F372749

General Info

Members Datasets Scaffolds Average Seq Length
264 146 528 261

Family's Representative Sequence

Representative Sequence 3300037068|Ga0373925_0007318|Ga0373925_0007318_528_1382
Length 284
Sequence MLTEISFSVKMGAVTRTPPPEPAALWRRLAAEFLGSGFLAAIVIGSGIAAQHLSPGATGLELLENAAATAAGLFAIILMFGPVSGGHFNPVVSFVDAAFGGLRWRDAAAYLPAQVAGCMAGAVAANLMFAQAAVSISAKHRATPAHFLSEVIATLGLILVIFALARSGRSRSAPAAVGAYIGAAYFFTSSTSFANPAITIGRMFSDTFAGIAPSSVPAFIAAQIIGGALAVVVIRVLYPRFTPAQAADILFPHDTSRGGPDQARAAHDGASAYPSPPPGQSQPH

Samples

Sample ID Description Type Environment
1 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
4 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
5 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
6 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
7 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
8 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
9 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
10 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
11 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
12 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
15 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
16 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
17 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
18 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
19 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
20 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
21 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
22 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
23 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
24 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
25 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
26 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
27 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
28 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
29 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
30 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
32 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
33 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
34 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
35 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
36 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
37 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
38 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
39 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
40 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
41 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
42 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
65 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
66 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
67 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
68 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
69 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
70 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
71 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
72 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
73 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
74 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
75 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
76 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
77 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
78 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
79 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
80 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
81 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
82 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
83 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
84 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
85 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
86 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
87 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
88 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
89 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
90 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
91 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
92 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
93 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
94 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
95 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
96 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
97 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
98 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
99 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
100 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
101 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
102 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
103 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
104 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
105 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
106 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
107 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
108 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
109 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
110 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
111 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
112 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
113 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
114 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
115 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
116 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
117 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
118 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
119 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
120 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
121 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
122 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
123 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
124 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
125 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
126 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
127 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
128 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
129 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
130 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
131 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
132 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
133 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
134 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
135 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
136 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
137 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
138 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
139 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
140 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
141 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
142 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
143 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
144 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
145 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
146 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.62
Metatranscriptomes 0.38
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.38
Nodule 0
Rhizoplane 4.92
Rhizosphere 93.18
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373925_0007318 3300037068 Bacteria 8061
2 Ga0070683_100274914 3300005329 Bacteria 1602
3 Ga0070709_10001474 3300005434 Bacteria 12696
4 Ga0070714_100020579 3300005435 Bacteria 5391
5 Ga0070714_100025890 3300005435 Bacteria 4844
6 Ga0070714_100041602 3300005435 Bacteria 3879
7 Ga0070714_100076318 3300005435 Bacteria 2909
8 Ga0070714_100191204 3300005435 Bacteria 1868
9 Ga0070714_100227640 3300005435 Bacteria 1716
10 Ga0070713_100000795 3300005436 Bacteria 20153
11 Ga0070713_100825417 3300005436 Bacteria 889
12 Ga0070710_10000020 3300005437 Bacteria 85562
13 Ga0070710_10020925 3300005437 Bacteria 3401
14 Ga0070701_10244840 3300005438 Bacteria 1080
15 Ga0070711_100002969 3300005439 Bacteria 9790
16 Ga0070711_100188203 3300005439 Bacteria 1584
17 Ga0070708_100000853 3300005445 Bacteria 22963
18 Ga0068867_100517506 3300005459 Bacteria 1028
19 Ga0070706_100004742 3300005467 Bacteria 13036
20 Ga0070706_100026027 3300005467 Bacteria 5384
21 Ga0070706_100080814 3300005467 Bacteria 3010
22 Ga0070707_100003514 3300005468 Bacteria 14789
23 Ga0070707_100005664 3300005468 Bacteria 11665
24 Ga0070707_100164403 3300005468 Bacteria 2163
25 Ga0070707_100391545 3300005468 Bacteria 1349
26 Ga0070698_100000044 3300005471 Bacteria 88151
27 Ga0070698_100000211 3300005471 Bacteria 56589
28 Ga0070698_100003249 3300005471 Bacteria 17867
29 Ga0070698_100207216 3300005471 Bacteria 1896
30 Ga0070672_100565712 3300005543 Bacteria 988
31 Ga0070696_100563001 3300005546 Bacteria 915
32 Ga0068855_100005453 3300005563 Bacteria 15510
33 Ga0068856_100080998 3300005614 Bacteria 3220
34 Ga0068856_100173828 3300005614 Bacteria 2166
35 Ga0068856_100329091 3300005614 Bacteria 1545
36 Ga0070702_100136480 3300005615 Bacteria 1557
37 Ga0068861_100283187 3300005719 Bacteria 1428
38 Ga0068860_100277272 3300005843 Bacteria 1638
39 Ga0081538_10000267 3300005981 Bacteria 59638
40 Ga0070717_10013855 3300006028 Bacteria 6192
41 Ga0070717_10070364 3300006028 Bacteria 2916
42 Ga0070717_10081791 3300006028 Bacteria 2712
43 Ga0070717_10223484 3300006028 Bacteria 1656
44 Ga0070715_10029424 3300006163 Bacteria 2212
45 Ga0070715_10147358 3300006163 Bacteria 1150
46 Ga0070716_100000766 3300006173 Bacteria 13786
47 Ga0070716_100409325 3300006173 Bacteria 977
48 Ga0070712_100033675 3300006175 Bacteria 3468
49 Ga0070712_100152388 3300006175 Bacteria 1776
50 Ga0070712_100591444 3300006175 Bacteria 938
51 Ga0075433_10143637 3300006852 Bacteria 2121
52 Ga0075434_100064353 3300006871 Bacteria 3651
53 Ga0075434_100392164 3300006871 Bacteria 1409
54 Ga0075435_100020231 3300007076 Bacteria 5095
55 Ga0075435_100180001 3300007076 Bacteria 1786
56 Ga0075435_100293178 3300007076 Bacteria 1390
57 Ga0105245_10063068 3300009098 Bacteria 3346
58 Ga0114129_10162202 3300009147 Bacteria 3052
59 Ga0105241_10047161 3300009174 Bacteria 3275
60 Ga0105248_10042270 3300009177 Bacteria 5111
61 Ga0105237_10000657 3300009545 Bacteria 47992
62 Ga0105237_10012093 3300009545 Bacteria 9114
63 Ga0105237_10192989 3300009545 Bacteria 2036
64 Ga0105238_10241515 3300009551 Bacteria 1784
65 Ga0105249_10069561 3300009553 Bacteria 3249
66 Ga0105239_10098962 3300010375 Bacteria 3224
67 Ga0105239_10219354 3300010375 Bacteria 2133
68 Ga0157374_10004772 3300013296 Bacteria 11366
69 Ga0163163_10061564 3300014325 Bacteria 3718
70 Ga0163163_10162604 3300014325 Bacteria 2278
71 Ga0157376_10020711 3300014969 Bacteria 5096
72 Ga0224572_1014446 3300024225 Bacteria 1509
73 Ga0228598_1005540 3300024227 Bacteria 2634
74 Ga0207692_10000146 3300025898 Bacteria 22057
75 Ga0207692_10044782 3300025898 Bacteria 2210
76 Ga0207647_10048439 3300025904 Bacteria 2639
77 Ga0207685_10096939 3300025905 Bacteria 1253
78 Ga0207699_10000546 3300025906 Bacteria 18585
79 Ga0207643_10175657 3300025908 Bacteria 1294
80 Ga0207684_10000306 3300025910 Bacteria 69573
81 Ga0207684_10057067 3300025910 Bacteria 3313
82 Ga0207654_10138440 3300025911 Bacteria 1549
83 Ga0207671_10000926 3300025914 Bacteria 36838
84 Ga0207671_10020081 3300025914 Bacteria 5095
85 Ga0207693_10023765 3300025915 Bacteria 4864
86 Ga0207693_10063627 3300025915 Bacteria 2890
87 Ga0207663_10003541 3300025916 Bacteria 7658
88 Ga0207663_10286118 3300025916 Bacteria 1226
89 Ga0207646_10000899 3300025922 Bacteria 38326
90 Ga0207646_10023902 3300025922 Bacteria 5607
91 Ga0207646_10038303 3300025922 Bacteria 4320
92 Ga0207646_10094289 3300025922 Bacteria 2681
93 Ga0207646_10161905 3300025922 Bacteria 2019
94 Ga0207694_10513818 3300025924 Bacteria 1003
95 Ga0207700_10000310 3300025928 Bacteria 28632
96 Ga0207700_10389489 3300025928 Bacteria 1220
97 Ga0207700_10498191 3300025928 Bacteria 1078
98 Ga0207664_10000526 3300025929 Bacteria 27229
99 Ga0207664_10024575 3300025929 Bacteria 4529
100 Ga0207664_10057472 3300025929 Bacteria 3092
101 Ga0207664_10064701 3300025929 Bacteria 2926
102 Ga0207664_10106073 3300025929 Bacteria 2329
103 Ga0207664_10126004 3300025929 Bacteria 2150
104 Ga0207664_10155505 3300025929 Bacteria 1946
105 Ga0207664_10346513 3300025929 Bacteria 1314
106 Ga0207665_10000491 3300025939 Bacteria 26745
107 Ga0207711_10136808 3300025941 Bacteria 2201
108 Ga0207667_10089668 3300025949 Bacteria 3178
109 Ga0207712_10040333 3300025961 Bacteria 3203
110 Ga0207677_10421723 3300026023 Bacteria 1137
111 Ga0207678_10328058 3300026067 Bacteria 1317
112 Ga0207702_10038126 3300026078 Bacteria 4025
113 Ga0207702_10113281 3300026078 Bacteria 2415
114 Ga0268265_10001900 3300028380 Bacteria 16602
115 Ga0265319_1000062 3300028563 Bacteria 85615
116 Ga0265336_10023484 3300028666 Bacteria 1954
117 Ga0265338_10000457 3300028800 Bacteria 72848
118 Ga0265338_10002428 3300028800 Bacteria 27997
119 Ga0265330_10127259 3300031235 Bacteria 1084
120 Ga0307406_10078731 3300031901 Bacteria 2184
121 Ga0307510_10321756 3300033180 Bacteria 1003
122 Ga0373934_0001821 3300035086 Bacteria 7834
123 Ga0373923_0058630 3300035111 Bacteria 1631
124 Ga0373923_0067660 3300035111 Bacteria 1528
125 Ga0373923_0084344 3300035111 Bacteria 1382
126 Ga0373953_0002665 3300035117 Bacteria 5409
127 Ga0373954_0028936 3300035118 Bacteria 2549
128 Ga0373956_0002523 3300035119 Bacteria 7452
129 Ga0373956_0133958 3300035119 Bacteria 1161
130 Ga0373957_0000702 3300035120 Bacteria 8677
131 Ga0373943_0152929 3300035170 Bacteria 1251
132 Ga0373955_0000515 3300035172 Bacteria 16465
133 Ga0373955_0004213 3300035172 Bacteria 6345
134 Ga0373924_0000549 3300035410 Bacteria 11538
135 Ga0373927_0067085 3300035695 Bacteria 2322
136 Ga0373933_0000507 3300035724 Bacteria 24320
137 Ga0373933_0182568 3300035724 Bacteria 1338
138 Ga0373947_0055571 3300035725 Bacteria 2391
139 Ga0373947_0240537 3300035725 Bacteria 1194
140 Ga0373937_0001460 3300036401 Bacteria 19784
141 Ga0373937_0002467 3300036401 Bacteria 15381
142 Ga0373937_0290623 3300036401 Bacteria 1544
143 Ga0372808_003284 3300036459 Bacteria 1966
144 Ga0373925_0048164 3300037068 Bacteria 3175
145 Ga0373925_0080385 3300037068 Bacteria 2477
146 Ga0395900_0241776 3300037418 Bacteria 1811
147 Ga0395901_0473769 3300038443 Bacteria 1278
148 Ga0436363_0216103 3300039450 Bacteria 935
149 Ga0436363_0374661 3300039450 Bacteria 945
150 Ga0466972_0058649 3300044658 Bacteria 1848
151 Ga0466961_0318273 3300044693 Bacteria 949
152 Ga0466963_0081737 3300044694 Bacteria 2189
153 Ga0495592_0002671 3300046454 Bacteria 12603
154 Ga0495592_0005749 3300046454 Bacteria 9181
155 Ga0495592_0086589 3300046454 Bacteria 2256
156 Ga0495592_0297223 3300046454 Bacteria 1051
157 Ga0495629_0010154 3300046459 Bacteria 6863
158 Ga0495629_0016761 3300046459 Bacteria 5258
159 Ga0495641_0006500 3300046461 Bacteria 7557
160 Ga0495641_0011044 3300046461 Bacteria 5175
161 Ga0495641_0131998 3300046461 Bacteria 1115
162 Ga0495641_0137569 3300046461 Bacteria 1091
163 Ga0495651_0000798 3300046462 Bacteria 24389
164 Ga0495651_0089625 3300046462 Bacteria 2308
165 Ga0495653_0003377 3300046463 Bacteria 12834
166 Ga0495653_0031593 3300046463 Bacteria 4208
167 Ga0495653_0046093 3300046463 Bacteria 3376
168 Ga0495653_0096783 3300046463 Bacteria 2146
169 Ga0495580_0022156 3300046472 Bacteria 4680
170 Ga0495582_0038200 3300046473 Bacteria 2641
171 Ga0495639_0034581 3300046475 Bacteria 2261
172 Ga0495662_0027764 3300046476 Bacteria 2734
173 Ga0495608_0000630 3300046511 Bacteria 24324
174 Ga0495608_0001073 3300046511 Bacteria 19281
175 Ga0495618_0068900 3300046514 Bacteria 2249
176 Ga0495628_0002940 3300046516 Bacteria 15281
177 Ga0495628_0046874 3300046516 Bacteria 3431
178 Ga0495630_0009211 3300046517 Bacteria 7098
179 Ga0495666_0034384 3300046526 Bacteria 2474
180 Ga0495652_0003271 3300046529 Bacteria 16138
181 Ga0495652_0073796 3300046529 Bacteria 2839
182 Ga0495652_0096917 3300046529 Bacteria 2400
183 Ga0495652_0234549 3300046529 Bacteria 1370
184 Ga0495665_0005756 3300046531 Bacteria 6690
185 Ga0495640_0005108 3300046533 Bacteria 10424
186 Ga0495640_0022240 3300046533 Bacteria 4639
187 Ga0495586_0232229 3300046535 Bacteria 1050
188 Ga0495587_0000605 3300046536 Bacteria 24467
189 Ga0495587_0007993 3300046536 Bacteria 6830
190 Ga0495645_0012080 3300046543 Bacteria 6084
191 Ga0495645_0065198 3300046543 Bacteria 2635
192 Ga0495645_0201264 3300046543 Bacteria 1351
193 Ga0495667_0000537 3300046559 Bacteria 24240
194 Ga0495667_0009551 3300046559 Bacteria 6573
195 Ga0495667_0098523 3300046559 Bacteria 1893
196 Ga0495634_0006494 3300046642 Bacteria 8882
197 Ga0495634_0021270 3300046642 Bacteria 4588
198 Ga0495635_0020333 3300046663 Bacteria 4624
199 Ga0495635_0188063 3300046663 Bacteria 1402
200 Ga0495657_0001623 3300046675 Bacteria 19291
201 Ga0495657_0002730 3300046675 Bacteria 14748
202 Ga0495657_0057411 3300046675 Bacteria 2588
203 Ga0495599_0000408 3300046678 Bacteria 24589
204 Ga0495599_0004478 3300046678 Bacteria 8277
205 Ga0495599_0192921 3300046678 Bacteria 1253
206 Ga0495623_0003230 3300046679 Bacteria 10766
207 Ga0495623_0074178 3300046679 Bacteria 2114
208 Ga0495646_0014968 3300046680 Bacteria 4927
209 Ga0495646_0041007 3300046680 Bacteria 2847
210 Ga0495647_0241536 3300046681 Bacteria 802
211 Ga0495658_0176918 3300046683 Bacteria 1322
212 Ga0495613_0018687 3300046689 Bacteria 5169
213 Ga0495624_0028258 3300046690 Bacteria 3667
214 Ga0495624_0133581 3300046690 Bacteria 1521
215 Ga0495600_0002853 3300046809 Bacteria 10060
216 Ga0495600_0024384 3300046809 Bacteria 3893
217 Ga0495600_0130288 3300046809 Bacteria 1635
218 Ga0495581_0173359 3300047315 Bacteria 1261
219 Ga0495604_0017844 3300047317 Bacteria 5676
220 Ga0495674_0150092 3300047319 Bacteria 1954
221 Ga0495674_0219455 3300047319 Bacteria 1572
222 Ga0495674_0302130 3300047319 Bacteria 1307
223 Ga0495676_0017086 3300047321 Bacteria 6420
224 Ga0495676_0059428 3300047321 Bacteria 3002
225 Ga0495676_0089332 3300047321 Bacteria 2309
226 Ga0495676_0214797 3300047321 Bacteria 1329
227 Ga0495680_0001902 3300047322 Bacteria 21925
228 Ga0495680_0003448 3300047322 Bacteria 15586
229 Ga0495680_0039351 3300047322 Bacteria 3773
230 Ga0495680_0210202 3300047322 Bacteria 1393
231 Ga0495675_0000486 3300047444 Bacteria 25750
232 Ga0495675_0009049 3300047444 Bacteria 6190
233 Ga0495684_0091777 3300047471 Bacteria 2300
234 Ga0495684_0108575 3300047471 Bacteria 2095
235 Ga0495593_0018941 3300047673 Bacteria 3862
236 Ga0495602_0001263 3300048088 Bacteria 24919
237 Ga0495602_0003195 3300048088 Bacteria 16901
238 Ga0496104_0209773 3300048907 Bacteria 1859
239 Ga0496105_0016978 3300048908 Bacteria 5824
240 Ga0496105_0306125 3300048908 Bacteria 1276
241 Ga0496108_0049859 3300048911 Bacteria 3502
242 Ga0496108_0152623 3300048911 Bacteria 1994
243 Ga0496109_0096126 3300048912 Bacteria 2744
244 Ga0496109_0222922 3300048912 Bacteria 1773
245 Ga0496110_0210750 3300048913 Bacteria 1766
246 Ga0496112_0082330 3300048915 Bacteria 3183
247 Ga0496112_0305204 3300048915 Bacteria 1537
248 Ga0496112_0340288 3300048915 Bacteria 1444
249 Ga0496114_0210507 3300048917 Bacteria 1705
250 Ga0496115_0117393 3300048918 Bacteria 2189
251 Ga0501067_0267989 3300049583 Bacteria 951
252 nmdc:mga0n895_11309_c1 3300050512 Bacteria 7953
253 nmdc:mga0n895_205775_c1 3300050512 Bacteria 1999
254 nmdc:mga0n895_47396_c1 3300050512 Bacteria 4202
255 nmdc:mga0n895_84512_c1 3300050512 Bacteria 3167
256 nmdc:mga0rr50_308641_c1 3300050513 Bacteria 1325
257 nmdc:mga08x19_12249_c1 3300050514 Bacteria 5162
258 nmdc:mga0a205_32396_c1 3300050515 Bacteria 3840
259 nmdc:mga0a205_83851_c1 3300050515 Bacteria 3078
260 Ga0495595_0011163 3300053084 Bacteria 3751
261 Ga0495595_0122454 3300053084 Bacteria 1267
262 Ga0495619_0005647 3300053085 Bacteria 7930
263 Ga0495619_0162585 3300053085 Bacteria 1542
264 Ga0500577_0004554 3300053142 Bacteria 3675
265 Ga0373925_0007318
266 Ga0070683_100274914
267 Ga0070709_10001474
268 Ga0070714_100020579
269 Ga0070714_100025890
270 Ga0070714_100041602
271 Ga0070714_100076318
272 Ga0070714_100191204
273 Ga0070714_100227640
274 Ga0070713_100000795
275 Ga0070713_100825417
276 Ga0070710_10000020
277 Ga0070710_10020925
278 Ga0070701_10244840
279 Ga0070711_100002969
280 Ga0070711_100188203
281 Ga0070708_100000853
282 Ga0068867_100517506
283 Ga0070706_100004742
284 Ga0070706_100026027
285 Ga0070706_100080814
286 Ga0070707_100003514
287 Ga0070707_100005664
288 Ga0070707_100164403
289 Ga0070707_100391545
290 Ga0070698_100000044
291 Ga0070698_100000211
292 Ga0070698_100003249
293 Ga0070698_100207216
294 Ga0070672_100565712
295 Ga0070696_100563001
296 Ga0068855_100005453
297 Ga0068856_100080998
298 Ga0068856_100173828
299 Ga0068856_100329091
300 Ga0070702_100136480
301 Ga0068861_100283187
302 Ga0068860_100277272
303 Ga0081538_10000267
304 Ga0070717_10013855
305 Ga0070717_10070364
306 Ga0070717_10081791
307 Ga0070717_10223484
308 Ga0070715_10029424
309 Ga0070715_10147358
310 Ga0070716_100000766
311 Ga0070716_100409325
312 Ga0070712_100033675
313 Ga0070712_100152388
314 Ga0070712_100591444
315 Ga0075433_10143637
316 Ga0075434_100064353
317 Ga0075434_100392164
318 Ga0075435_100020231
319 Ga0075435_100180001
320 Ga0075435_100293178
321 Ga0105245_10063068
322 Ga0114129_10162202
323 Ga0105241_10047161
324 Ga0105248_10042270
325 Ga0105237_10000657
326 Ga0105237_10012093
327 Ga0105237_10192989
328 Ga0105238_10241515
329 Ga0105249_10069561
330 Ga0105239_10098962
331 Ga0105239_10219354
332 Ga0157374_10004772
333 Ga0163163_10061564
334 Ga0163163_10162604
335 Ga0157376_10020711
336 Ga0224572_1014446
337 Ga0228598_1005540
338 Ga0207692_10000146
339 Ga0207692_10044782
340 Ga0207647_10048439
341 Ga0207685_10096939
342 Ga0207699_10000546
343 Ga0207643_10175657
344 Ga0207684_10000306
345 Ga0207684_10057067
346 Ga0207654_10138440
347 Ga0207671_10000926
348 Ga0207671_10020081
349 Ga0207693_10023765
350 Ga0207693_10063627
351 Ga0207663_10003541
352 Ga0207663_10286118
353 Ga0207646_10000899
354 Ga0207646_10023902
355 Ga0207646_10038303
356 Ga0207646_10094289
357 Ga0207646_10161905
358 Ga0207694_10513818
359 Ga0207700_10000310
360 Ga0207700_10389489
361 Ga0207700_10498191
362 Ga0207664_10000526
363 Ga0207664_10024575
364 Ga0207664_10057472
365 Ga0207664_10064701
366 Ga0207664_10106073
367 Ga0207664_10126004
368 Ga0207664_10155505
369 Ga0207664_10346513
370 Ga0207665_10000491
371 Ga0207711_10136808
372 Ga0207667_10089668
373 Ga0207712_10040333
374 Ga0207677_10421723
375 Ga0207678_10328058
376 Ga0207702_10038126
377 Ga0207702_10113281
378 Ga0268265_10001900
379 Ga0265319_1000062
380 Ga0265336_10023484
381 Ga0265338_10000457
382 Ga0265338_10002428
383 Ga0265330_10127259
384 Ga0307406_10078731
385 Ga0307510_10321756
386 Ga0373934_0001821
387 Ga0373923_0058630
388 Ga0373923_0067660
389 Ga0373923_0084344
390 Ga0373953_0002665
391 Ga0373954_0028936
392 Ga0373956_0002523
393 Ga0373956_0133958
394 Ga0373957_0000702
395 Ga0373943_0152929
396 Ga0373955_0000515
397 Ga0373955_0004213
398 Ga0373924_0000549
399 Ga0373927_0067085
400 Ga0373933_0000507
401 Ga0373933_0182568
402 Ga0373947_0055571
403 Ga0373947_0240537
404 Ga0373937_0001460
405 Ga0373937_0002467
406 Ga0373937_0290623
407 Ga0372808_003284
408 Ga0373925_0048164
409 Ga0373925_0080385
410 Ga0395900_0241776
411 Ga0395901_0473769
412 Ga0436363_0216103
413 Ga0436363_0374661
414 Ga0466972_0058649
415 Ga0466961_0318273
416 Ga0466963_0081737
417 Ga0495592_0002671
418 Ga0495592_0005749
419 Ga0495592_0086589
420 Ga0495592_0297223
421 Ga0495629_0010154
422 Ga0495629_0016761
423 Ga0495641_0006500
424 Ga0495641_0011044
425 Ga0495641_0131998
426 Ga0495641_0137569
427 Ga0495651_0000798
428 Ga0495651_0089625
429 Ga0495653_0003377
430 Ga0495653_0031593
431 Ga0495653_0046093
432 Ga0495653_0096783
433 Ga0495580_0022156
434 Ga0495582_0038200
435 Ga0495639_0034581
436 Ga0495662_0027764
437 Ga0495608_0000630
438 Ga0495608_0001073
439 Ga0495618_0068900
440 Ga0495628_0002940
441 Ga0495628_0046874
442 Ga0495630_0009211
443 Ga0495666_0034384
444 Ga0495652_0003271
445 Ga0495652_0073796
446 Ga0495652_0096917
447 Ga0495652_0234549
448 Ga0495665_0005756
449 Ga0495640_0005108
450 Ga0495640_0022240
451 Ga0495586_0232229
452 Ga0495587_0000605
453 Ga0495587_0007993
454 Ga0495645_0012080
455 Ga0495645_0065198
456 Ga0495645_0201264
457 Ga0495667_0000537
458 Ga0495667_0009551
459 Ga0495667_0098523
460 Ga0495634_0006494
461 Ga0495634_0021270
462 Ga0495635_0020333
463 Ga0495635_0188063
464 Ga0495657_0001623
465 Ga0495657_0002730
466 Ga0495657_0057411
467 Ga0495599_0000408
468 Ga0495599_0004478
469 Ga0495599_0192921
470 Ga0495623_0003230
471 Ga0495623_0074178
472 Ga0495646_0014968
473 Ga0495646_0041007
474 Ga0495647_0241536
475 Ga0495658_0176918
476 Ga0495613_0018687
477 Ga0495624_0028258
478 Ga0495624_0133581
479 Ga0495600_0002853
480 Ga0495600_0024384
481 Ga0495600_0130288
482 Ga0495581_0173359
483 Ga0495604_0017844
484 Ga0495674_0150092
485 Ga0495674_0219455
486 Ga0495674_0302130
487 Ga0495676_0017086
488 Ga0495676_0059428
489 Ga0495676_0089332
490 Ga0495676_0214797
491 Ga0495680_0001902
492 Ga0495680_0003448
493 Ga0495680_0039351
494 Ga0495680_0210202
495 Ga0495675_0000486
496 Ga0495675_0009049
497 Ga0495684_0091777
498 Ga0495684_0108575
499 Ga0495593_0018941
500 Ga0495602_0001263
501 Ga0495602_0003195
502 Ga0496104_0209773
503 Ga0496105_0016978
504 Ga0496105_0306125
505 Ga0496108_0049859
506 Ga0496108_0152623
507 Ga0496109_0096126
508 Ga0496109_0222922
509 Ga0496110_0210750
510 Ga0496112_0082330
511 Ga0496112_0305204
512 Ga0496112_0340288
513 Ga0496114_0210507
514 Ga0496115_0117393
515 Ga0501067_0267989
516 nmdc:mga0n895_11309_c1
517 nmdc:mga0n895_205775_c1
518 nmdc:mga0n895_47396_c1
519 nmdc:mga0n895_84512_c1
520 nmdc:mga0rr50_308641_c1
521 nmdc:mga08x19_12249_c1
522 nmdc:mga0a205_32396_c1
523 nmdc:mga0a205_83851_c1
524 Ga0495595_0011163
525 Ga0495595_0122454
526 Ga0495619_0005647
527 Ga0495619_0162585
528 Ga0500577_0004554

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00230

MIP

Major intrinsic protein

21

194

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
2o9d-assembly2.cif.gz_B crystal structure of aqpz mutant t183c. 0.8279 3 217
1rc2-assembly1.cif.gz_B error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8247 8 216
3nka-assembly2.cif.gz_B crystal structure of aqpz h174g,t183f 0.823 3 216
5i32-assembly1.cif.gz_A ammonia permeable aquaporin attip2;1 0.82 7 213
6qim-assembly1.cif.gz_A-2 structure of atpip2;4 0.8161 4 219
ID Description Score Start End Superfamily
af_Q7Z138_18_164_1.20.1080.10 Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. 0.9289 4 109 1.20.1080.10
af_A0A1D6PLK2_10_163_1.20.1080.10 Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. 0.9104 5 108 1.20.1080.10
af_I1NH56_66_171_1.20.1080.10 Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. 0.8712 3 110 1.20.1080.10
af_Q84S07_26_278_1.20.1080.10 Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. 0.8583 1 217 1.20.1080.10
af_A0A0P0WDK9_2_139_1.20.1080.10 Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. 0.8495 7 107 1.20.1080.10
ID Description Score Start End GO Terms
AF-A0A6L5EWK3-F1-model_v4 Aquaporin family protein 0.9896 1 218 GO:0005886
GO:0015250
AF-A0A3C1E276-F1-model_v4 Aquaporin family protein 0.9876 7 218 GO:0005886
GO:0015250
AF-A0A5C8UJG4-F1-model_v4 Aquaporin family protein 0.9867 3 218 GO:0005886
GO:0015250
AF-A0A522P192-F1-model_v4 Aquaporin family protein 0.9867 3 218 GO:0005886
GO:0015250
AF-A0A7W9HII9-F1-model_v4 Glycerol uptake facilitator-like aquaporin 0.9859 1 218 GO:0015267
GO:0016020

Map