F372717

General Info

Members Datasets Scaffolds Average Seq Length
264 162 528 119

Family's Representative Sequence

Representative Sequence 3300031731|Ga0307405_10759222|Ga0307405_107592222
Length 142
Sequence MTGFRNFILRGNLVELAVAFIIAGAFAAVVTSFTGVILSAITRFSGGPPNFDSIEWFKEDGAAGTGVTVGPFLTALIAFLILAAVVYFFVVMPYTKAKERFFPTEPEGTPADVALLTEIRDLLAQGQSRHAGSGTTDGTGTV

Samples

Sample ID Description Type Environment
1 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
4 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
5 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
12 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
13 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
14 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
15 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
19 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
20 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
21 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
22 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
23 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
24 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
25 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
26 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
27 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
28 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
29 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
30 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
31 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
32 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
33 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
34 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
35 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
36 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
37 3300012487 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 Metagenome Rhizosphere
38 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
39 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
40 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
41 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
42 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
43 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
44 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
45 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
46 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
47 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
48 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
68 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
70 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
71 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
72 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
73 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
74 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
75 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
76 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
77 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
78 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
79 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
80 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
81 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
82 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
83 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
84 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
85 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
86 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
87 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
88 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
89 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
90 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
91 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
92 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
93 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
94 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
95 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
96 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
97 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
98 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
99 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
100 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
101 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
102 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
103 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
104 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
105 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
106 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
107 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
108 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
109 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
110 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
111 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
112 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
113 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
114 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
115 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
116 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
117 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
127 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
131 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
132 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
133 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
134 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
135 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
136 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
137 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
138 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
139 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
140 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
141 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
142 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
143 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
144 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
146 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
147 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
148 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
149 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
150 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
151 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
152 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
153 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
154 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
155 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
156 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
157 2643221615 Nocardioides sp. Root224 Isolate Unclassified
158 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
159 2808606365 Phycicoccus sp. SLBN-51 Isolate Unclassified
160 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
161 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
162 2857481737 Nocardioides sp. R-74106 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.73
Metatranscriptomes 0
Isolates 2.27

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.61
Nodule 0
Rhizoplane 8.71
Rhizosphere 78.03
Stem 0
Stem Tuber 0
Unclassified 0.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307405_10759222 3300031731 Bacteria 809
2 Ga0070683_100891352 3300005329 Bacteria 853
3 Ga0070677_10234406 3300005333 Bacteria 903
4 Ga0070689_101858090 3300005340 Bacteria 550
5 Ga0070687_101188599 3300005343 Bacteria 562
6 Ga0070661_100419830 3300005344 Bacteria 1060
7 Ga0070668_100467893 3300005347 Bacteria 1087
8 Ga0070674_100650684 3300005356 Bacteria 896
9 Ga0070673_102028404 3300005364 Bacteria 546
10 Ga0070659_100045577 3300005366 Bacteria 3435
11 Ga0070700_100157233 3300005441 Bacteria 1561
12 Ga0068867_100565292 3300005459 Bacteria 987
13 Ga0070685_10116905 3300005466 Bacteria 1651
14 Ga0068853_100948470 3300005539 Bacteria 827
15 Ga0070672_100403763 3300005543 Bacteria 1172
16 Ga0070672_100897660 3300005543 Bacteria 783
17 Ga0070665_100001294 3300005548 Bacteria 29946
18 Ga0068855_100356163 3300005563 Bacteria 1611
19 Ga0070664_102247368 3300005564 Bacteria 518
20 Ga0068854_101587420 3300005578 Bacteria 596
21 Ga0070702_100487792 3300005615 Bacteria 902
22 Ga0068852_100566237 3300005616 Bacteria 1138
23 Ga0068866_11249577 3300005718 Bacteria 538
24 Ga0068861_101343378 3300005719 Bacteria 696
25 Ga0068870_10346692 3300005840 Bacteria 952
26 Ga0075365_10003959 3300006038 Bacteria 7758
27 Ga0075365_10329553 3300006038 Bacteria 1075
28 Ga0075365_10979042 3300006038 Bacteria 596
29 Ga0075368_10007412 3300006042 Bacteria 3872
30 Ga0075368_10078113 3300006042 Bacteria 1344
31 Ga0075363_100022163 3300006048 Bacteria 3209
32 Ga0075363_100664102 3300006048 Bacteria 628
33 Ga0075364_10013685 3300006051 Bacteria 4997
34 Ga0075364_10059652 3300006051 Bacteria 2501
35 Ga0075362_10007718 3300006177 Bacteria 4087
36 Ga0075362_10286361 3300006177 Bacteria 816
37 Ga0075369_10579738 3300006186 Bacteria 536
38 Ga0075370_10000996 3300006353 Bacteria 11704
39 Ga0075370_10081995 3300006353 Bacteria 1854
40 Ga0105243_10645775 3300009148 Bacteria 1025
41 Ga0105243_10683803 3300009148 Bacteria 998
42 Ga0105243_10863335 3300009148 Bacteria 897
43 Ga0105243_11731542 3300009148 Bacteria 655
44 Ga0105237_11522621 3300009545 Bacteria 676
45 Ga0105238_10975292 3300009551 Bacteria 868
46 Ga0105238_11642766 3300009551 Bacteria 673
47 Ga0105249_11247763 3300009553 Bacteria 815
48 Ga0105246_10066201 3300011119 Bacteria 2529
49 Ga0105246_10570185 3300011119 Bacteria 973
50 Ga0157321_1000963 3300012487 Unclassified 1374
51 Ga0157371_10196421 3300013102 Bacteria 1445
52 Ga0157370_10503151 3300013104 Bacteria 1113
53 Ga0157369_10196516 3300013105 Bacteria 2118
54 Ga0163162_12323390 3300013306 Bacteria 616
55 Ga0157372_11053675 3300013307 Bacteria 941
56 Ga0157372_11205441 3300013307 Bacteria 875
57 Ga0157375_10094027 3300013308 Bacteria 3065
58 Ga0157375_11924805 3300013308 Bacteria 702
59 Ga0157375_12127016 3300013308 Bacteria 668
60 Ga0163163_10343646 3300014325 Bacteria 1548
61 Ga0163163_10644913 3300014325 Bacteria 1122
62 Ga0163163_11611364 3300014325 Bacteria 710
63 Ga0157380_10079501 3300014326 Bacteria 2678
64 Ga0157380_10230600 3300014326 Bacteria 1663
65 Ga0157380_11343001 3300014326 Bacteria 763
66 Ga0157376_11395156 3300014969 Bacteria 732
67 Ga0163161_10088973 3300017792 Bacteria 2283
68 Ga0163161_10479426 3300017792 Bacteria 1010
69 Ga0163161_11804628 3300017792 Bacteria 544
70 Ga0207688_10386009 3300025901 Unclassified 867
71 Ga0207647_10368584 3300025904 Bacteria 812
72 Ga0207643_10044215 3300025908 Bacteria 2514
73 Ga0207693_10467198 3300025915 Bacteria 985
74 Ga0207657_10018970 3300025919 Bacteria 6546
75 Ga0207690_10041061 3300025932 Bacteria 3029
76 Ga0207709_10502782 3300025935 Bacteria 946
77 Ga0207709_11225072 3300025935 Bacteria 619
78 Ga0207691_10584473 3300025940 Bacteria 946
79 Ga0207661_10285620 3300025944 Bacteria 1476
80 Ga0207667_10248157 3300025949 Bacteria 1821
81 Ga0207651_10441686 3300025960 Bacteria 1115
82 Ga0207712_10700049 3300025961 Bacteria 884
83 Ga0207668_10236826 3300025972 Bacteria 1475
84 Ga0207639_10873283 3300026041 Bacteria 840
85 Ga0207678_10909501 3300026067 Bacteria 778
86 Ga0207678_11405965 3300026067 Bacteria 617
87 Ga0207708_10049827 3300026075 Bacteria 3189
88 Ga0207708_10248689 3300026075 Bacteria 1432
89 Ga0207675_100741433 3300026118 Bacteria 993
90 Ga0207683_10070000 3300026121 Bacteria 3099
91 Ga0207683_11453606 3300026121 Bacteria 633
92 Ga0207698_10910212 3300026142 Bacteria 887
93 Ga0207698_11897273 3300026142 Bacteria 611
94 Ga0209813_10010252 3300027866 Bacteria 2418
95 Ga0268266_10001059 3300028379 Bacteria 34495
96 Ga0307408_100343756 3300031548 Bacteria 1264
97 Ga0307408_101166601 3300031548 Bacteria 717
98 Ga0316575_10016394 3300031665 Bacteria 2804
99 Ga0316575_10045219 3300031665 Bacteria 1748
100 Ga0316579_10057630 3300031691 Bacteria 1825
101 Ga0316576_10007843 3300031727 Bacteria 6748
102 Ga0316576_10073661 3300031727 Bacteria 2523
103 Ga0316578_10001825 3300031728 Bacteria 8960
104 Ga0316578_10003407 3300031728 Bacteria 7263
105 Ga0307405_11011330 3300031731 Bacteria 710
106 Ga0307413_10143654 3300031824 Bacteria 1653
107 Ga0307410_10140226 3300031852 Bacteria 1787
108 Ga0307410_10392965 3300031852 Bacteria 1119
109 Ga0307406_10197905 3300031901 Bacteria 1477
110 Ga0307406_11289371 3300031901 Bacteria 637
111 Ga0307407_10092243 3300031903 Bacteria 1860
112 Ga0307407_10187352 3300031903 Bacteria 1376
113 Ga0307407_10245241 3300031903 Bacteria 1224
114 Ga0307407_10280830 3300031903 Bacteria 1153
115 Ga0307412_10084742 3300031911 Bacteria 2201
116 Ga0307409_100006713 3300031995 Bacteria 6805
117 Ga0307409_100083971 3300031995 Bacteria 2584
118 Ga0307409_100526072 3300031995 Bacteria 1156
119 Ga0307416_100050206 3300032002 Bacteria 3324
120 Ga0307416_103761936 3300032002 Bacteria 508
121 Ga0307411_10705954 3300032005 Bacteria 879
122 Ga0307415_100140579 3300032126 Bacteria 1843
123 Ga0316583_10074859 3300032133 Bacteria 1184
124 Ga0316580_10041710 3300032139 Bacteria 1417
125 Ga0316580_10131068 3300032139 Bacteria 768
126 Ga0316574_0001666 3300035398 Bacteria 10703
127 Ga0316574_0082762 3300035398 Bacteria 2040
128 Ga0316574_0272882 3300035398 Bacteria 1078
129 Ga0316582_0005011 3300036647 Bacteria 6770
130 Ga0316582_0090391 3300036647 Bacteria 2014
131 Ga0316584_0003766 3300036712 Bacteria 9935
132 Ga0316584_0625132 3300036712 Bacteria 744
133 Ga0395901_0296225 3300038443 Bacteria 1678
134 Ga0451789_0647377 3300041443 Bacteria 749
135 Ga0451791_1133739 3300041451 Bacteria 626
136 Ga0451793_0718709 3300041452 Bacteria 1337
137 Ga0451795_0914184 3300041456 Bacteria 696
138 Ga0451853_0528936 3300041512 Bacteria 1167
139 Ga0466972_0235851 3300044658 Bacteria 856
140 Ga0466965_0631385 3300044683 Bacteria 610
141 Ga0466966_0588343 3300044684 Bacteria 670
142 Ga0466961_0111588 3300044693 Bacteria 1720
143 Ga0466963_0243366 3300044694 Bacteria 1262
144 Ga0466970_0223153 3300044765 Bacteria 1052
145 Ga0466970_0267943 3300044765 Bacteria 959
146 Ga0466957_0129161 3300044842 Bacteria 1617
147 Ga0466960_0042534 3300044901 Bacteria 2157
148 Ga0466960_0051671 3300044901 Bacteria 1986
149 Ga0466958_0619517 3300045836 Bacteria 704
150 Ga0466967_0067508 3300045976 Bacteria 3190
151 Ga0466967_1032375 3300045976 Bacteria 819
152 Ga0495656_0635087 3300046615 Bacteria 573
153 Ga0496100_0633513 3300048903 Bacteria 832
154 Ga0496100_0711005 3300048903 Bacteria 784
155 Ga0496101_0287428 3300048904 Bacteria 1286
156 Ga0496104_0193103 3300048907 Bacteria 1948
157 Ga0496104_1287448 3300048907 Bacteria 634
158 Ga0496104_1807499 3300048907 Bacteria 513
159 Ga0496105_0726281 3300048908 Bacteria 760
160 Ga0496107_1243805 3300048910 Bacteria 534
161 Ga0496108_0220526 3300048911 Bacteria 1648
162 Ga0496108_0643346 3300048911 Bacteria 922
163 Ga0496109_1250376 3300048912 Bacteria 679
164 Ga0496110_1116391 3300048913 Bacteria 697
165 Ga0496111_0782977 3300048914 Bacteria 691
166 Ga0496113_0275261 3300048916 Bacteria 1346
167 Ga0496114_0012477 3300048917 Bacteria 6804
168 Ga0496114_0351019 3300048917 Bacteria 1305
169 Ga0496114_0387922 3300048917 Bacteria 1237
170 Ga0496114_0594331 3300048917 Bacteria 976
171 Ga0496115_0197054 3300048918 Bacteria 1664
172 Ga0501031_0021429 3300049568 Bacteria 4212
173 Ga0501031_0025498 3300049568 Bacteria 3855
174 Ga0501032_0022560 3300049569 Bacteria 4363
175 Ga0501033_0182460 3300049570 Bacteria 1504
176 Ga0501033_0325995 3300049570 Bacteria 1078
177 Ga0501033_0512464 3300049570 Bacteria 829
178 Ga0501034_0943960 3300049571 Bacteria 749
179 Ga0501036_0003900 3300049572 Bacteria 11967
180 Ga0501036_0014583 3300049572 Bacteria 6545
181 Ga0501037_0164516 3300049573 Bacteria 1580
182 Ga0501039_0001912 3300049575 Bacteria 15428
183 Ga0501039_0058833 3300049575 Bacteria 2977
184 Ga0501039_0114257 3300049575 Bacteria 2112
185 Ga0501040_0005126 3300049576 Bacteria 8472
186 Ga0501040_0027228 3300049576 Bacteria 3847
187 Ga0501040_0030121 3300049576 Bacteria 3664
188 Ga0501040_1030802 3300049576 Bacteria 597
189 Ga0501041_0002142 3300049577 Bacteria 11135
190 Ga0501041_0005512 3300049577 Bacteria 7401
191 Ga0501042_0001074 3300049578 Bacteria 15657
192 Ga0501042_0092030 3300049578 Bacteria 2177
193 Ga0501043_0355207 3300049579 Bacteria 1113
194 Ga0501043_1041391 3300049579 Bacteria 581
195 Ga0501046_0047953 3300049580 Bacteria 3385
196 Ga0501046_1222395 3300049580 Bacteria 516
197 Ga0501048_0025982 3300049582 Bacteria 4265
198 Ga0501048_0577806 3300049582 Bacteria 806
199 Ga0501048_0706467 3300049582 Bacteria 724
200 Ga0501068_0231425 3300049584 Bacteria 1175
201 Ga0501068_0415979 3300049584 Bacteria 868
202 Ga0501069_0066572 3300049585 Bacteria 2014
203 Ga0501069_0080751 3300049585 Bacteria 1832
204 Ga0501069_0255757 3300049585 Bacteria 1022
205 Ga0501070_0056642 3300049586 Bacteria 3249
206 Ga0501070_0057866 3300049586 Bacteria 3214
207 Ga0501070_0075605 3300049586 Bacteria 2788
208 Ga0501071_0021776 3300049587 Bacteria 4467
209 Ga0501071_0806527 3300049587 Bacteria 724
210 Ga0501072_0026109 3300049588 Bacteria 4551
211 Ga0501072_0027441 3300049588 Bacteria 4441
212 Ga0501072_0033182 3300049588 Bacteria 4045
213 Ga0501073_0239858 3300049589 Bacteria 1252
214 Ga0501073_0271492 3300049589 Bacteria 1170
215 Ga0501074_0036378 3300049590 Bacteria 3566
216 Ga0501074_0122112 3300049590 Bacteria 1863
217 Ga0501075_0038963 3300049591 Bacteria 3555
218 Ga0501075_0049321 3300049591 Bacteria 3164
219 Ga0501075_0136870 3300049591 Bacteria 1866
220 Ga0501076_0005637 3300049592 Bacteria 9023
221 Ga0501076_0030208 3300049592 Bacteria 4220
222 Ga0501077_0285189 3300049593 Bacteria 1051
223 Ga0501077_0476838 3300049593 Bacteria 799
224 Ga0501243_109606 3300049675 Bacteria 564
225 Ga0501079_0020672 3300049741 Bacteria 5032
226 Ga0501079_0297631 3300049741 Bacteria 1262
227 Ga0501080_0240708 3300049742 Bacteria 1651
228 Ga0501080_0390873 3300049742 Bacteria 1252
229 Ga0501080_0427107 3300049742 Bacteria 1190
230 Ga0501080_1717495 3300049742 Bacteria 529
231 Ga0501081_0227062 3300049743 Bacteria 1359
232 Ga0501081_0453514 3300049743 Bacteria 953
233 Ga0501035_0009921 3300049822 Bacteria 8843
234 Ga0501035_0254522 3300049822 Bacteria 1490
235 Ga0501035_0304872 3300049822 Bacteria 1341
236 Ga0501045_0001508 3300049824 Bacteria 15505
237 Ga0501045_0061420 3300049824 Bacteria 2756
238 Ga0501045_0279677 3300049824 Bacteria 1242
239 nmdc:mga03683_403754_c1 3300050489 Bacteria 653
240 nmdc:mga03683_55855_c1 3300050489 Bacteria 1659
241 nmdc:mga03n38_40656_c1 3300050490 Bacteria 2022
242 nmdc:mga00v17_498276_c1 3300050491 Bacteria 790
243 nmdc:mga00v17_92735_c1 3300050491 Bacteria 1899
244 nmdc:mga0yw44_1213_c1 3300050492 Bacteria 10098
245 nmdc:mga0yw44_1232131_c1 3300050492 Bacteria 505
246 nmdc:mga0yw44_751245_c1 3300050492 Bacteria 662
247 nmdc:mga06z11_27313_c1 3300050494 Bacteria 2728
248 nmdc:mga04h51_6465_c1 3300050495 Bacteria 3041
249 nmdc:mga07m45_81088_c1 3300050496 Bacteria 1853
250 nmdc:mga07m45_96155_c1 3300050496 Bacteria 1700
251 Ga0500573_0266672 3300053140 Bacteria 874
252 Ga0501084_0013904 3300054114 Bacteria 6663
253 Ga0501084_0547924 3300054114 Bacteria 977
254 Ga0501082_0254050 3300060353 Bacteria 1529
255 Ga0501082_0784513 3300060353 Bacteria 834
256 Ga0530510_0021644 3300061734 Bacteria 4575
257 Ga0530510_0666540 3300061734 Bacteria 792
258 Ga0530510_0881841 3300061734 Bacteria 683
259 2644094079 2643221615 Bacteria 5487866
260 2644323922 2643221657 Bacteria 5490246
261 2808875667 2808606365 Bacteria 4301966
262 2812334657 2811994874 Bacteria 5367947
263 2855388313 2855386786 Bacteria 4752232
264 2857486242 2857481737 Bacteria 4761446
265 Ga0307405_10759222
266 Ga0070683_100891352
267 Ga0070677_10234406
268 Ga0070689_101858090
269 Ga0070687_101188599
270 Ga0070661_100419830
271 Ga0070668_100467893
272 Ga0070674_100650684
273 Ga0070673_102028404
274 Ga0070659_100045577
275 Ga0070700_100157233
276 Ga0068867_100565292
277 Ga0070685_10116905
278 Ga0068853_100948470
279 Ga0070672_100403763
280 Ga0070672_100897660
281 Ga0070665_100001294
282 Ga0068855_100356163
283 Ga0070664_102247368
284 Ga0068854_101587420
285 Ga0070702_100487792
286 Ga0068852_100566237
287 Ga0068866_11249577
288 Ga0068861_101343378
289 Ga0068870_10346692
290 Ga0075365_10003959
291 Ga0075365_10329553
292 Ga0075365_10979042
293 Ga0075368_10007412
294 Ga0075368_10078113
295 Ga0075363_100022163
296 Ga0075363_100664102
297 Ga0075364_10013685
298 Ga0075364_10059652
299 Ga0075362_10007718
300 Ga0075362_10286361
301 Ga0075369_10579738
302 Ga0075370_10000996
303 Ga0075370_10081995
304 Ga0105243_10645775
305 Ga0105243_10683803
306 Ga0105243_10863335
307 Ga0105243_11731542
308 Ga0105237_11522621
309 Ga0105238_10975292
310 Ga0105238_11642766
311 Ga0105249_11247763
312 Ga0105246_10066201
313 Ga0105246_10570185
314 Ga0157321_1000963
315 Ga0157371_10196421
316 Ga0157370_10503151
317 Ga0157369_10196516
318 Ga0163162_12323390
319 Ga0157372_11053675
320 Ga0157372_11205441
321 Ga0157375_10094027
322 Ga0157375_11924805
323 Ga0157375_12127016
324 Ga0163163_10343646
325 Ga0163163_10644913
326 Ga0163163_11611364
327 Ga0157380_10079501
328 Ga0157380_10230600
329 Ga0157380_11343001
330 Ga0157376_11395156
331 Ga0163161_10088973
332 Ga0163161_10479426
333 Ga0163161_11804628
334 Ga0207688_10386009
335 Ga0207647_10368584
336 Ga0207643_10044215
337 Ga0207693_10467198
338 Ga0207657_10018970
339 Ga0207690_10041061
340 Ga0207709_10502782
341 Ga0207709_11225072
342 Ga0207691_10584473
343 Ga0207661_10285620
344 Ga0207667_10248157
345 Ga0207651_10441686
346 Ga0207712_10700049
347 Ga0207668_10236826
348 Ga0207639_10873283
349 Ga0207678_10909501
350 Ga0207678_11405965
351 Ga0207708_10049827
352 Ga0207708_10248689
353 Ga0207675_100741433
354 Ga0207683_10070000
355 Ga0207683_11453606
356 Ga0207698_10910212
357 Ga0207698_11897273
358 Ga0209813_10010252
359 Ga0268266_10001059
360 Ga0307408_100343756
361 Ga0307408_101166601
362 Ga0316575_10016394
363 Ga0316575_10045219
364 Ga0316579_10057630
365 Ga0316576_10007843
366 Ga0316576_10073661
367 Ga0316578_10001825
368 Ga0316578_10003407
369 Ga0307405_11011330
370 Ga0307413_10143654
371 Ga0307410_10140226
372 Ga0307410_10392965
373 Ga0307406_10197905
374 Ga0307406_11289371
375 Ga0307407_10092243
376 Ga0307407_10187352
377 Ga0307407_10245241
378 Ga0307407_10280830
379 Ga0307412_10084742
380 Ga0307409_100006713
381 Ga0307409_100083971
382 Ga0307409_100526072
383 Ga0307416_100050206
384 Ga0307416_103761936
385 Ga0307411_10705954
386 Ga0307415_100140579
387 Ga0316583_10074859
388 Ga0316580_10041710
389 Ga0316580_10131068
390 Ga0316574_0001666
391 Ga0316574_0082762
392 Ga0316574_0272882
393 Ga0316582_0005011
394 Ga0316582_0090391
395 Ga0316584_0003766
396 Ga0316584_0625132
397 Ga0395901_0296225
398 Ga0451789_0647377
399 Ga0451791_1133739
400 Ga0451793_0718709
401 Ga0451795_0914184
402 Ga0451853_0528936
403 Ga0466972_0235851
404 Ga0466965_0631385
405 Ga0466966_0588343
406 Ga0466961_0111588
407 Ga0466963_0243366
408 Ga0466970_0223153
409 Ga0466970_0267943
410 Ga0466957_0129161
411 Ga0466960_0042534
412 Ga0466960_0051671
413 Ga0466958_0619517
414 Ga0466967_0067508
415 Ga0466967_1032375
416 Ga0495656_0635087
417 Ga0496100_0633513
418 Ga0496100_0711005
419 Ga0496101_0287428
420 Ga0496104_0193103
421 Ga0496104_1287448
422 Ga0496104_1807499
423 Ga0496105_0726281
424 Ga0496107_1243805
425 Ga0496108_0220526
426 Ga0496108_0643346
427 Ga0496109_1250376
428 Ga0496110_1116391
429 Ga0496111_0782977
430 Ga0496113_0275261
431 Ga0496114_0012477
432 Ga0496114_0351019
433 Ga0496114_0387922
434 Ga0496114_0594331
435 Ga0496115_0197054
436 Ga0501031_0021429
437 Ga0501031_0025498
438 Ga0501032_0022560
439 Ga0501033_0182460
440 Ga0501033_0325995
441 Ga0501033_0512464
442 Ga0501034_0943960
443 Ga0501036_0003900
444 Ga0501036_0014583
445 Ga0501037_0164516
446 Ga0501039_0001912
447 Ga0501039_0058833
448 Ga0501039_0114257
449 Ga0501040_0005126
450 Ga0501040_0027228
451 Ga0501040_0030121
452 Ga0501040_1030802
453 Ga0501041_0002142
454 Ga0501041_0005512
455 Ga0501042_0001074
456 Ga0501042_0092030
457 Ga0501043_0355207
458 Ga0501043_1041391
459 Ga0501046_0047953
460 Ga0501046_1222395
461 Ga0501048_0025982
462 Ga0501048_0577806
463 Ga0501048_0706467
464 Ga0501068_0231425
465 Ga0501068_0415979
466 Ga0501069_0066572
467 Ga0501069_0080751
468 Ga0501069_0255757
469 Ga0501070_0056642
470 Ga0501070_0057866
471 Ga0501070_0075605
472 Ga0501071_0021776
473 Ga0501071_0806527
474 Ga0501072_0026109
475 Ga0501072_0027441
476 Ga0501072_0033182
477 Ga0501073_0239858
478 Ga0501073_0271492
479 Ga0501074_0036378
480 Ga0501074_0122112
481 Ga0501075_0038963
482 Ga0501075_0049321
483 Ga0501075_0136870
484 Ga0501076_0005637
485 Ga0501076_0030208
486 Ga0501077_0285189
487 Ga0501077_0476838
488 Ga0501243_109606
489 Ga0501079_0020672
490 Ga0501079_0297631
491 Ga0501080_0240708
492 Ga0501080_0390873
493 Ga0501080_0427107
494 Ga0501080_1717495
495 Ga0501081_0227062
496 Ga0501081_0453514
497 Ga0501035_0009921
498 Ga0501035_0254522
499 Ga0501035_0304872
500 Ga0501045_0001508
501 Ga0501045_0061420
502 Ga0501045_0279677
503 nmdc:mga03683_403754_c1
504 nmdc:mga03683_55855_c1
505 nmdc:mga03n38_40656_c1
506 nmdc:mga00v17_498276_c1
507 nmdc:mga00v17_92735_c1
508 nmdc:mga0yw44_1213_c1
509 nmdc:mga0yw44_1232131_c1
510 nmdc:mga0yw44_751245_c1
511 nmdc:mga06z11_27313_c1
512 nmdc:mga04h51_6465_c1
513 nmdc:mga07m45_81088_c1
514 nmdc:mga07m45_96155_c1
515 Ga0500573_0266672
516 Ga0501084_0013904
517 Ga0501084_0547924
518 Ga0501082_0254050
519 Ga0501082_0784513
520 Ga0530510_0021644
521 Ga0530510_0666540
522 Ga0530510_0881841
523 2644094079
524 2644323922
525 2808875667
526 2812334657
527 2855388313
528 2857486242

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01741

MscL

Large-conductance mechanosensitive channel, MscL

1

124

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End Superfamily
af_P68805_1_94_1.10.1200.120 Mainly Alpha;Orthogonal Bundle;Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A;Large-conductance mechanosensitive channel, MscL; domain 1 0.7442 2 90 1.10.1200.120
af_P68805_1_94_1.10.1200.120 Mainly Alpha;Orthogonal Bundle;Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A;Large-conductance mechanosensitive channel, MscL; domain 1 0.7055 2 90 1.10.1200.120
af_Q4CN11_1_226_1.20.58.2220 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Formin, FH2 domain 0.3519 12 117 1.20.58.2220
af_F4J6B8_1_112_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.339 13 77 1.20.140.150
af_Q4CN11_1_226_1.20.58.2220 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Formin, FH2 domain 0.3082 12 117 1.20.58.2220
ID Description Score Start End GO Terms
AF-A0A356FGT1-F1-model_v4 deleted 0.8054 1 90
AF-E8V4U4-F1-model_v4 Large-conductance mechanosensitive channel 0.7892 2 98 GO:0005886
GO:0008381
AF-A0A356FGT1-F1-model_v4 deleted 0.7836 1 90
AF-A0A810KTB8-F1-model_v4 Large-conductance mechanosensitive channel 0.7549 2 100 GO:0005886
GO:0008381
AF-A0A455SWV6-F1-model_v4 Large-conductance mechanosensitive channel 0.7482 2 101 GO:0005886
GO:0008381

Map