F372979

General Info

Members Datasets Scaffolds Average Seq Length
264 172 528 227

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2855386786|2855390879
Length 249
Sequence KAPLRRGRRKAGALDDATVRATWQVASLLLDYPDEGQPLDVVAQAIEALPASVAEPLARFLEHRRGTPLGALQADYVETFDTRRRCTLFLTYFLHGDTRKRGMALLRFKQAYLAAGLELDDTELPDHLAVVLEFAATADLEEGRRLLLDHRAGLELLRLSLTDLGSPYADLVTAVCAGLPPVGGDDLEMVRKLAAEGPPDEEVGLTPYGEPGFDAALTDPRYRPAPAPSGPVDLGLPAMPSAAPSGRGA

Samples

Sample ID Description Type Environment
1 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
2 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
41 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
42 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
43 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
44 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
45 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
46 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
47 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
48 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
63 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
64 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
65 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
102 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
105 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
106 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
107 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
108 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
109 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
110 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
111 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
112 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
113 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
114 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
115 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
116 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
117 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
118 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
119 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
120 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
121 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
122 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
123 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
124 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
125 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
126 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
127 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
128 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
129 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
130 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
131 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
132 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
133 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
143 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
144 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
145 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
146 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
147 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
148 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
149 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
150 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
151 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
152 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
153 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
154 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
155 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
157 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
158 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
159 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
160 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
161 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
162 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
163 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
164 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
165 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
166 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
167 2643221561 Nocardioides sp. Root151 Isolate Unclassified
168 2643221567 Phycicoccus sp. Root563 Isolate Unclassified
169 2643221604 Nocardioides sp. Root190 Isolate Unclassified
170 2643221624 Phycicoccus sp. Root101 Isolate Unclassified
171 2643221696 Nocardioides sp. Root140 Isolate Unclassified
172 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.35
Metatranscriptomes 0
Isolates 2.65

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.71
Nodule 0
Rhizoplane 10.98
Rhizosphere 76.89
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24738J21930_10002079 3300002075 Bacteria 5360
2 JGI24744J21845_10001889 3300002077 Bacteria 4216
3 Ga0070658_10074937 3300005327 Bacteria 2776
4 Ga0070683_100075209 3300005329 Bacteria 3155
5 Ga0070683_100118417 3300005329 Bacteria 2501
6 Ga0070683_100468164 3300005329 Bacteria 1203
7 Ga0070680_100033764 3300005336 Bacteria 4126
8 Ga0070680_100700276 3300005336 Bacteria 872
9 Ga0070682_100010573 3300005337 Bacteria 5239
10 Ga0070682_100184842 3300005337 Bacteria 1459
11 Ga0070682_100198428 3300005337 Bacteria 1414
12 Ga0070682_100375549 3300005337 Bacteria 1067
13 Ga0068868_100007754 3300005338 Bacteria 7659
14 Ga0070660_100465249 3300005339 Bacteria 1050
15 Ga0070692_10009582 3300005345 Bacteria 4371
16 Ga0070669_100070712 3300005353 Bacteria 2580
17 Ga0070675_101027407 3300005354 Bacteria 757
18 Ga0070674_100004097 3300005356 Bacteria 8282
19 Ga0070673_100099319 3300005364 Bacteria 2394
20 Ga0070659_100029684 3300005366 Bacteria 4227
21 Ga0070659_100121249 3300005366 Bacteria 2118
22 Ga0070659_100197982 3300005366 Bacteria 1653
23 Ga0070667_100073721 3300005367 Bacteria 2911
24 Ga0070714_100083860 3300005435 Bacteria 2780
25 Ga0070713_100304066 3300005436 Bacteria 1469
26 Ga0070701_10007841 3300005438 Bacteria 4588
27 Ga0070700_100003584 3300005441 Bacteria 8021
28 Ga0070700_100776419 3300005441 Bacteria 769
29 Ga0070694_100441204 3300005444 Bacteria 1026
30 Ga0070663_100607914 3300005455 Bacteria 920
31 Ga0070663_100715720 3300005455 Bacteria 852
32 Ga0070678_100318300 3300005456 Bacteria 1328
33 Ga0070681_10131523 3300005458 Bacteria 2435
34 Ga0070681_10184048 3300005458 Bacteria 2010
35 Ga0068867_100007401 3300005459 Bacteria 7765
36 Ga0070679_100067210 3300005530 Bacteria 3574
37 Ga0070679_100345929 3300005530 Bacteria 1435
38 Ga0070684_100018438 3300005535 Bacteria 5749
39 Ga0070684_100127452 3300005535 Bacteria 2294
40 Ga0070684_100856101 3300005535 Bacteria 851
41 Ga0070672_100119232 3300005543 Bacteria 2158
42 Ga0070695_100304457 3300005545 Bacteria 1179
43 Ga0070696_100009764 3300005546 Bacteria 6423
44 Ga0070693_100215279 3300005547 Bacteria 1256
45 Ga0068855_100238952 3300005563 Bacteria 2031
46 Ga0070702_100025479 3300005615 Bacteria 3170
47 Ga0068852_100007446 3300005616 Bacteria 7989
48 Ga0068859_100637226 3300005617 Bacteria 1158
49 Ga0068864_100058082 3300005618 Bacteria 3343
50 Ga0068866_10048219 3300005718 Bacteria 2153
51 Ga0068861_100007082 3300005719 Bacteria 7673
52 Ga0068870_10005808 3300005840 Bacteria 5412
53 Ga0068870_10162969 3300005840 Bacteria 1324
54 Ga0068860_100000631 3300005843 Bacteria 41527
55 Ga0075365_10021296 3300006038 Bacteria 4042
56 Ga0075365_10044649 3300006038 Bacteria 2905
57 Ga0075363_100013354 3300006048 Bacteria 3977
58 Ga0075364_10015943 3300006051 Bacteria 4666
59 Ga0075364_10069327 3300006051 Bacteria 2320
60 Ga0075364_10198778 3300006051 Bacteria 1359
61 Ga0075364_10232943 3300006051 Bacteria 1251
62 Ga0070715_10079076 3300006163 Bacteria 1488
63 Ga0075362_10007542 3300006177 Bacteria 4126
64 Ga0075362_10188538 3300006177 Bacteria 1001
65 Ga0075367_10012249 3300006178 Bacteria 4564
66 Ga0075370_10037242 3300006353 Bacteria 2734
67 Ga0075429_100536538 3300006880 Bacteria 1025
68 Ga0068865_100013598 3300006881 Bacteria 5149
69 Ga0097620_100637348 3300006931 Bacteria 1158
70 Ga0105240_11181072 3300009093 Bacteria 811
71 Ga0105245_10027428 3300009098 Bacteria 5017
72 Ga0105245_10268375 3300009098 Bacteria 1663
73 Ga0105245_11113762 3300009098 Bacteria 836
74 Ga0105243_10001281 3300009148 Bacteria 22570
75 Ga0105243_10057583 3300009148 Bacteria 3095
76 Ga0105242_10865298 3300009176 Bacteria 901
77 Ga0105248_10022228 3300009177 Bacteria 7033
78 Ga0105238_10214786 3300009551 Bacteria 1900
79 Ga0105238_10969568 3300009551 Bacteria 870
80 Ga0105249_10339967 3300009553 Bacteria 1517
81 Ga0157371_10476808 3300013102 Bacteria 919
82 Ga0157369_10090764 3300013105 Bacteria 3262
83 Ga0157369_10216304 3300013105 Bacteria 2007
84 Ga0157369_10545678 3300013105 Bacteria 1198
85 Ga0163162_10074647 3300013306 Bacteria 3450
86 Ga0163162_11153478 3300013306 Bacteria 879
87 Ga0157372_10024021 3300013307 Bacteria 6614
88 Ga0157372_10547807 3300013307 Bacteria 1348
89 Ga0157375_10010888 3300013308 Bacteria 8018
90 Ga0157375_10582150 3300013308 Bacteria 1279
91 Ga0157375_10887210 3300013308 Bacteria 1036
92 Ga0157375_11005736 3300013308 Bacteria 973
93 Ga0163163_10429225 3300014325 Bacteria 1381
94 Ga0163163_10448715 3300014325 Bacteria 1350
95 Ga0163163_11191316 3300014325 Bacteria 824
96 Ga0182008_10078484 3300014497 Bacteria 1624
97 Ga0163161_10542003 3300017792 Bacteria 952
98 Ga0207697_10029591 3300025315 Bacteria 2241
99 Ga0207688_10017285 3300025901 Bacteria 3919
100 Ga0207647_10008929 3300025904 Bacteria 7149
101 Ga0207647_10032550 3300025904 Bacteria 3347
102 Ga0207685_10030649 3300025905 Bacteria 1917
103 Ga0207643_10006969 3300025908 Bacteria 6063
104 Ga0207643_10290747 3300025908 Bacteria 1015
105 Ga0207705_10103541 3300025909 Bacteria 2096
106 Ga0207707_10329694 3300025912 Bacteria 1317
107 Ga0207695_10668879 3300025913 Bacteria 919
108 Ga0207660_10023482 3300025917 Bacteria 4166
109 Ga0207660_10626495 3300025917 Bacteria 877
110 Ga0207662_10032854 3300025918 Bacteria 3021
111 Ga0207657_10071553 3300025919 Bacteria 2936
112 Ga0207652_10023413 3300025921 Bacteria 5116
113 Ga0207652_10174946 3300025921 Bacteria 1927
114 Ga0207652_10435544 3300025921 Bacteria 1182
115 Ga0207681_10078043 3300025923 Bacteria 2330
116 Ga0207687_10225288 3300025927 Bacteria 1478
117 Ga0207687_10265415 3300025927 Bacteria 1370
118 Ga0207700_10409450 3300025928 Bacteria 1189
119 Ga0207664_10075126 3300025929 Bacteria 2731
120 Ga0207690_10038000 3300025932 Bacteria 3130
121 Ga0207690_10072542 3300025932 Bacteria 2378
122 Ga0207690_10259634 3300025932 Bacteria 1345
123 Ga0207686_10051331 3300025934 Bacteria 2569
124 Ga0207709_10021835 3300025935 Bacteria 3626
125 Ga0207709_10096343 3300025935 Bacteria 1946
126 Ga0207669_10013837 3300025937 Bacteria 4025
127 Ga0207691_10029718 3300025940 Bacteria 5111
128 Ga0207711_10109420 3300025941 Bacteria 2456
129 Ga0207689_10105554 3300025942 Bacteria 2314
130 Ga0207661_10112663 3300025944 Bacteria 2303
131 Ga0207661_10136960 3300025944 Bacteria 2104
132 Ga0207661_10602534 3300025944 Bacteria 1008
133 Ga0207667_10183885 3300025949 Bacteria 2146
134 Ga0207712_10098653 3300025961 Bacteria 2167
135 Ga0207640_10100652 3300025981 Bacteria 2025
136 Ga0207658_10253835 3300025986 Bacteria 1495
137 Ga0207677_10037116 3300026023 Bacteria 3182
138 Ga0207677_10185351 3300026023 Bacteria 1641
139 Ga0207677_10634170 3300026023 Bacteria 941
140 Ga0207678_10168577 3300026067 Bacteria 1870
141 Ga0207678_10191066 3300026067 Bacteria 1750
142 Ga0207678_10396276 3300026067 Bacteria 1195
143 Ga0207708_10000445 3300026075 Bacteria 32158
144 Ga0207648_10007814 3300026089 Bacteria 10445
145 Ga0207648_10587538 3300026089 Bacteria 1026
146 Ga0207676_10043693 3300026095 Bacteria 3452
147 Ga0207675_100009111 3300026118 Bacteria 9314
148 Ga0207683_10130263 3300026121 Bacteria 2262
149 Ga0207683_10150046 3300026121 Bacteria 2104
150 Ga0207683_10750787 3300026121 Bacteria 905
151 Ga0207698_10084161 3300026142 Bacteria 2577
152 Ga0209813_10044207 3300027866 Bacteria 1368
153 Ga0268266_10546970 3300028379 Bacteria 1109
154 Ga0268264_10000269 3300028381 Bacteria 91321
155 Ga0307405_10865742 3300031731 Bacteria 762
156 Ga0307406_10125771 3300031901 Bacteria 1791
157 Ga0307406_10171417 3300031901 Bacteria 1571
158 Ga0307406_10344671 3300031901 Bacteria 1162
159 Ga0307406_10400650 3300031901 Bacteria 1088
160 Ga0307407_10217508 3300031903 Bacteria 1290
161 Ga0307407_10366203 3300031903 Bacteria 1025
162 Ga0307409_100050861 3300031995 Bacteria 3168
163 Ga0307409_100145910 3300031995 Bacteria 2047
164 Ga0307409_100224881 3300031995 Bacteria 1697
165 Ga0307409_100472403 3300031995 Bacteria 1215
166 Ga0307416_100214388 3300032002 Bacteria 1840
167 Ga0307411_10115225 3300032005 Bacteria 1933
168 Ga0307415_100212529 3300032126 Bacteria 1544
169 Ga0307415_100709804 3300032126 Bacteria 908
170 Ga0373951_0000155 3300035091 Bacteria 24895
171 Ga0395898_0186608 3300037466 Bacteria 1982
172 Ga0395901_0019050 3300038443 Bacteria 7017
173 Ga0395901_0163899 3300038443 Bacteria 2334
174 Ga0451843_1258628 3300041509 Bacteria 1248
175 Ga0451853_1912995 3300041512 Bacteria 847
176 Ga0439431_0046791 3300041997 Bacteria 1114
177 Ga0439449_0011596 3300042007 Bacteria 3315
178 Ga0466967_0059100 3300045976 Bacteria 3392
179 Ga0496100_0411665 3300048903 Bacteria 1031
180 Ga0496100_0675896 3300048903 Bacteria 805
181 Ga0496101_0037983 3300048904 Bacteria 3418
182 Ga0496102_0043007 3300048905 Bacteria 4095
183 Ga0496105_0266140 3300048908 Bacteria 1385
184 Ga0496105_0298807 3300048908 Bacteria 1295
185 Ga0496106_0029605 3300048909 Bacteria 4082
186 Ga0496107_0003988 3300048910 Bacteria 9941
187 Ga0496107_0273235 3300048910 Bacteria 1258
188 Ga0496107_0488796 3300048910 Bacteria 913
189 Ga0496108_0018076 3300048911 Bacteria 5767
190 Ga0496108_0108712 3300048911 Bacteria 2369
191 Ga0496109_0029059 3300048912 Bacteria 4948
192 Ga0496109_0048127 3300048912 Bacteria 3879
193 Ga0496109_0547247 3300048912 Bacteria 1092
194 Ga0496110_0002246 3300048913 Bacteria 14450
195 Ga0496111_0002914 3300048914 Bacteria 10456
196 Ga0496112_0164541 3300048915 Bacteria 2184
197 Ga0496113_0060879 3300048916 Bacteria 2847
198 Ga0496114_0005014 3300048917 Bacteria 10329
199 Ga0496114_0009066 3300048917 Bacteria 7890
200 Ga0496114_0033139 3300048917 Bacteria 4255
201 Ga0496114_0088107 3300048917 Bacteria 2633
202 Ga0496114_0143573 3300048917 Bacteria 2068
203 Ga0496114_0173394 3300048917 Bacteria 1881
204 Ga0496114_0177787 3300048917 Bacteria 1857
205 Ga0496114_0370079 3300048917 Bacteria 1268
206 Ga0496115_0179948 3300048918 Bacteria 1748
207 Ga0496115_0404829 3300048918 Bacteria 1107
208 Ga0501034_0065080 3300049571 Bacteria 3658
209 Ga0501034_0887676 3300049571 Bacteria 780
210 Ga0501036_0027876 3300049572 Bacteria 4775
211 Ga0501038_0284371 3300049574 Bacteria 1301
212 Ga0501039_0134239 3300049575 Bacteria 1943
213 Ga0501039_0139601 3300049575 Bacteria 1904
214 Ga0501039_0444635 3300049575 Bacteria 1018
215 Ga0501040_0332062 3300049576 Bacteria 1088
216 Ga0501041_0315766 3300049577 Bacteria 985
217 Ga0501042_0013389 3300049578 Bacteria 5580
218 Ga0501046_0041370 3300049580 Bacteria 3678
219 Ga0501048_0285223 3300049582 Bacteria 1174
220 Ga0501067_0009080 3300049583 Bacteria 5505
221 Ga0501068_0034191 3300049584 Bacteria 3031
222 Ga0501070_0015069 3300049586 Bacteria 6506
223 Ga0501071_0064494 3300049587 Bacteria 2658
224 Ga0501071_0074125 3300049587 Bacteria 2484
225 Ga0501072_0057996 3300049588 Bacteria 3052
226 Ga0501073_0058233 3300049589 Bacteria 2700
227 Ga0501074_0042144 3300049590 Bacteria 3303
228 Ga0501074_0118107 3300049590 Bacteria 1897
229 Ga0501076_0110094 3300049592 Bacteria 2226
230 Ga0501077_0036249 3300049593 Bacteria 3142
231 Ga0501077_0199474 3300049593 Bacteria 1271
232 Ga0501079_0258363 3300049741 Bacteria 1361
233 Ga0501079_0375579 3300049741 Bacteria 1114
234 Ga0501080_0019029 3300049742 Bacteria 6359
235 Ga0501081_0488159 3300049743 Bacteria 917
236 Ga0501081_0578953 3300049743 Bacteria 840
237 Ga0501083_0021971 3300049744 Bacteria 4430
238 Ga0501083_0307679 3300049744 Bacteria 1031
239 Ga0501044_0113340 3300049823 Bacteria 2719
240 Ga0501045_0220961 3300049824 Bacteria 1411
241 nmdc:mga03683_102472_c1 3300050489 Bacteria 1259
242 nmdc:mga03683_57937_c1 3300050489 Bacteria 1632
243 nmdc:mga00v17_181760_c1 3300050491 Bacteria 1357
244 nmdc:mga00v17_20097_c1 3300050491 Bacteria 3822
245 nmdc:mga00v17_5553_c1 3300050491 Bacteria 6647
246 nmdc:mga0yw44_112419_c1 3300050492 Bacteria 1747
247 nmdc:mga0yw44_21490_c1 3300050492 Bacteria 3601
248 nmdc:mga0yw44_3513_c1 3300050492 Bacteria 6978
249 nmdc:mga04h51_53083_c1 3300050495 Bacteria 1367
250 nmdc:mga07m45_14587_c1 3300050496 Bacteria 4190
251 nmdc:mga07m45_94990_c1 3300050496 Bacteria 1710
252 nmdc:mga09592_497544_c1 3300050508 Bacteria 1050
253 nmdc:mga08y16_258330_c1 3300050511 Bacteria 1799
254 Ga0501084_0053998 3300054114 Bacteria 3360
255 Ga0501084_0185002 3300054114 Bacteria 1758
256 Ga0501082_0139698 3300060353 Bacteria 2102
257 Ga0501082_0189556 3300060353 Bacteria 1789
258 2855390879 2855386786 Bacteria 4752232
259 2643826142 2643221561 Bacteria 4984412
260 2643850173 2643221567 Bacteria 4163945
261 2644036075 2643221604 Bacteria 5014917
262 2644136192 2643221624 Bacteria 4384879
263 2644532119 2643221696 Bacteria 5431823
264 2808914490 2808606375 Bacteria 9466072
265 JGI24738J21930_10002079
266 JGI24744J21845_10001889
267 Ga0070658_10074937
268 Ga0070683_100075209
269 Ga0070683_100118417
270 Ga0070683_100468164
271 Ga0070680_100033764
272 Ga0070680_100700276
273 Ga0070682_100010573
274 Ga0070682_100184842
275 Ga0070682_100198428
276 Ga0070682_100375549
277 Ga0068868_100007754
278 Ga0070660_100465249
279 Ga0070692_10009582
280 Ga0070669_100070712
281 Ga0070675_101027407
282 Ga0070674_100004097
283 Ga0070673_100099319
284 Ga0070659_100029684
285 Ga0070659_100121249
286 Ga0070659_100197982
287 Ga0070667_100073721
288 Ga0070714_100083860
289 Ga0070713_100304066
290 Ga0070701_10007841
291 Ga0070700_100003584
292 Ga0070700_100776419
293 Ga0070694_100441204
294 Ga0070663_100607914
295 Ga0070663_100715720
296 Ga0070678_100318300
297 Ga0070681_10131523
298 Ga0070681_10184048
299 Ga0068867_100007401
300 Ga0070679_100067210
301 Ga0070679_100345929
302 Ga0070684_100018438
303 Ga0070684_100127452
304 Ga0070684_100856101
305 Ga0070672_100119232
306 Ga0070695_100304457
307 Ga0070696_100009764
308 Ga0070693_100215279
309 Ga0068855_100238952
310 Ga0070702_100025479
311 Ga0068852_100007446
312 Ga0068859_100637226
313 Ga0068864_100058082
314 Ga0068866_10048219
315 Ga0068861_100007082
316 Ga0068870_10005808
317 Ga0068870_10162969
318 Ga0068860_100000631
319 Ga0075365_10021296
320 Ga0075365_10044649
321 Ga0075363_100013354
322 Ga0075364_10015943
323 Ga0075364_10069327
324 Ga0075364_10198778
325 Ga0075364_10232943
326 Ga0070715_10079076
327 Ga0075362_10007542
328 Ga0075362_10188538
329 Ga0075367_10012249
330 Ga0075370_10037242
331 Ga0075429_100536538
332 Ga0068865_100013598
333 Ga0097620_100637348
334 Ga0105240_11181072
335 Ga0105245_10027428
336 Ga0105245_10268375
337 Ga0105245_11113762
338 Ga0105243_10001281
339 Ga0105243_10057583
340 Ga0105242_10865298
341 Ga0105248_10022228
342 Ga0105238_10214786
343 Ga0105238_10969568
344 Ga0105249_10339967
345 Ga0157371_10476808
346 Ga0157369_10090764
347 Ga0157369_10216304
348 Ga0157369_10545678
349 Ga0163162_10074647
350 Ga0163162_11153478
351 Ga0157372_10024021
352 Ga0157372_10547807
353 Ga0157375_10010888
354 Ga0157375_10582150
355 Ga0157375_10887210
356 Ga0157375_11005736
357 Ga0163163_10429225
358 Ga0163163_10448715
359 Ga0163163_11191316
360 Ga0182008_10078484
361 Ga0163161_10542003
362 Ga0207697_10029591
363 Ga0207688_10017285
364 Ga0207647_10008929
365 Ga0207647_10032550
366 Ga0207685_10030649
367 Ga0207643_10006969
368 Ga0207643_10290747
369 Ga0207705_10103541
370 Ga0207707_10329694
371 Ga0207695_10668879
372 Ga0207660_10023482
373 Ga0207660_10626495
374 Ga0207662_10032854
375 Ga0207657_10071553
376 Ga0207652_10023413
377 Ga0207652_10174946
378 Ga0207652_10435544
379 Ga0207681_10078043
380 Ga0207687_10225288
381 Ga0207687_10265415
382 Ga0207700_10409450
383 Ga0207664_10075126
384 Ga0207690_10038000
385 Ga0207690_10072542
386 Ga0207690_10259634
387 Ga0207686_10051331
388 Ga0207709_10021835
389 Ga0207709_10096343
390 Ga0207669_10013837
391 Ga0207691_10029718
392 Ga0207711_10109420
393 Ga0207689_10105554
394 Ga0207661_10112663
395 Ga0207661_10136960
396 Ga0207661_10602534
397 Ga0207667_10183885
398 Ga0207712_10098653
399 Ga0207640_10100652
400 Ga0207658_10253835
401 Ga0207677_10037116
402 Ga0207677_10185351
403 Ga0207677_10634170
404 Ga0207678_10168577
405 Ga0207678_10191066
406 Ga0207678_10396276
407 Ga0207708_10000445
408 Ga0207648_10007814
409 Ga0207648_10587538
410 Ga0207676_10043693
411 Ga0207675_100009111
412 Ga0207683_10130263
413 Ga0207683_10150046
414 Ga0207683_10750787
415 Ga0207698_10084161
416 Ga0209813_10044207
417 Ga0268266_10546970
418 Ga0268264_10000269
419 Ga0307405_10865742
420 Ga0307406_10125771
421 Ga0307406_10171417
422 Ga0307406_10344671
423 Ga0307406_10400650
424 Ga0307407_10217508
425 Ga0307407_10366203
426 Ga0307409_100050861
427 Ga0307409_100145910
428 Ga0307409_100224881
429 Ga0307409_100472403
430 Ga0307416_100214388
431 Ga0307411_10115225
432 Ga0307415_100212529
433 Ga0307415_100709804
434 Ga0373951_0000155
435 Ga0395898_0186608
436 Ga0395901_0019050
437 Ga0395901_0163899
438 Ga0451843_1258628
439 Ga0451853_1912995
440 Ga0439431_0046791
441 Ga0439449_0011596
442 Ga0466967_0059100
443 Ga0496100_0411665
444 Ga0496100_0675896
445 Ga0496101_0037983
446 Ga0496102_0043007
447 Ga0496105_0266140
448 Ga0496105_0298807
449 Ga0496106_0029605
450 Ga0496107_0003988
451 Ga0496107_0273235
452 Ga0496107_0488796
453 Ga0496108_0018076
454 Ga0496108_0108712
455 Ga0496109_0029059
456 Ga0496109_0048127
457 Ga0496109_0547247
458 Ga0496110_0002246
459 Ga0496111_0002914
460 Ga0496112_0164541
461 Ga0496113_0060879
462 Ga0496114_0005014
463 Ga0496114_0009066
464 Ga0496114_0033139
465 Ga0496114_0088107
466 Ga0496114_0143573
467 Ga0496114_0173394
468 Ga0496114_0177787
469 Ga0496114_0370079
470 Ga0496115_0179948
471 Ga0496115_0404829
472 Ga0501034_0065080
473 Ga0501034_0887676
474 Ga0501036_0027876
475 Ga0501038_0284371
476 Ga0501039_0134239
477 Ga0501039_0139601
478 Ga0501039_0444635
479 Ga0501040_0332062
480 Ga0501041_0315766
481 Ga0501042_0013389
482 Ga0501046_0041370
483 Ga0501048_0285223
484 Ga0501067_0009080
485 Ga0501068_0034191
486 Ga0501070_0015069
487 Ga0501071_0064494
488 Ga0501071_0074125
489 Ga0501072_0057996
490 Ga0501073_0058233
491 Ga0501074_0042144
492 Ga0501074_0118107
493 Ga0501076_0110094
494 Ga0501077_0036249
495 Ga0501077_0199474
496 Ga0501079_0258363
497 Ga0501079_0375579
498 Ga0501080_0019029
499 Ga0501081_0488159
500 Ga0501081_0578953
501 Ga0501083_0021971
502 Ga0501083_0307679
503 Ga0501044_0113340
504 Ga0501045_0220961
505 nmdc:mga03683_102472_c1
506 nmdc:mga03683_57937_c1
507 nmdc:mga00v17_181760_c1
508 nmdc:mga00v17_20097_c1
509 nmdc:mga00v17_5553_c1
510 nmdc:mga0yw44_112419_c1
511 nmdc:mga0yw44_21490_c1
512 nmdc:mga0yw44_3513_c1
513 nmdc:mga04h51_53083_c1
514 nmdc:mga07m45_14587_c1
515 nmdc:mga07m45_94990_c1
516 nmdc:mga09592_497544_c1
517 nmdc:mga08y16_258330_c1
518 Ga0501084_0053998
519 Ga0501084_0185002
520 Ga0501082_0139698
521 Ga0501082_0189556
522 2855390879
523 2643826142
524 2643850173
525 2644036075
526 2644136192
527 2644532119
528 2808914490

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02613

Nitrate_red_del

Nitrate reductase delta subunit

46

174

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
2o9x-assembly1.cif.gz_A crystal structure of a putative redox enzyme maturation protein from archaeoglobus fulgidus 0.6885 16 192
2o9x-assembly1.cif.gz_A crystal structure of a putative redox enzyme maturation protein from archaeoglobus fulgidus 0.6449 16 192
1s9u-assembly1.cif.gz_A atomic structure of a putative anaerobic dehydrogenase component 0.5964 12 194
3efp-assembly1.cif.gz_A crystal structure of the escherichia coli twin arginine leader peptide binding protein dmsd in a monomeric form 0.5884 13 193
1s9u-assembly1.cif.gz_A atomic structure of a putative anaerobic dehydrogenase component 0.5349 12 194
ID Description Score Start End Superfamily
af_O06561_3_176_1.10.3480.10 Mainly Alpha;Orthogonal Bundle;TorD-like;TorD-like 0.9566 21 192 1.10.3480.10
af_P9WJQ1_274_409_1.10.3480.10 Mainly Alpha;Orthogonal Bundle;TorD-like;TorD-like 0.9441 38 170 1.10.3480.10
af_O06561_3_176_1.10.3480.10 Mainly Alpha;Orthogonal Bundle;TorD-like;TorD-like 0.9407 21 192 1.10.3480.10
af_P9WJQ1_274_409_1.10.3480.10 Mainly Alpha;Orthogonal Bundle;TorD-like;TorD-like 0.9175 38 170 1.10.3480.10
af_P0AF26_5_149_1.10.3480.10 Mainly Alpha;Orthogonal Bundle;TorD-like;TorD-like 0.9124 21 160 1.10.3480.10
ID Description Score Start End GO Terms
AF-A0A4R3CKM4-F1-model_v4 deleted 0.962 14 177
AF-A0A285KIS2-F1-model_v4 Nitrate reductase delta subunit 0.9616 16 203 GO:0016530
GO:0042128
GO:0051082
GO:0051131
AF-A0A6N7Z3I2-F1-model_v4 Nitrate reductase molybdenum cofactor assembly chaperone 0.9605 10 206 GO:0016530
GO:0042128
GO:0051082
GO:0051131
AF-A0A1V3XI96-F1-model_v4 Nitrate reductase molybdenum cofactor assembly chaperone 0.9544 19 149 GO:0016530
GO:0042128
GO:0051082
GO:0051131
AF-A0A132NLP7-F1-model_v4 Nitrate reductase 0.9532 10 159 GO:0016530
GO:0042128
GO:0051082
GO:0051131

Map