F372140

General Info

Members Datasets Scaffolds Average Seq Length
263 162 526 205

Family's Representative Sequence

Representative Sequence 3300048914|Ga0496111_0424788|Ga0496111_0424788_200_916
Length 238
Sequence MAALHSFWPWVSLALLGAFHGLNPAMGWLFAVARGLQERRLRGVLHALGPIAAGHALAIGLVAVAFGILGFVVPPALLLALGGMALLGFAGWIVLRRFRHPRWVGMRATPRQLVLWSFLMATAHGAGLMLIPALVALGGERTPSALAAAPIDHHLGHAMPVADDALLAALAAVGVHTAGMLLVATAIAIVVYEKVGVELLRRAWFNLDFIWVGALTIAGAVALGFGLWSFLSNSLIGT

Samples

Sample ID Description Type Environment
1 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
43 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
46 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
47 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
48 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
49 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
50 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
51 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
71 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
76 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
77 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
118 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
119 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
120 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
121 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
122 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
123 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
124 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
125 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
126 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
127 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
128 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
129 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
130 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
131 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
132 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
133 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
134 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
135 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
136 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
137 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
138 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
139 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
140 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
141 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
142 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
143 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
144 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
145 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
146 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
147 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
148 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
149 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
150 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
151 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
154 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
155 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
156 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
157 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
158 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
159 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
160 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
161 2855683550 Micromonospora sp. RP3T Isolate Unclassified
162 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.48
Metatranscriptomes 0.76
Isolates 0.76

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.7
Rhizosphere 91.63
Stem 0
Stem Tuber 0
Unclassified 6.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496111_0424788 3300048914 Bacteria 982
2 Ga0070658_10009763 3300005327 Bacteria 7709
3 Ga0070683_100003277 3300005329 Bacteria 13090
4 Ga0070683_100005491 3300005329 Bacteria 10592
5 Ga0070683_100065276 3300005329 Bacteria 3389
6 Ga0070683_100079506 3300005329 Bacteria 3069
7 Ga0070683_100539980 3300005329 Bacteria 1115
8 Ga0070670_100031420 3300005331 Bacteria 4573
9 Ga0070680_100000416 3300005336 Bacteria 29057
10 Ga0070682_100051032 3300005337 Bacteria 2584
11 Ga0070682_100243795 3300005337 Bacteria 1291
12 Ga0070661_100019597 3300005344 Bacteria 4821
13 Ga0070661_100032989 3300005344 Bacteria 3751
14 Ga0070692_10154257 3300005345 Bacteria 1311
15 Ga0070675_100008275 3300005354 Bacteria 8068
16 Ga0070674_100278375 3300005356 Bacteria 1325
17 Ga0070673_100047519 3300005364 Bacteria 3340
18 Ga0070688_100105581 3300005365 Bacteria 1865
19 Ga0070659_100037045 3300005366 Bacteria 3802
20 Ga0070659_100210946 3300005366 Bacteria 1600
21 Ga0070659_100298408 3300005366 Unclassified 1343
22 Ga0070667_100502136 3300005367 Bacteria 1112
23 Ga0070714_100104789 3300005435 Bacteria 2496
24 Ga0070713_100579835 3300005436 Bacteria 1064
25 Ga0070711_100085963 3300005439 Unclassified 2254
26 Ga0070711_100302220 3300005439 Bacteria 1273
27 Ga0070700_100019200 3300005441 Bacteria 3943
28 Ga0070694_100601050 3300005444 Bacteria 886
29 Ga0070708_100003188 3300005445 Bacteria 12788
30 Ga0070708_100049794 3300005445 Bacteria 3707
31 Ga0070708_100184506 3300005445 Bacteria 1951
32 Ga0070678_100100464 3300005456 Bacteria 2241
33 Ga0070662_100126111 3300005457 Bacteria 1968
34 Ga0068867_100136624 3300005459 Bacteria 1912
35 Ga0070706_100000702 3300005467 Bacteria 37793
36 Ga0070706_100000831 3300005467 Bacteria 34175
37 Ga0070706_100080692 3300005467 Bacteria 3013
38 Ga0070706_100165264 3300005467 Bacteria 2067
39 Ga0070706_100256207 3300005467 Bacteria 1634
40 Ga0070707_100000029 3300005468 Bacteria 123116
41 Ga0070707_100020219 3300005468 Bacteria 6277
42 Ga0070707_100020501 3300005468 Bacteria 6237
43 Ga0070707_100046618 3300005468 Bacteria 4148
44 Ga0070707_100202381 3300005468 Bacteria 1935
45 Ga0070707_101094522 3300005468 Bacteria 763
46 Ga0070698_100003017 3300005471 Bacteria 18548
47 Ga0070698_100004729 3300005471 Bacteria 14950
48 Ga0070698_100136642 3300005471 Bacteria 2405
49 Ga0070698_100300842 3300005471 Bacteria 1535
50 Ga0070698_100490302 3300005471 Bacteria 1166
51 Ga0070699_100024215 3300005518 Bacteria 5231
52 Ga0070699_100078925 3300005518 Bacteria 2867
53 Ga0070699_100130596 3300005518 Bacteria 2214
54 Ga0070699_100231415 3300005518 Bacteria 1648
55 Ga0070699_100262762 3300005518 Bacteria 1544
56 Ga0070679_100119182 3300005530 Bacteria 2624
57 Ga0070684_100002536 3300005535 Bacteria 13485
58 Ga0070684_100080626 3300005535 Bacteria 2879
59 Ga0070684_100104124 3300005535 Bacteria 2538
60 Ga0070684_100342000 3300005535 Bacteria 1375
61 Ga0070697_100000003 3300005536 Bacteria 322584
62 Ga0070697_100032938 3300005536 Bacteria 4172
63 Ga0070697_100076723 3300005536 Bacteria 2748
64 Ga0070697_100089387 3300005536 Bacteria 2545
65 Ga0070697_100539969 3300005536 Bacteria 1022
66 Ga0068853_100022560 3300005539 Bacteria 5258
67 Ga0070665_100233108 3300005548 Bacteria 1841
68 Ga0070704_100622087 3300005549 Bacteria 951
69 Ga0068855_100011995 3300005563 Bacteria 10477
70 Ga0068855_100014558 3300005563 Bacteria 9476
71 Ga0068855_100049574 3300005563 Bacteria 4952
72 Ga0068855_100303405 3300005563 Bacteria 1768
73 Ga0068855_100991519 3300005563 Bacteria 883
74 Ga0070664_100006260 3300005564 Bacteria 9613
75 Ga0070664_100034467 3300005564 Bacteria 4247
76 Ga0070664_100397652 3300005564 Bacteria 1260
77 Ga0068857_100010641 3300005577 Bacteria 8000
78 Ga0068856_100013042 3300005614 Bacteria 8048
79 Ga0068856_100021160 3300005614 Bacteria 6320
80 Ga0068856_100029663 3300005614 Bacteria 5344
81 Ga0068852_100073425 3300005616 Bacteria 3009
82 Ga0068852_100336474 3300005616 Bacteria 1470
83 Ga0068852_100527093 3300005616 Bacteria 1179
84 Ga0068864_100095152 3300005618 Bacteria 2634
85 Ga0068851_10192298 3300005834 Bacteria 1135
86 Ga0068863_101281273 3300005841 Unclassified 740
87 Ga0070715_10027783 3300006163 Bacteria 2263
88 Ga0070716_100312422 3300006173 Bacteria 1098
89 Ga0070716_100446439 3300006173 Bacteria 942
90 Ga0068871_100071557 3300006358 Bacteria 2853
91 Ga0075428_100363199 3300006844 Bacteria 1553
92 Ga0075433_10538703 3300006852 Bacteria 1027
93 Ga0075434_100621546 3300006871 Bacteria 1099
94 Ga0068865_100207494 3300006881 Bacteria 1525
95 Ga0075436_100012031 3300006914 Bacteria 5935
96 Ga0075436_100078355 3300006914 Bacteria 2289
97 Ga0075435_100014794 3300007076 Bacteria 5848
98 Ga0099794_10002894 3300007265 Bacteria 6447
99 Ga0099794_10170623 3300007265 Unclassified 1109
100 Ga0105240_10179052 3300009093 Bacteria 2504
101 Ga0105240_10452054 3300009093 Bacteria 1437
102 Ga0111539_10073397 3300009094 Bacteria 4034
103 Ga0105245_10005442 3300009098 Bacteria 11187
104 Ga0105245_10333431 3300009098 Bacteria 1498
105 Ga0105245_10534070 3300009098 Bacteria 1193
106 Ga0105247_10384706 3300009101 Bacteria 996
107 Ga0114129_10270947 3300009147 Bacteria 2271
108 Ga0105243_10139671 3300009148 Bacteria 2065
109 Ga0105241_10019000 3300009174 Bacteria 5065
110 Ga0105248_10019713 3300009177 Bacteria 7467
111 Ga0105238_10607657 3300009551 Bacteria 1102
112 Ga0105239_10042270 3300010375 Bacteria 4995
113 Ga0105239_10045330 3300010375 Bacteria 4819
114 Ga0157373_10221833 3300013100 Bacteria 1334
115 Ga0157370_10001412 3300013104 Bacteria 29803
116 Ga0157370_10058379 3300013104 Bacteria 3668
117 Ga0157369_10002676 3300013105 Bacteria 21247
118 Ga0157369_10002887 3300013105 Bacteria 20533
119 Ga0157369_10423136 3300013105 Bacteria 1381
120 Ga0157374_10017354 3300013296 Bacteria 6337
121 Ga0157374_10231291 3300013296 Bacteria 1816
122 Ga0157378_10568979 3300013297 Bacteria 1141
123 Ga0157372_10022377 3300013307 Bacteria 6838
124 Ga0157372_10070023 3300013307 Bacteria 3946
125 Ga0157372_10106456 3300013307 Bacteria 3208
126 Ga0157372_10239122 3300013307 Bacteria 2107
127 Ga0157372_10240112 3300013307 Bacteria 2102
128 Ga0157375_10045468 3300013308 Bacteria 4273
129 Ga0163163_11305163 3300014325 Bacteria 788
130 Ga0157380_10449675 3300014326 Bacteria 1237
131 Ga0157377_10001662 3300014745 Bacteria 9689
132 Ga0157376_10053210 3300014969 Unclassified 3369
133 Ga0157376_10926092 3300014969 Bacteria 891
134 Ga0206349_1433208 3300020075 Unclassified 1415
135 Ga0206353_12005111 3300020082 Bacteria 767
136 Ga0213876_10069894 3300021384 Bacteria 1855
137 Ga0213875_10006140 3300021388 Bacteria 6346
138 Ga0207656_10088588 3300025321 Bacteria 1402
139 Ga0207656_10133291 3300025321 Bacteria 1166
140 Ga0207688_10007155 3300025901 Bacteria 6068
141 Ga0207680_10188162 3300025903 Bacteria 1400
142 Ga0207705_10070758 3300025909 Bacteria 2528
143 Ga0207684_10000008 3300025910 Bacteria 601602
144 Ga0207684_10001579 3300025910 Bacteria 24306
145 Ga0207684_10088643 3300025910 Bacteria 2636
146 Ga0207684_10112738 3300025910 Bacteria 2328
147 Ga0207684_10223169 3300025910 Bacteria 1626
148 Ga0207654_10130957 3300025911 Unclassified 1588
149 Ga0207693_10018242 3300025915 Bacteria 5590
150 Ga0207693_10062336 3300025915 Bacteria 2921
151 Ga0207663_10434815 3300025916 Bacteria 1010
152 Ga0207660_10015866 3300025917 Unclassified 4978
153 Ga0207657_10221457 3300025919 Bacteria 1516
154 Ga0207649_10025230 3300025920 Bacteria 3464
155 Ga0207649_10192114 3300025920 Bacteria 1437
156 Ga0207652_10259784 3300025921 Bacteria 1566
157 Ga0207646_10000142 3300025922 Bacteria 98159
158 Ga0207646_10000166 3300025922 Bacteria 89251
159 Ga0207646_10001408 3300025922 Bacteria 29855
160 Ga0207646_10011700 3300025922 Bacteria 8485
161 Ga0207646_10047534 3300025922 Bacteria 3849
162 Ga0207646_10053218 3300025922 Bacteria 3621
163 Ga0207646_10136657 3300025922 Bacteria 2207
164 Ga0207646_10643049 3300025922 Bacteria 950
165 Ga0207694_10015394 3300025924 Bacteria 5767
166 Ga0207687_10448386 3300025927 Bacteria 1070
167 Ga0207644_10046428 3300025931 Bacteria 3095
168 Ga0207690_10388127 3300025932 Bacteria 1111
169 Ga0207706_10107789 3300025933 Bacteria 2451
170 Ga0207686_10090254 3300025934 Bacteria 2021
171 Ga0207709_10076997 3300025935 Bacteria 2136
172 Ga0207669_10276053 3300025937 Unclassified 1265
173 Ga0207669_10346570 3300025937 Bacteria 1146
174 Ga0207704_10005417 3300025938 Bacteria 5884
175 Ga0207704_10177997 3300025938 Bacteria 1533
176 Ga0207665_10040290 3300025939 Bacteria 3116
177 Ga0207711_10026188 3300025941 Bacteria 4892
178 Ga0207689_10056404 3300025942 Bacteria 3233
179 Ga0207661_10044976 3300025944 Bacteria 3492
180 Ga0207679_10023322 3300025945 Bacteria 4229
181 Ga0207679_10023652 3300025945 Bacteria 4204
182 Ga0207679_10374908 3300025945 Bacteria 1246
183 Ga0207667_10021864 3300025949 Bacteria 7079
184 Ga0207667_10027128 3300025949 Bacteria 6244
185 Ga0207667_10105501 3300025949 Bacteria 2907
186 Ga0207667_10690643 3300025949 Bacteria 1024
187 Ga0207667_11033280 3300025949 Bacteria 808
188 Ga0207712_10066326 3300025961 Bacteria 2580
189 Ga0207712_10874492 3300025961 Bacteria 793
190 Ga0207658_10350066 3300025986 Bacteria 1286
191 Ga0207658_10742841 3300025986 Bacteria 888
192 Ga0207639_10035747 3300026041 Bacteria 3678
193 Ga0207639_10114736 3300026041 Bacteria 2202
194 Ga0207678_10036646 3300026067 Bacteria 4270
195 Ga0207708_10000782 3300026075 Bacteria 24008
196 Ga0207702_10052207 3300026078 Bacteria 3459
197 Ga0207702_10168012 3300026078 Bacteria 2009
198 Ga0207702_10963036 3300026078 Bacteria 846
199 Ga0207641_10233166 3300026088 Bacteria 1712
200 Ga0207641_11027437 3300026088 Unclassified 821
201 Ga0207676_10228641 3300026095 Bacteria 1661
202 Ga0207674_10009840 3300026116 Bacteria 10887
203 Ga0207674_10167056 3300026116 Bacteria 2154
204 Ga0207674_10641825 3300026116 Bacteria 1025
205 Ga0207683_10011456 3300026121 Bacteria 7567
206 Ga0207698_10190479 3300026142 Bacteria 1826
207 Ga0209588_1006352 3300027671 Bacteria 3432
208 Ga0207428_10027631 3300027907 Bacteria 4722
209 Ga0307513_10454749 3300031456 Bacteria 1004
210 Ga0307408_100244306 3300031548 Bacteria 1477
211 Ga0307409_100464247 3300031995 Bacteria 1225
212 Ga0307416_100068027 3300032002 Bacteria 2941
213 Ga0307416_100144174 3300032002 Bacteria 2171
214 Ga0307416_101382854 3300032002 Bacteria 810
215 Ga0307415_100039154 3300032126 Bacteria 3130
216 Ga0373923_0061052 3300035111 Bacteria 1601
217 Ga0373955_0282680 3300035172 Bacteria 998
218 Ga0373927_0480442 3300035695 Bacteria 821
219 Ga0373947_0138896 3300035725 Bacteria 1557
220 Ga0395900_0361610 3300037418 Bacteria 1423
221 Ga0395898_0309693 3300037466 Unclassified 1506
222 Ga0395905_1394461 3300037471 Unclassified 605
223 Ga0436364_0204865 3300037853 Unclassified 775
224 Ga0436364_0451335 3300037853 Bacteria 33153
225 Ga0436365_1765978 3300039437 Bacteria 6080
226 Ga0466969_0079610 3300044656 Bacteria 1566
227 Ga0466965_0294722 3300044683 Bacteria 879
228 Ga0466971_0237009 3300044719 Unclassified 867
229 Ga0466959_0200130 3300045049 Bacteria 1391
230 Ga0466958_0054365 3300045836 Bacteria 2428
231 Ga0466958_0823615 3300045836 Unclassified 605
232 Ga0466967_0092553 3300045976 Unclassified 2749
233 Ga0466967_0446479 3300045976 Bacteria 1264
234 Ga0495580_0007450 3300046472 Bacteria 8797
235 Ga0496100_0116002 3300048903 Bacteria 1868
236 Ga0496101_0011472 3300048904 Bacteria 5882
237 Ga0496102_0014424 3300048905 Bacteria 6865
238 Ga0496105_0939446 3300048908 Unclassified 650
239 Ga0496106_0146180 3300048909 Bacteria 1862
240 Ga0496107_0039681 3300048910 Bacteria 3378
241 Ga0496108_0012323 3300048911 Bacteria 6955
242 Ga0496109_0021292 3300048912 Bacteria 5732
243 Ga0496109_0116750 3300048912 Bacteria 2484
244 Ga0496110_0011836 3300048913 Bacteria 7164
245 Ga0496112_0007262 3300048915 Bacteria 9820
246 Ga0496112_0183829 3300048915 Bacteria 2054
247 Ga0496113_0109860 3300048916 Bacteria 2145
248 Ga0496115_0014074 3300048918 Bacteria 6056
249 Ga0501038_0558507 3300049574 Bacteria 870
250 Ga0501047_0012389 3300049581 Bacteria 8071
251 Ga0501067_0217963 3300049583 Unclassified 1063
252 nmdc:mga05p37_227667_c1 3300050507 Bacteria 2247
253 nmdc:mga05p37_392992_c1 3300050507 Bacteria 1621
254 nmdc:mga06r32_209930_c1 3300050510 Bacteria 1935
255 nmdc:mga08y16_41020_c1 3300050511 Bacteria 4849
256 nmdc:mga0n895_23067_c1 3300050512 Bacteria 5845
257 nmdc:mga0n895_336921_c1 3300050512 Bacteria 1528
258 nmdc:mga0rr50_17802_c1 3300050513 Bacteria 4756
259 nmdc:mga0rr50_488718_c1 3300050513 Bacteria 1046
260 nmdc:mga08x19_36504_c1 3300050514 Bacteria 3113
261 nmdc:mga0a205_9618_c1 3300050515 Bacteria 8849
262 2855686320 2855683550 Bacteria 7134265
263 8053947282 8053945823 Bacteria 8962862
264 Ga0496111_0424788
265 Ga0070658_10009763
266 Ga0070683_100003277
267 Ga0070683_100005491
268 Ga0070683_100065276
269 Ga0070683_100079506
270 Ga0070683_100539980
271 Ga0070670_100031420
272 Ga0070680_100000416
273 Ga0070682_100051032
274 Ga0070682_100243795
275 Ga0070661_100019597
276 Ga0070661_100032989
277 Ga0070692_10154257
278 Ga0070675_100008275
279 Ga0070674_100278375
280 Ga0070673_100047519
281 Ga0070688_100105581
282 Ga0070659_100037045
283 Ga0070659_100210946
284 Ga0070659_100298408
285 Ga0070667_100502136
286 Ga0070714_100104789
287 Ga0070713_100579835
288 Ga0070711_100085963
289 Ga0070711_100302220
290 Ga0070700_100019200
291 Ga0070694_100601050
292 Ga0070708_100003188
293 Ga0070708_100049794
294 Ga0070708_100184506
295 Ga0070678_100100464
296 Ga0070662_100126111
297 Ga0068867_100136624
298 Ga0070706_100000702
299 Ga0070706_100000831
300 Ga0070706_100080692
301 Ga0070706_100165264
302 Ga0070706_100256207
303 Ga0070707_100000029
304 Ga0070707_100020219
305 Ga0070707_100020501
306 Ga0070707_100046618
307 Ga0070707_100202381
308 Ga0070707_101094522
309 Ga0070698_100003017
310 Ga0070698_100004729
311 Ga0070698_100136642
312 Ga0070698_100300842
313 Ga0070698_100490302
314 Ga0070699_100024215
315 Ga0070699_100078925
316 Ga0070699_100130596
317 Ga0070699_100231415
318 Ga0070699_100262762
319 Ga0070679_100119182
320 Ga0070684_100002536
321 Ga0070684_100080626
322 Ga0070684_100104124
323 Ga0070684_100342000
324 Ga0070697_100000003
325 Ga0070697_100032938
326 Ga0070697_100076723
327 Ga0070697_100089387
328 Ga0070697_100539969
329 Ga0068853_100022560
330 Ga0070665_100233108
331 Ga0070704_100622087
332 Ga0068855_100011995
333 Ga0068855_100014558
334 Ga0068855_100049574
335 Ga0068855_100303405
336 Ga0068855_100991519
337 Ga0070664_100006260
338 Ga0070664_100034467
339 Ga0070664_100397652
340 Ga0068857_100010641
341 Ga0068856_100013042
342 Ga0068856_100021160
343 Ga0068856_100029663
344 Ga0068852_100073425
345 Ga0068852_100336474
346 Ga0068852_100527093
347 Ga0068864_100095152
348 Ga0068851_10192298
349 Ga0068863_101281273
350 Ga0070715_10027783
351 Ga0070716_100312422
352 Ga0070716_100446439
353 Ga0068871_100071557
354 Ga0075428_100363199
355 Ga0075433_10538703
356 Ga0075434_100621546
357 Ga0068865_100207494
358 Ga0075436_100012031
359 Ga0075436_100078355
360 Ga0075435_100014794
361 Ga0099794_10002894
362 Ga0099794_10170623
363 Ga0105240_10179052
364 Ga0105240_10452054
365 Ga0111539_10073397
366 Ga0105245_10005442
367 Ga0105245_10333431
368 Ga0105245_10534070
369 Ga0105247_10384706
370 Ga0114129_10270947
371 Ga0105243_10139671
372 Ga0105241_10019000
373 Ga0105248_10019713
374 Ga0105238_10607657
375 Ga0105239_10042270
376 Ga0105239_10045330
377 Ga0157373_10221833
378 Ga0157370_10001412
379 Ga0157370_10058379
380 Ga0157369_10002676
381 Ga0157369_10002887
382 Ga0157369_10423136
383 Ga0157374_10017354
384 Ga0157374_10231291
385 Ga0157378_10568979
386 Ga0157372_10022377
387 Ga0157372_10070023
388 Ga0157372_10106456
389 Ga0157372_10239122
390 Ga0157372_10240112
391 Ga0157375_10045468
392 Ga0163163_11305163
393 Ga0157380_10449675
394 Ga0157377_10001662
395 Ga0157376_10053210
396 Ga0157376_10926092
397 Ga0206349_1433208
398 Ga0206353_12005111
399 Ga0213876_10069894
400 Ga0213875_10006140
401 Ga0207656_10088588
402 Ga0207656_10133291
403 Ga0207688_10007155
404 Ga0207680_10188162
405 Ga0207705_10070758
406 Ga0207684_10000008
407 Ga0207684_10001579
408 Ga0207684_10088643
409 Ga0207684_10112738
410 Ga0207684_10223169
411 Ga0207654_10130957
412 Ga0207693_10018242
413 Ga0207693_10062336
414 Ga0207663_10434815
415 Ga0207660_10015866
416 Ga0207657_10221457
417 Ga0207649_10025230
418 Ga0207649_10192114
419 Ga0207652_10259784
420 Ga0207646_10000142
421 Ga0207646_10000166
422 Ga0207646_10001408
423 Ga0207646_10011700
424 Ga0207646_10047534
425 Ga0207646_10053218
426 Ga0207646_10136657
427 Ga0207646_10643049
428 Ga0207694_10015394
429 Ga0207687_10448386
430 Ga0207644_10046428
431 Ga0207690_10388127
432 Ga0207706_10107789
433 Ga0207686_10090254
434 Ga0207709_10076997
435 Ga0207669_10276053
436 Ga0207669_10346570
437 Ga0207704_10005417
438 Ga0207704_10177997
439 Ga0207665_10040290
440 Ga0207711_10026188
441 Ga0207689_10056404
442 Ga0207661_10044976
443 Ga0207679_10023322
444 Ga0207679_10023652
445 Ga0207679_10374908
446 Ga0207667_10021864
447 Ga0207667_10027128
448 Ga0207667_10105501
449 Ga0207667_10690643
450 Ga0207667_11033280
451 Ga0207712_10066326
452 Ga0207712_10874492
453 Ga0207658_10350066
454 Ga0207658_10742841
455 Ga0207639_10035747
456 Ga0207639_10114736
457 Ga0207678_10036646
458 Ga0207708_10000782
459 Ga0207702_10052207
460 Ga0207702_10168012
461 Ga0207702_10963036
462 Ga0207641_10233166
463 Ga0207641_11027437
464 Ga0207676_10228641
465 Ga0207674_10009840
466 Ga0207674_10167056
467 Ga0207674_10641825
468 Ga0207683_10011456
469 Ga0207698_10190479
470 Ga0209588_1006352
471 Ga0207428_10027631
472 Ga0307513_10454749
473 Ga0307408_100244306
474 Ga0307409_100464247
475 Ga0307416_100068027
476 Ga0307416_100144174
477 Ga0307416_101382854
478 Ga0307415_100039154
479 Ga0373923_0061052
480 Ga0373955_0282680
481 Ga0373927_0480442
482 Ga0373947_0138896
483 Ga0395900_0361610
484 Ga0395898_0309693
485 Ga0395905_1394461
486 Ga0436364_0204865
487 Ga0436364_0451335
488 Ga0436365_1765978
489 Ga0466969_0079610
490 Ga0466965_0294722
491 Ga0466971_0237009
492 Ga0466959_0200130
493 Ga0466958_0054365
494 Ga0466958_0823615
495 Ga0466967_0092553
496 Ga0466967_0446479
497 Ga0495580_0007450
498 Ga0496100_0116002
499 Ga0496101_0011472
500 Ga0496102_0014424
501 Ga0496105_0939446
502 Ga0496106_0146180
503 Ga0496107_0039681
504 Ga0496108_0012323
505 Ga0496109_0021292
506 Ga0496109_0116750
507 Ga0496110_0011836
508 Ga0496112_0007262
509 Ga0496112_0183829
510 Ga0496113_0109860
511 Ga0496115_0014074
512 Ga0501038_0558507
513 Ga0501047_0012389
514 Ga0501067_0217963
515 nmdc:mga05p37_227667_c1
516 nmdc:mga05p37_392992_c1
517 nmdc:mga06r32_209930_c1
518 nmdc:mga08y16_41020_c1
519 nmdc:mga0n895_23067_c1
520 nmdc:mga0n895_336921_c1
521 nmdc:mga0rr50_17802_c1
522 nmdc:mga0rr50_488718_c1
523 nmdc:mga08x19_36504_c1
524 nmdc:mga0a205_9618_c1
525 2855686320
526 8053947282

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map