacteria 5632
204 Ga0496115_0243002 3300048918 Bacteria 1484
205 Ga0496116_0146242 3300048919 Bacteria 1321
206 Ga0496117_0023814 3300048920 Bacteria 4863
207 Ga0496118_0064356 3300048921 Bacteria 2691
208 Ga0496119_0022659 3300048922 Bacteria 4487
209 Ga0496121_0000035 3300048924 Bacteria 374316
210 Ga0496121_0001011 3300048924 Bacteria 50244
211 Ga0496125_0058592 3300048928 Bacteria 3110
212 Ga0496126_0006901 3300048929 Bacteria 12578
213 Ga0495678_004316 3300049459 Bacteria 8281
214 Ga0501047_0002867 3300049581 Bacteria 16362
215 Ga0501047_0167277 3300049581 Bacteria 2069
216 Ga0501048_0051955 3300049582 Bacteria 2916
217 nmdc:mga00v17_725_c1 3300050491 Bacteria 18009
218 nmdc:mga07m45_24930_c1 3300050496 Bacteria 3279
219 nmdc:mga0sz30_7952_c1 3300050516 Bacteria 3991
220 Ga0500635_0002320 3300053080 Bacteria 4699
221 Ga0500578_0000077 3300053086 Bacteria 108269
222 Ga0500644_0000194 3300053088 Bacteria 37615
223 Ga0500641_0002022 3300053096 Bacteria 7201
224 Ga0500641_0002332 3300053096 Bacteria 6725
225 Ga0500556_0001380 3300053104 Bacteria 10608
226 Ga0500562_000830 3300053108 Bacteria 7522
227 Ga0500562_002662 3300053108 Bacteria 4441
228 Ga0500594_0000360 3300053118 Bacteria 10136
229 Ga0500607_021263 3300053121 Bacteria 3659
230 Ga0500608_000028 3300053122 Bacteria 66949
231 Ga0500614_002931 3300053123 Bacteria 3738
232 Ga0500618_000189 3300053125 Bacteria 50500
233 Ga0500559_0000221 3300053136 Bacteria 45774
234 Ga0500559_0003397 3300053136 Bacteria 7846
235 Ga0500559_0007592 3300053136 Bacteria 4790
236 Ga0500564_000177 3300053138 Bacteria 17045
237 Ga0500622_0004483 3300053156 Bacteria 8749
238 Ga0500622_0008972 3300053156 Bacteria 5559
239 Ga0500624_004418 3300053157 Unclassified 1851
240 Ga0500636_0016186 3300053177 Bacteria 4397
241 Ga0500637_0019922 3300053178 Bacteria 3625
242 Ga0500645_002864 3300053730 Bacteria 7391
243 Ga0500609_004607 3300053731 Bacteria 1901

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013306 Ga0163162_10339850 Ga0163162_103398501 289
2 3300005539 Ga0068853_100024558 Ga0068853_1000245582 296
3 3300026041 Ga0207639_10308749 Ga0207639_103087492 296
4 3300005841 Ga0068863_100015421 Ga0068863_1000154213 297
5 3300006931 Ga0097620_100001582 Ga0097620_1000015829 297
6 3300009177 Ga0105248_10004488 Ga0105248_100044887 297
7 3300046515 Ga0495620_0031642 Ga0495620_0031642_548_1636 297
8 3300035725 Ga0373947_0051433 Ga0373947_0051433_81_1211 300
9 3300005339 Ga0070660_100005603 Ga0070660_1000056035 303
10 3300009177 Ga0105248_10017964 Ga0105248_100179646 303
11 3300048919 Ga0496116_0146242 Ga0496116_0146242_135_1208 303
12 3300048920 Ga0496117_0023814 Ga0496117_0023814_1948_3021 304
13 3300048921 Ga0496118_0064356 Ga0496118_0064356_748_1821 304
14 3300048922 Ga0496119_0022659 Ga0496119_0022659_1345_2418 304
15 3300048924 Ga0496121_0000035 Ga0496121_0000035_254352_255425 304
16 3300005548 Ga0070665_100000418 Ga0070665_10000041845 305
17 3300010375 Ga0105239_10036093 Ga0105239_100360932 305
18 3300025909 Ga0207705_10149115 Ga0207705_101491152 305
19 3300025919 Ga0207657_10017426 Ga0207657_100174262 305
20 3300028379 Ga0268266_10000003 Ga0268266_100000031140 305
21 3300048918 Ga0496115_0016458 Ga0496115_0016458_3155_4279 305
22 3300050491 nmdc:mga00v17_725_c1 nmdc:mga00v17_725_c1_1921_3033 306
23 3300050496 nmdc:mga07m45_24930_c1 nmdc:mga07m45_24930_c1_274_1386 306
24 3300053080 Ga0500635_0002320 Ga0500635_0002320_1891_2979 306
25 3300053121 Ga0500607_021263 Ga0500607_021263_743_1831 306
26 3300053123 Ga0500614_002931 Ga0500614_002931_2384_3472 306
27 3300053157 Ga0500624_004418 Ga0500624_004418_242_1330 306
28 3300053177 Ga0500636_0016186 Ga0500636_0016186_1471_2559 306
29 3300053178 Ga0500637_0019922 Ga0500637_0019922_1348_2436 306
30 3300009177 Ga0105248_10003646 Ga0105248_100036469 307
31 3300025941 Ga0207711_10001468 Ga0207711_1000146820 307
32 3300005331 Ga0070670_100000022 Ga0070670_10000002211 308
33 3300005347 Ga0070668_100000042 Ga0070668_1000000423 308
34 3300005367 Ga0070667_100000508 Ga0070667_1000005086 308
35 3300005548 Ga0070665_100001884 Ga0070665_10000188424 308
36 3300005617 Ga0068859_100037204 Ga0068859_1000372045 308
37 3300005618 Ga0068864_100000757 Ga0068864_1000007578 308
38 3300005841 Ga0068863_100000119 Ga0068863_10000011939 308
39 3300005842 Ga0068858_100009974 Ga0068858_1000099747 308
40 3300005843 Ga0068860_100000133 Ga0068860_100000133117 308
41 3300006042 Ga0075368_10010296 Ga0075368_100102964 308
42 3300006051 Ga0075364_10002819 Ga0075364_100028198 308
43 3300006178 Ga0075367_10012466 Ga0075367_100124662 308
44 3300006931 Ga0097620_100037205 Ga0097620_1000372052 308
45 3300009177 Ga0105248_10035909 Ga0105248_100359092 308
46 3300009553 Ga0105249_10004052 Ga0105249_100040526 308
47 3300014326 Ga0157380_10139602 Ga0157380_101396023 308
48 3300014968 Ga0157379_10003056 Ga0157379_1000305616 308
49 3300025925 Ga0207650_10000016 Ga0207650_10000016136 308
50 3300025941 Ga0207711_10012799 Ga0207711_100127999 308
51 3300025961 Ga0207712_10002726 Ga0207712_100027266 308
52 3300025972 Ga0207668_10000241 Ga0207668_1000024121 308
53 3300025986 Ga0207658_10000295 Ga0207658_1000029542 308
54 3300026035 Ga0207703_10006921 Ga0207703_100069217 308
55 3300026088 Ga0207641_10000612 Ga0207641_1000061239 308
56 3300026095 Ga0207676_10002400 Ga0207676_100024002 308
57 3300028379 Ga0268266_10003648 Ga0268266_100036486 308
58 3300028380 Ga0268265_10001088 Ga0268265_100010889 308
59 3300028381 Ga0268264_10000207 Ga0268264_1000020755 308
60 3300048909 Ga0496106_0135373 Ga0496106_0135373_802_1908 308
61 3300005458 Ga0070681_10184968 Ga0070681_101849681 310
62 3300025254 Ga0209148_1008455 Ga0209148_10084552 310
63 3300025912 Ga0207707_10147627 Ga0207707_101476273 310
64 3300006195 Ga0075366_10078928 Ga0075366_100789283 311
65 3300046507 Ga0495606_0002829 Ga0495606_0002829_12327_13508 315
66 3300009093 Ga0105240_10046037 Ga0105240_100460371 317
67 3300025917 Ga0207660_10182944 Ga0207660_101829442 317
68 3300005336 Ga0070680_100025991 Ga0070680_1000259916 318
69 3300005458 Ga0070681_10061447 Ga0070681_100614473 318
70 3300005563 Ga0068855_100041023 Ga0068855_1000410237 318
71 3300009551 Ga0105238_10023706 Ga0105238_100237063 318
72 3300025913 Ga0207695_10000837 Ga0207695_1000083733 318
73 3300025913 Ga0207695_10036928 Ga0207695_100369283 318
74 3300025921 Ga0207652_10048861 Ga0207652_100488613 318
75 3300025949 Ga0207667_10034966 Ga0207667_100349665 318
76 3300046684 Ga0495669_0013682 Ga0495669_0013682_1650_2756 320
77 3300009092 Ga0105250_10005952 Ga0105250_100059523 322
78 3300009093 Ga0105240_10003732 Ga0105240_1000373210 322
79 3300009177 Ga0105248_10077036 Ga0105248_100770366 322
80 3300014968 Ga0157379_10037451 Ga0157379_100374513 322
81 3300025913 Ga0207695_10007867 Ga0207695_1000786710 322
82 3300037471 Ga0395905_0030066 Ga0395905_0030066_3393_4490 325
83 3300005336 Ga0070680_100001019 Ga0070680_10000101914 327
84 3300005366 Ga0070659_100019649 Ga0070659_1000196497 327
85 3300005458 Ga0070681_10030836 Ga0070681_100308367 327
86 3300005530 Ga0070679_100011485 Ga0070679_1000114855 327
87 3300005539 Ga0068853_100021697 Ga0068853_1000216977 327
88 3300005563 Ga0068855_100151958 Ga0068855_1001519583 327
89 3300025909 Ga0207705_10002027 Ga0207705_1000202713 327
90 3300025917 Ga0207660_10007742 Ga0207660_100077426 327
91 3300025919 Ga0207657_10031047 Ga0207657_100310475 327
92 3300025921 Ga0207652_10001554 Ga0207652_1000155417 327
93 3300025932 Ga0207690_10025165 Ga0207690_100251651 327
94 3300025949 Ga0207667_10004404 Ga0207667_100044049 327
95 3300026041 Ga0207639_10027411 Ga0207639_100274115 327
96 3300026116 Ga0207674_10056120 Ga0207674_100561204 327
97 3300039437 Ga0436365_0656099 Ga0436365_0656099_1037_2131 327
98 3300005367 Ga0070667_100103782 Ga0070667_1001037823 328
99 3300005548 Ga0070665_100014450 Ga0070665_1000144506 328
100 3300005844 Ga0068862_100027340 Ga0068862_1000273403 328
101 3300009553 Ga0105249_10142996 Ga0105249_101429963 328
102 3300025972 Ga0207668_10000019 Ga0207668_10000019104 328
103 3300025986 Ga0207658_10017791 Ga0207658_100177912 328
104 3300028379 Ga0268266_10001814 Ga0268266_1000181423 328
105 3300028380 Ga0268265_10033777 Ga0268265_100337773 328
106 3300005327 Ga0070658_10068309 Ga0070658_100683091 329
107 3300006946 Ga0079104_1012982 Ga0079104_10129822 329
108 3300009093 Ga0105240_10236718 Ga0105240_102367181 329
109 3300047472 Ga0495686_0009073 Ga0495686_0009073_5684_6871 329
110 3300028786 Ga0307517_10058084 Ga0307517_100580843 330
111 3300046460 Ga0495638_0001712 Ga0495638_0001712_7788_8975 330
112 3300005842 Ga0068858_100002124 Ga0068858_10000212416 331
113 3300046794 Ga0495589_0030741 Ga0495589_0030741_1358_2545 331
114 3300005841 Ga0068863_100000066 Ga0068863_100000066101 332
115 3300021384 Ga0213876_10016980 Ga0213876_100169803 332
116 3300025949 Ga0207667_10158385 Ga0207667_101583854 332
117 3300026088 Ga0207641_10000011 Ga0207641_10000011288 332
118 3300026095 Ga0207676_10007791 Ga0207676_100077916 332
119 3300046520 Ga0495637_0002096 Ga0495637_0002096_3677_4858 332
120 3300053104 Ga0500556_0001380 Ga0500556_0001380_8074_9255 332
121 3300048918 Ga0496115_0000398 Ga0496115_0000398_25408_26556 333
122 3300049581 Ga0501047_0167277 Ga0501047_0167277_358_1485 333
123 3300049582 Ga0501048_0051955 Ga0501048_0051955_250_1377 333
124 3300048918 Ga0496115_0002868 Ga0496115_0002868_3195_4376 334
125 3300049581 Ga0501047_0002867 Ga0501047_0002867_2898_4028 334
126 3300009551 Ga0105238_10026036 Ga0105238_100260367 335
127 3300025299 Ga0209256_1005495 Ga0209256_10054952 336
128 3300037418 Ga0395900_0021999 Ga0395900_0021999_3986_5101 336
129 3300037471 Ga0395905_0013716 Ga0395905_0013716_5440_6555 336
130 3300047472 Ga0495686_0000512 Ga0495686_0000512_32234_33550 337
131 3300003775 Ga0055524_1008359 Ga0055524_10083594 338
132 3300005548 Ga0070665_100020455 Ga0070665_1000204556 338
133 3300025263 Ga0209565_1000149 Ga0209565_100014929 338
134 3300025297 Ga0209758_1005596 Ga0209758_10055967 338
135 3300025299 Ga0209256_1004236 Ga0209256_10042363 338
136 3300028379 Ga0268266_10022099 Ga0268266_100220992 338
137 3300037312 Ga0395899_0108724 Ga0395899_0108724_199_1320 338
138 3300037466 Ga0395898_0244192 Ga0395898_0244192_199_1320 338
139 3300005335 Ga0070666_10116274 Ga0070666_101162742 339
140 3300005367 Ga0070667_100018027 Ga0070667_1000180276 339
141 3300005563 Ga0068855_100327410 Ga0068855_1003274102 339
142 3300005617 Ga0068859_100008132 Ga0068859_1000081327 339
143 3300005719 Ga0068861_100112854 Ga0068861_1001128542 339
144 3300005841 Ga0068863_100020615 Ga0068863_1000206153 339
145 3300005843 Ga0068860_100014882 Ga0068860_1000148825 339
146 3300005844 Ga0068862_100007242 Ga0068862_1000072423 339
147 3300006931 Ga0097620_100008132 Ga0097620_1000081327 339
148 3300009553 Ga0105249_10068726 Ga0105249_100687262 339
149 3300025961 Ga0207712_10050903 Ga0207712_100509032 339
150 3300025986 Ga0207658_10039033 Ga0207658_100390332 339
151 3300026088 Ga0207641_10009691 Ga0207641_100096917 339
152 3300026118 Ga0207675_100023654 Ga0207675_1000236542 339
153 3300028380 Ga0268265_10007210 Ga0268265_100072106 339
154 3300028381 Ga0268264_10008205 Ga0268264_100082053 339
155 3300046460 Ga0495638_0003079 Ga0495638_0003079_9330_10508 339
156 3300046660 Ga0495625_0017757 Ga0495625_0017757_2239_3417 339
157 3300046692 Ga0495671_0034481 Ga0495671_0034481_1313_2491 339
158 3300047320 Ga0495672_0006648 Ga0495672_0006648_6710_7888 339
159 3300053096 Ga0500641_0002332 Ga0500641_0002332_4532_5653 339
160 3300053136 Ga0500559_0000221 Ga0500559_0000221_9695_10879 339
161 3300053108 Ga0500562_000830 Ga0500562_000830_4377_5504 340
162 3300046453 Ga0495627_000879 Ga0495627_000879_7295_8482 341
163 3300046524 Ga0495648_0000553 Ga0495648_0000553_6555_7736 341
164 3300047469 Ga0495673_0002411 Ga0495673_0002411_6729_7910 341
165 3300053088 Ga0500644_0000194 Ga0500644_0000194_11953_13134 341
166 3300053138 Ga0500564_000177 Ga0500564_000177_9633_10814 341
167 3300005844 Ga0068862_100141830 Ga0068862_1001418302 343
168 3300047469 Ga0495673_0002362 Ga0495673_0002362_4217_5401 343
169 3300005347 Ga0070668_100044230 Ga0070668_1000442302 344
170 3300005843 Ga0068860_100000212 Ga0068860_10000021286 344
171 3300005844 Ga0068862_100092991 Ga0068862_1000929912 344
172 3300025972 Ga0207668_10047301 Ga0207668_100473013 344
173 3300028380 Ga0268265_10002074 Ga0268265_100020743 344
174 3300028381 Ga0268264_10000091 Ga0268264_10000091180 344
175 3300031730 Ga0307516_10000030 Ga0307516_1000003097 344
176 3300046684 Ga0495669_0000014 Ga0495669_0000014_36874_38034 344
177 3300031456 Ga0307513_10000873 Ga0307513_1000087313 345
178 3300047469 Ga0495673_0000853 Ga0495673_0000853_6868_8055 346
179 3300046460 Ga0495638_0000441 Ga0495638_0000441_45018_46199 347
180 3300041413 Ga0439465_0037027 Ga0439465_0037027_112_1287 348
181 3300042156 Ga0439446_0008335 Ga0439446_0008335_1418_2593 348
182 3300053096 Ga0500641_0002022 Ga0500641_0002022_802_1983 348
183 3300053730 Ga0500645_002864 Ga0500645_002864_4374_5555 348
184 iso_pu_bacteria 2582581279 2585148784 353
185 iso_pu_bacteria 2791355048 2792460409 353
186 iso_pu_bacteria 2843744320 2843745097 353
187 iso_pu_bacteria 2849560528 2849564111 353
188 iso_pu_bacteria 2849573788 2849575575 353
189 iso_pu_bacteria 2851153111 2851155242 353
190 iso_pu_bacteria 2898329390 2898331143 353
191 iso_pu_bacteria 2857504554 2857508487 354
192 iso_pu_bacteria 2585428106 2587919095 355
193 iso_pu_bacteria 2643221545 2643748927 355
194 iso_pu_bacteria 2643221640 2644227495 355
195 iso_pu_bacteria 2643221642 2644236987 355
196 iso_pu_bacteria 2643221691 2644509314 355
197 iso_pu_bacteria 2884960567 2884961284 355
198 iso_pu_bacteria 2928531327 2928531793 355
199 3300046660 Ga0495625_0000854 Ga0495625_0000854_30292_31470 356
200 iso_pu_bacteria 2643221552 2643783112 356
201 iso_pu_bacteria 2643221584 2643930288 356
202 3300028794 Ga0307515_10018388 Ga0307515_100183888 357
203 3300028794 Ga0307515_10090547 Ga0307515_100905472 357
204 3300028794 Ga0307515_10198777 Ga0307515_101987772 357
205 3300046457 Ga0495590_0002209 Ga0495590_0002209_5971_7152 357
206 3300046512 Ga0495610_0001569 Ga0495610_0001569_13795_14976 357
207 3300046518 Ga0495631_0002465 Ga0495631_0002465_8286_9467 357
208 3300046530 Ga0495654_0011576 Ga0495654_0011576_3330_4511 357
209 3300046616 Ga0495668_0000141 Ga0495668_0000141_98895_100070 357
210 3300047472 Ga0495686_0005941 Ga0495686_0005941_5177_6358 357
211 3300049459 Ga0495678_004316 Ga0495678_004316_1149_2330 357
212 3300053086 Ga0500578_0000077 Ga0500578_0000077_5774_6955 357
213 3300053108 Ga0500562_002662 Ga0500562_002662_1919_3100 357
214 3300053118 Ga0500594_0000360 Ga0500594_0000360_5974_7155 357
215 3300053156 Ga0500622_0004483 Ga0500622_0004483_1402_2583 357
216 iso_pu_bacteria 2510917020 2511123174 357
217 iso_pu_bacteria 2643221583 2643927021 357
218 3300053122 Ga0500608_000028 Ga0500608_000028_23793_24971 358
219 3300053136 Ga0500559_0003397 Ga0500559_0003397_6293_7471 358
220 3300053156 Ga0500622_0008972 Ga0500622_0008972_3070_4248 358
221 3300003781 Ga0055536_1004775 Ga0055536_10047756 359
222 3300003781 Ga0055536_1006298 Ga0055536_10062986 359
223 3300003791 Ga0055530_10005997 Ga0055530_100059976 359
224 3300003794 Ga0055531_10000528 Ga0055531_100005286 359
225 3300006186 Ga0075369_10008315 Ga0075369_100083152 359
226 3300025292 Ga0209676_1000295 Ga0209676_100029585 359
227 3300025292 Ga0209676_1000414 Ga0209676_100041410 359
228 3300025298 Ga0209050_1000362 Ga0209050_100036277 359
229 3300025298 Ga0209050_1005917 Ga0209050_10059172 359
230 3300025299 Ga0209256_1014605 Ga0209256_10146052 359
231 3300025304 Ga0209257_1000282 Ga0209257_100028277 359
232 3300025304 Ga0209257_1005655 Ga0209257_10056556 359
233 3300046616 Ga0495668_0040182 Ga0495668_0040182_1227_2411 359
234 3300048918 Ga0496115_0243002 Ga0496115_0243002_252_1433 359
235 3300048928 Ga0496125_0058592 Ga0496125_0058592_644_1825 359
236 3300048929 Ga0496126_0006901 Ga0496126_0006901_5238_6419 359
237 3300050516 nmdc:mga0sz30_7952_c1 nmdc:mga0sz30_7952_c1_1353_2534 359
238 3300053136 Ga0500559_0007592 Ga0500559_0007592_2239_3423 359
239 3300006353 Ga0075370_10024881 Ga0075370_100248812 360
240 3300025298 Ga0209050_1021187 Ga0209050_10211872 360
241 3300046460 Ga0495638_0002843 Ga0495638_0002843_8896_10077 360
242 3300046460 Ga0495638_0010399 Ga0495638_0010399_4832_6013 360
243 3300046471 Ga0495650_0000046 Ga0495650_0000046_103425_104606 360
244 3300046492 Ga0495585_0083047 Ga0495585_0083047_273_1454 360
245 3300046513 Ga0495616_0003030 Ga0495616_0003030_9571_10752 360
246 3300046524 Ga0495648_0070267 Ga0495648_0070267_748_1929 360
247 3300046530 Ga0495654_0000039 Ga0495654_0000039_8847_10028 360
248 3300046660 Ga0495625_0099695 Ga0495625_0099695_716_1897 360
249 3300053731 Ga0500609_004607 Ga0500609_004607_579_1760 360
250 3300046512 Ga0495610_0002476 Ga0495610_0002476_8519_9703 361
251 3300047446 Ga0495679_002625 Ga0495679_002625_5056_6240 361
252 3300047470 Ga0495681_0036503 Ga0495681_0036503_190_1374 361
253 3300053125 Ga0500618_000189 Ga0500618_000189_18593_19777 361
254 iso_pu_bacteria 2582581293 2585196876 361
255 iso_pu_bacteria 2818991435 2819537670 361
256 iso_pu_bacteria 2818991454 2819647447 361
257 3300046660 Ga0495625_0002619 Ga0495625_0002619_10677_11867 362
258 3300048909 Ga0496106_0009305 Ga0496106_0009305_4445_5635 362
259 3300048910 Ga0496107_0001541 Ga0496107_0001541_9872_11062 362
260 3300048924 Ga0496121_0001011 Ga0496121_0001011_30377_31567 362
261 3300025304 Ga0209257_1000036 Ga0209257_100003643 363
262 3300003215 JGI25153J46596_10031078 JGI25153J46596_100310782 365
263 3300005262 Ga0065165_1000711 Ga0065165_100071143 365
264 3300025295 Ga0209564_1002321 Ga0209564_10023219 365
265 3300025297 Ga0209758_1002036 Ga0209758_100203611 365

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04748

Polysacc_deac_2

Divergent polysaccharide deacetylase

184

391

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qv5-assembly2.cif.gz_B crystal structure of uncharacterized protein atu2773 from agrobacterium tumefaciens c58 0.7964 142 344
7x1x-assembly1.cif.gz_B crystal structure of cis-4,5-dihydrodiol phthalate dehydrogenase in complex with nad+ 0.7178 196 225
2nly-assembly1.cif.gz_A crystal structure of protein bh1492 from bacillus halodurans, pfam duf610 0.7108 167 343
2qv5-assembly2.cif.gz_B crystal structure of uncharacterized protein atu2773 from agrobacterium tumefaciens c58 0.6621 142 344
4lui-assembly1.cif.gz_A crystal structure of orotidine 5'-monophosphate decarboxylase from methanocaldococcus jannaschii 0.6454 173 313
ID Description Score Start End Superfamily
2qv5A01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.7894 154 344 3.20.20.370
af_Q9Y4E5_884_1001_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.7871 182 222 3.40.50.1010
af_P37691_16_246_3.20.20.370 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.7785 173 343 3.20.20.370
af_Q4DQ63_67_341_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.7592 182 225 3.40.640.10
2nlyA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.7108 167 343 3.20.20.370
ID Description Score Start End GO Terms
AF-A0A4S0QZ02-F1-model_v4 Divergent polysaccharide deacetylase family protein 0.9361 144 251 GO:0005975
AF-A0A354U1J5-F1-model_v4 deleted 0.9293 150 319
AF-A0A4S0XL06-F1-model_v4 deleted 0.928 130 246
AF-A0A4S0QZ02-F1-model_v4 Divergent polysaccharide deacetylase family protein 0.9199 144 251 GO:0005975
AF-A0A528TPQ9-F1-model_v4 Divergent polysaccharide deacetylase family protein 0.91 171 321 GO:0005975

Feature Viewer

pLDDT pTM Quality
60.33 0.57 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map