F372100

General Info

Members Datasets Scaffolds Average Seq Length
263 215 253 250

Family's Representative Sequence

Representative Sequence 3300046523|Ga0495644_0074521|Ga0495644_0074521_280_1017
Length 225
Sequence MNRFNGKTVLVTGGNSGMGLVTAQAFAAEGARVVITGRDAATLASAARELAKQLAEANVKLDAVFINAGIAKLAPFADITEALWDETFDINVKGAFFQIQSLVPLLNEGASIVLNGSINAHIGMPASSVYAASKAALISLAKTLSADLLSRGVRVNVISPGPVATPLHAKLGVTGDVVAQLQSQIPIGRFGRASEIAATVLHLASPESGFIVGTEIVIDGGMSQL

Samples

Sample ID Description Type Environment
1 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
2 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
3 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
4 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
5 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
6 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
7 2842711865 Duganella sp. R-73148 Isolate Unclassified
8 2857558681 Duganella sp. R-74565 Isolate Unclassified
9 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
10 2928058823 Ralstonia sp. 1138 Isolate Unclassified
11 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
12 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
13 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
14 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
15 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
16 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
19 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
20 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
54 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
70 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
78 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
79 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
80 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
82 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
83 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
108 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
110 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
111 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
112 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
113 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
114 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
115 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
116 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
117 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
118 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
119 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
120 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
121 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
122 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
123 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
124 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
125 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
126 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
127 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
128 3300044671 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA1E Metagenome Unclassified
129 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
130 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
131 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
132 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
133 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
134 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
135 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
136 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
137 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
138 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
139 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
140 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
141 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
142 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
143 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
144 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
145 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
146 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
147 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
148 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
149 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
150 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
151 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
152 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
153 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
154 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
155 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
156 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
157 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
158 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
159 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
160 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
161 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
162 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
163 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
164 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
165 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
166 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
167 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
168 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
169 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
170 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
171 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
172 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
173 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
174 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
175 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
176 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
177 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
178 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
179 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
180 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
181 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
182 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
183 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
184 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
185 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
186 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
187 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
188 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
189 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
190 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
191 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
192 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
195 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
196 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
197 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
198 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
199 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
200 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
201 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
202 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
203 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
204 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
205 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
206 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
207 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
208 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
209 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
210 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
211 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
212 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
213 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
214 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
215 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.2
Metatranscriptomes 0
Isolates 3.8

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.75
Nodule 0
Rhizoplane 6.84
Rhizosphere 75.29
Stem 0
Stem Tuber 0
Unclassified 9.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24744J21845_10021907 3300002077 Bacteria 1256
2 rootH1_10051093 3300003316 Bacteria 6218
3 rootL2_10016142 3300003322 Bacteria 9385
4 Ga0055526_1017253 3300003771 Bacteria 2770
5 Ga0065714_10101937 3300005288 Bacteria 1632
6 Ga0065712_10189523 3300005290 Unclassified 1154
7 Ga0070658_10161985 3300005327 Bacteria 1877
8 Ga0070658_10242583 3300005327 Bacteria 1527
9 Ga0070676_10052063 3300005328 Unclassified 2406
10 Ga0070690_100009687 3300005330 Bacteria 5587
11 Ga0070670_100067147 3300005331 Unclassified 3078
12 Ga0068869_100494373 3300005334 Unclassified 1020
13 Ga0070666_10089361 3300005335 Unclassified 2114
14 Ga0070680_100336180 3300005336 Bacteria 1283
15 Ga0068868_100026082 3300005338 Bacteria 4450
16 Ga0070660_100435977 3300005339 Bacteria 1086
17 Ga0070689_100867615 3300005340 Unclassified 797
18 Ga0070661_100019906 3300005344 Bacteria 4783
19 Ga0070668_100195845 3300005347 Bacteria 1657
20 Ga0070668_100245245 3300005347 Unclassified 1485
21 Ga0070669_100128552 3300005353 Unclassified 1941
22 Ga0070669_100662658 3300005353 Bacteria 879
23 Ga0070675_100009131 3300005354 Bacteria 7702
24 Ga0070671_100066562 3300005355 Bacteria 3003
25 Ga0070674_100015868 3300005356 Bacteria 4712
26 Ga0070673_100002936 3300005364 Bacteria 10509
27 Ga0070659_100000219 3300005366 Bacteria 44254
28 Ga0070667_100046591 3300005367 Bacteria 3648
29 Ga0070705_100072202 3300005440 Bacteria 2090
30 Ga0070708_100133593 3300005445 Bacteria 2298
31 Ga0070678_100000790 3300005456 Bacteria 15894
32 Ga0068867_100277000 3300005459 Bacteria 1374
33 Ga0070706_100230541 3300005467 Bacteria 1729
34 Ga0070707_100053003 3300005468 Bacteria 3888
35 Ga0070698_100017692 3300005471 Bacteria 7508
36 Ga0070699_100053529 3300005518 Bacteria 3493
37 Ga0070697_100034682 3300005536 Bacteria 4069
38 Ga0070697_100050776 3300005536 Bacteria 3367
39 Ga0070697_100235090 3300005536 Bacteria 1564
40 Ga0068853_100042007 3300005539 Bacteria 3907
41 Ga0070686_100042337 3300005544 Bacteria 2852
42 Ga0070696_100012171 3300005546 Bacteria 5766
43 Ga0070665_100067324 3300005548 Bacteria 3591
44 Ga0068854_100109345 3300005578 Unclassified 2083
45 Ga0068852_100412865 3300005616 Bacteria 1330
46 Ga0068866_10162560 3300005718 Unclassified 1303
47 Ga0068858_100688771 3300005842 Unclassified 994
48 Ga0075432_10014196 3300006058 Bacteria 2712
49 Ga0070716_100226638 3300006173 Bacteria 1259
50 Ga0097621_100015333 3300006237 Bacteria 5763
51 Ga0068871_100009620 3300006358 Bacteria 7019
52 Ga0075428_100149577 3300006844 Bacteria 2536
53 Ga0075428_100888100 3300006844 Bacteria 946
54 Ga0075430_100141432 3300006846 Bacteria 2004
55 Ga0075431_100007810 3300006847 Bacteria 10654
56 Ga0075431_100497905 3300006847 Bacteria 1210
57 Ga0075433_10054569 3300006852 Bacteria 3486
58 Ga0075433_10255519 3300006852 Bacteria 1554
59 Ga0068865_100606578 3300006881 Bacteria 926
60 Ga0111539_10000109 3300009094 Bacteria 89705
61 Ga0114129_10034797 3300009147 Bacteria 7117
62 Ga0114129_10605777 3300009147 Bacteria 1419
63 Ga0105243_10985608 3300009148 Bacteria 844
64 Ga0105241_10101696 3300009174 Bacteria 2286
65 Ga0105248_10686840 3300009177 Bacteria 1155
66 Ga0105238_10046098 3300009551 Unclassified 4401
67 Ga0105249_10436759 3300009553 Bacteria 1346
68 Ga0157326_1001498 3300012513 Bacteria 2575
69 Ga0157371_10025917 3300013102 Unclassified 4266
70 Ga0157374_10014500 3300013296 Bacteria 6897
71 Ga0157378_10006263 3300013297 Bacteria 10417
72 Ga0157375_10000797 3300013308 Bacteria 27613
73 Ga0157375_10077895 3300013308 Bacteria 3346
74 Ga0182008_10018872 3300014497 Bacteria 3567
75 Ga0157379_10008600 3300014968 Bacteria 8886
76 Ga0157376_10035229 3300014969 Bacteria 4048
77 Ga0157376_10055131 3300014969 Unclassified 3316
78 Ga0182006_1003411 3300015261 Bacteria 8128
79 Ga0182007_10013179 3300015262 Bacteria 3163
80 Ga0209565_1017059 3300025263 Bacteria 1600
81 Ga0209676_1002341 3300025292 Bacteria 13691
82 Ga0209025_1005968 3300025294 Bacteria 9685
83 Ga0209564_1001283 3300025295 Bacteria 27528
84 Ga0209257_1006323 3300025304 Bacteria 7710
85 Ga0207680_10140700 3300025903 Unclassified 1600
86 Ga0207645_10015597 3300025907 Bacteria 5043
87 Ga0207705_10162358 3300025909 Bacteria 1679
88 Ga0207654_10324383 3300025911 Bacteria 1053
89 Ga0207657_10022549 3300025919 Bacteria 5887
90 Ga0207657_10082802 3300025919 Unclassified 2693
91 Ga0207646_10222319 3300025922 Bacteria 1706
92 Ga0207681_10265948 3300025923 Bacteria 1344
93 Ga0207650_10027217 3300025925 Bacteria 4090
94 Ga0207644_10004597 3300025931 Bacteria 8977
95 Ga0207690_10032073 3300025932 Bacteria 3368
96 Ga0207669_10039611 3300025937 Bacteria 2725
97 Ga0207691_10152846 3300025940 Bacteria 2028
98 Ga0207711_10296135 3300025941 Unclassified 1492
99 Ga0207668_10244660 3300025972 Bacteria 1453
100 Ga0207668_10385884 3300025972 Bacteria 1180
101 Ga0207640_10388101 3300025981 Unclassified 1133
102 Ga0207658_10454552 3300025986 Unclassified 1134
103 Ga0207677_10020196 3300026023 Bacteria 4039
104 Ga0207703_10655477 3300026035 Unclassified 996
105 Ga0207639_10129988 3300026041 Bacteria 2083
106 Ga0207648_10240589 3300026089 Bacteria 1611
107 Ga0207648_10294752 3300026089 Bacteria 1453
108 Ga0207683_10000117 3300026121 Bacteria 64937
109 Ga0207698_10364538 3300026142 Bacteria 1369
110 Ga0209998_10038517 3300027717 Bacteria 1079
111 Ga0207428_10007444 3300027907 Bacteria 9980
112 Ga0268266_10077402 3300028379 Bacteria 2892
113 Ga0307517_10192059 3300028786 Bacteria 1294
114 Ga0307515_10008957 3300028794 Bacteria 19443
115 Ga0316177_1072788 3300030731 Bacteria 2786
116 Ga0316180_1052560 3300030736 Bacteria 3387
117 Ga0265329_10009695 3300031242 Bacteria 3575
118 Ga0265316_10022811 3300031344 Bacteria 5267
119 Ga0307509_10008837 3300031507 Bacteria 12730
120 Ga0307509_10009520 3300031507 Bacteria 12118
121 Ga0307509_10288615 3300031507 Bacteria 1396
122 Ga0307508_10001017 3300031616 Bacteria 32617
123 Ga0307508_10001048 3300031616 Bacteria 32001
124 Ga0307514_10005406 3300031649 Bacteria 11421
125 Ga0307516_10032628 3300031730 Bacteria 5243
126 Ga0307507_10041370 3300033179 Bacteria 4612
127 Ga0307507_10088138 3300033179 Bacteria 2679
128 Ga0307510_10048595 3300033180 Bacteria 4524
129 Ga0373953_0123382 3300035117 Bacteria 1101
130 Ga0373954_0195119 3300035118 Bacteria 994
131 Ga0373957_0112383 3300035120 Bacteria 1098
132 Ga0373937_0010695 3300036401 Bacteria 8027
133 Ga0395905_0000427 3300037471 Bacteria 58785
134 Ga0466969_0025088 3300044656 Bacteria 3066
135 Ga0466972_0050366 3300044658 Bacteria 2010
136 Ga0466978_0001040 3300044671 Bacteria 9965
137 Ga0466961_0000077 3300044693 Bacteria 60661
138 Ga0466963_0069624 3300044694 Bacteria 2365
139 Ga0466970_0001869 3300044765 Bacteria 10182
140 Ga0466960_0066296 3300044901 Bacteria 1785
141 Ga0466959_0004694 3300045049 Bacteria 9201
142 Ga0495627_054279 3300046453 Bacteria 1198
143 Ga0495590_0000002 3300046457 Bacteria 485720
144 Ga0495638_0000030 3300046460 Bacteria 318183
145 Ga0495638_0022011 3300046460 Bacteria 4190
146 Ga0495650_0003168 3300046471 Bacteria 12277
147 Ga0495585_0068758 3300046492 Bacteria 1934
148 Ga0495594_0196358 3300046499 Bacteria 1150
149 Ga0495607_0001827 3300046501 Bacteria 18144
150 Ga0495583_0000058 3300046506 Bacteria 200120
151 Ga0495583_0018439 3300046506 Bacteria 3674
152 Ga0495606_0000422 3300046507 Bacteria 70719
153 Ga0495606_0001596 3300046507 Bacteria 29575
154 Ga0495606_0001776 3300046507 Bacteria 27602
155 Ga0495606_0004619 3300046507 Bacteria 13640
156 Ga0495610_0017107 3300046512 Bacteria 4144
157 Ga0495610_0044344 3300046512 Bacteria 2207
158 Ga0495616_0000248 3300046513 Bacteria 43590
159 Ga0495631_0000004 3300046518 Bacteria 159706
160 Ga0495643_0000078 3300046522 Bacteria 162974
161 Ga0495643_0000099 3300046522 Bacteria 145425
162 Ga0495644_0074521 3300046523 Bacteria 1277
163 Ga0495648_0000009 3300046524 Bacteria 317193
164 Ga0495648_0003566 3300046524 Bacteria 13618
165 Ga0495648_0023740 3300046524 Bacteria 4191
166 Ga0495648_0058388 3300046524 Bacteria 2307
167 Ga0495663_0003293 3300046525 Bacteria 4680
168 Ga0495609_0074209 3300046538 Bacteria 1492
169 Ga0495621_0002395 3300046539 Bacteria 5050
170 Ga0495597_0000014 3300046542 Bacteria 177043
171 Ga0495622_0001368 3300046557 Bacteria 12438
172 Ga0495633_0000041 3300046558 Bacteria 176298
173 Ga0495633_0000065 3300046558 Bacteria 139197
174 Ga0495633_0003229 3300046558 Bacteria 11002
175 Ga0495633_0039613 3300046558 Bacteria 2249
176 Ga0495668_0000750 3300046616 Bacteria 38415
177 Ga0495625_0000023 3300046660 Bacteria 274067
178 Ga0495625_0036623 3300046660 Bacteria 3605
179 Ga0495625_0041501 3300046660 Bacteria 3349
180 Ga0495625_0150416 3300046660 Bacteria 1565
181 Ga0495625_0210220 3300046660 Bacteria 1279
182 Ga0495659_0000266 3300046664 Bacteria 21306
183 Ga0495588_0108896 3300046674 Bacteria 1459
184 Ga0495658_0078044 3300046683 Bacteria 1937
185 Ga0495669_0033163 3300046684 Bacteria 2272
186 Ga0495669_0033283 3300046684 Bacteria 2268
187 Ga0495624_0108069 3300046690 Bacteria 1711
188 Ga0495670_0094282 3300046691 Bacteria 1535
189 Ga0495670_0135608 3300046691 Bacteria 1285
190 Ga0495649_0010719 3300046694 Bacteria 5397
191 Ga0495636_0108922 3300047318 Bacteria 1217
192 Ga0495636_0139110 3300047318 Bacteria 1083
193 Ga0495674_0230095 3300047319 Bacteria 1530
194 Ga0495672_0000277 3300047320 Bacteria 71082
195 Ga0495676_0005555 3300047321 Bacteria 11571
196 Ga0495675_0113643 3300047444 Bacteria 1689
197 Ga0495677_0077853 3300047445 Bacteria 1241
198 Ga0495685_037740 3300047447 Bacteria 1656
199 Ga0495673_0000015 3300047469 Bacteria 598766
200 Ga0495593_0040447 3300047673 Bacteria 2510
201 Ga0496100_0001227 3300048903 Bacteria 12470
202 Ga0496101_0002551 3300048904 Bacteria 11173
203 Ga0496102_0032143 3300048905 Bacteria 4714
204 Ga0496102_0078838 3300048905 Bacteria 3032
205 Ga0496103_0003049 3300048906 Bacteria 10303
206 Ga0496104_0035804 3300048907 Bacteria 4637
207 Ga0496105_0110132 3300048908 Bacteria 2273
208 Ga0496106_0115981 3300048909 Unclassified 2089
209 Ga0496107_0252255 3300048910 Bacteria 1313
210 Ga0496108_0037023 3300048911 Bacteria 4062
211 Ga0496109_0003293 3300048912 Bacteria 13487
212 Ga0496109_0458800 3300048912 Unclassified 1203
213 Ga0496110_0227459 3300048913 Bacteria 1696
214 Ga0496112_0122263 3300048915 Unclassified 2574
215 Ga0496113_0145825 3300048916 Bacteria 1865
216 Ga0496113_0549639 3300048916 Unclassified 926
217 Ga0496114_0024995 3300048917 Bacteria 4878
218 Ga0496115_0252761 3300048918 Unclassified 1451
219 Ga0496122_0124281 3300048925 Bacteria 1656
220 Ga0496123_0043757 3300048926 Bacteria 3071
221 Ga0496126_0530584 3300048929 Bacteria 937
222 Ga0495678_000165 3300049459 Bacteria 77667
223 Ga0495678_002129 3300049459 Bacteria 14033
224 Ga0495678_016344 3300049459 Bacteria 3395
225 Ga0501043_0401405 3300049579 Bacteria 1036
226 Ga0501035_0028056 3300049822 Bacteria 5141
227 Ga0501035_0031180 3300049822 Bacteria 4855
228 Ga0501044_0000132 3300049823 Bacteria 91574
229 nmdc:mga05p37_177195_c1 3300050507 Bacteria 2596
230 nmdc:mga0qj67_136942_c1 3300050509 Bacteria 1984
231 nmdc:mga06r32_17852_c1 3300050510 Bacteria 6484
232 nmdc:mga06r32_285808_c1 3300050510 Bacteria 1636
233 nmdc:mga06r32_315914_c1 3300050510 Bacteria 1548
234 nmdc:mga08y16_280_c1 3300050511 Bacteria 46474
235 nmdc:mga08y16_554848_c1 3300050511 Bacteria 1162
236 Ga0500610_0000013 3300053079 Bacteria 88264
237 Ga0500583_0005295 3300053092 Bacteria 4307
238 Ga0500650_0075041 3300053098 Bacteria 1581
239 Ga0500562_013621 3300053108 Bacteria 2079
240 Ga0500571_000009 3300053110 Bacteria 83552
241 Ga0500592_004621 3300053116 Bacteria 2189
242 Ga0500593_000491 3300053117 Bacteria 15630
243 Ga0500594_0002142 3300053118 Bacteria 4271
244 Ga0500594_0003248 3300053118 Bacteria 3560
245 Ga0500595_041149 3300053119 Bacteria 1487
246 Ga0500608_025984 3300053122 Bacteria 2746
247 Ga0500655_000045 3300053133 Bacteria 33987
248 Ga0500564_005985 3300053138 Bacteria 5030
249 Ga0500586_000021 3300053145 Bacteria 29628
250 Ga0500622_0189233 3300053156 Bacteria 945
251 Ga0500638_038201 3300053162 Bacteria 2330
252 Ga0500636_0038539 3300053177 Bacteria 2827
253 Ga0466962_0017583 3300061719 Bacteria 3442

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046523 Ga0495644_0074521 Ga0495644_0074521_280_1017 225
2 3300003316 rootH1_10051093 rootH1_100510933 230
3 3300014968 Ga0157379_10008600 Ga0157379_100086006 240
4 3300048925 Ga0496122_0124281 Ga0496122_0124281_606_1355 244
5 iso_pu_bacteria 2510917014 2511096367 245
6 iso_pu_bacteria 2510917015 2511102932 245
7 iso_pu_bacteria 2808606384 2808968269 245
8 iso_pu_bacteria 2808606390 2809003100 245
9 iso_pu_bacteria 2808606391 2809010377 245
10 iso_pu_bacteria 2842711865 2842715674 245
11 iso_pu_bacteria 2857558681 2857561723 245
12 iso_pu_bacteria 2904479285 2904482303 245
13 iso_pu_bacteria 2928058823 2928059471 245
14 3300005327 Ga0070658_10242583 Ga0070658_102425832 248
15 3300005336 Ga0070680_100336180 Ga0070680_1003361802 248
16 3300005339 Ga0070660_100435977 Ga0070660_1004359771 248
17 3300005344 Ga0070661_100019906 Ga0070661_1000199063 248
18 3300005539 Ga0068853_100042007 Ga0068853_1000420073 248
19 3300009551 Ga0105238_10046098 Ga0105238_100460982 248
20 3300025919 Ga0207657_10022549 Ga0207657_100225494 248
21 3300026041 Ga0207639_10129988 Ga0207639_101299882 248
22 3300002077 JGI24744J21845_10021907 JGI24744J21845_100219072 249
23 3300003322 rootL2_10016142 rootL2_100161428 249
24 3300003771 Ga0055526_1017253 Ga0055526_10172532 249
25 3300005288 Ga0065714_10101937 Ga0065714_101019372 249
26 3300005290 Ga0065712_10189523 Ga0065712_101895231 249
27 3300005327 Ga0070658_10161985 Ga0070658_101619853 249
28 3300005328 Ga0070676_10052063 Ga0070676_100520632 249
29 3300005330 Ga0070690_100009687 Ga0070690_1000096873 249
30 3300005331 Ga0070670_100067147 Ga0070670_1000671473 249
31 3300005334 Ga0068869_100494373 Ga0068869_1004943731 249
32 3300005335 Ga0070666_10089361 Ga0070666_100893612 249
33 3300005338 Ga0068868_100026082 Ga0068868_1000260822 249
34 3300005340 Ga0070689_100867615 Ga0070689_1008676151 249
35 3300005347 Ga0070668_100195845 Ga0070668_1001958452 249
36 3300005347 Ga0070668_100245245 Ga0070668_1002452452 249
37 3300005353 Ga0070669_100128552 Ga0070669_1001285522 249
38 3300005353 Ga0070669_100662658 Ga0070669_1006626581 249
39 3300005354 Ga0070675_100009131 Ga0070675_1000091313 249
40 3300005355 Ga0070671_100066562 Ga0070671_1000665622 249
41 3300005356 Ga0070674_100015868 Ga0070674_1000158682 249
42 3300005364 Ga0070673_100002936 Ga0070673_10000293612 249
43 3300005366 Ga0070659_100000219 Ga0070659_1000002194 249
44 3300005367 Ga0070667_100046591 Ga0070667_1000465914 249
45 3300005440 Ga0070705_100072202 Ga0070705_1000722022 249
46 3300005445 Ga0070708_100133593 Ga0070708_1001335933 249
47 3300005456 Ga0070678_100000790 Ga0070678_10000079018 249
48 3300005459 Ga0068867_100277000 Ga0068867_1002770002 249
49 3300005467 Ga0070706_100230541 Ga0070706_1002305413 249
50 3300005468 Ga0070707_100053003 Ga0070707_1000530035 249
51 3300005471 Ga0070698_100017692 Ga0070698_1000176929 249
52 3300005518 Ga0070699_100053529 Ga0070699_1000535294 249
53 3300005536 Ga0070697_100034682 Ga0070697_1000346822 249
54 3300005536 Ga0070697_100050776 Ga0070697_1000507764 249
55 3300005536 Ga0070697_100235090 Ga0070697_1002350902 249
56 3300005544 Ga0070686_100042337 Ga0070686_1000423373 249
57 3300005546 Ga0070696_100012171 Ga0070696_1000121711 249
58 3300005548 Ga0070665_100067324 Ga0070665_1000673242 249
59 3300005578 Ga0068854_100109345 Ga0068854_1001093452 249
60 3300005616 Ga0068852_100412865 Ga0068852_1004128652 249
61 3300005718 Ga0068866_10162560 Ga0068866_101625601 249
62 3300005842 Ga0068858_100688771 Ga0068858_1006887711 249
63 3300006058 Ga0075432_10014196 Ga0075432_100141962 249
64 3300006173 Ga0070716_100226638 Ga0070716_1002266382 249
65 3300006237 Ga0097621_100015333 Ga0097621_1000153332 249
66 3300006358 Ga0068871_100009620 Ga0068871_1000096205 249
67 3300006844 Ga0075428_100149577 Ga0075428_1001495773 249
68 3300006844 Ga0075428_100888100 Ga0075428_1008881002 249
69 3300006846 Ga0075430_100141432 Ga0075430_1001414322 249
70 3300006847 Ga0075431_100007810 Ga0075431_1000078106 249
71 3300006847 Ga0075431_100497905 Ga0075431_1004979052 249
72 3300006852 Ga0075433_10054569 Ga0075433_100545692 249
73 3300006852 Ga0075433_10255519 Ga0075433_102555191 249
74 3300006881 Ga0068865_100606578 Ga0068865_1006065781 249
75 3300009094 Ga0111539_10000109 Ga0111539_1000010940 249
76 3300009147 Ga0114129_10034797 Ga0114129_1003479710 249
77 3300009147 Ga0114129_10605777 Ga0114129_106057771 249
78 3300009148 Ga0105243_10985608 Ga0105243_109856081 249
79 3300009174 Ga0105241_10101696 Ga0105241_101016961 249
80 3300009177 Ga0105248_10686840 Ga0105248_106868402 249
81 3300009553 Ga0105249_10436759 Ga0105249_104367592 249
82 3300012513 Ga0157326_1001498 Ga0157326_10014982 249
83 3300013102 Ga0157371_10025917 Ga0157371_100259174 249
84 3300013296 Ga0157374_10014500 Ga0157374_100145005 249
85 3300013297 Ga0157378_10006263 Ga0157378_100062634 249
86 3300013308 Ga0157375_10000797 Ga0157375_1000079721 249
87 3300013308 Ga0157375_10077895 Ga0157375_100778954 249
88 3300014497 Ga0182008_10018872 Ga0182008_100188724 249
89 3300014969 Ga0157376_10035229 Ga0157376_100352293 249
90 3300014969 Ga0157376_10055131 Ga0157376_100551312 249
91 3300015261 Ga0182006_1003411 Ga0182006_10034115 249
92 3300015262 Ga0182007_10013179 Ga0182007_100131792 249
93 3300025263 Ga0209565_1017059 Ga0209565_10170592 249
94 3300025292 Ga0209676_1002341 Ga0209676_100234110 249
95 3300025294 Ga0209025_1005968 Ga0209025_10059685 249
96 3300025295 Ga0209564_1001283 Ga0209564_100128315 249
97 3300025304 Ga0209257_1006323 Ga0209257_10063236 249
98 3300025903 Ga0207680_10140700 Ga0207680_101407001 249
99 3300025907 Ga0207645_10015597 Ga0207645_100155979 249
100 3300025909 Ga0207705_10162358 Ga0207705_101623581 249
101 3300025911 Ga0207654_10324383 Ga0207654_103243831 249
102 3300025919 Ga0207657_10082802 Ga0207657_100828023 249
103 3300025922 Ga0207646_10222319 Ga0207646_102223194 249
104 3300025923 Ga0207681_10265948 Ga0207681_102659482 249
105 3300025925 Ga0207650_10027217 Ga0207650_100272175 249
106 3300025931 Ga0207644_10004597 Ga0207644_100045973 249
107 3300025932 Ga0207690_10032073 Ga0207690_100320732 249
108 3300025937 Ga0207669_10039611 Ga0207669_100396112 249
109 3300025940 Ga0207691_10152846 Ga0207691_101528463 249
110 3300025941 Ga0207711_10296135 Ga0207711_102961351 249
111 3300025972 Ga0207668_10244660 Ga0207668_102446602 249
112 3300025972 Ga0207668_10385884 Ga0207668_103858842 249
113 3300025981 Ga0207640_10388101 Ga0207640_103881011 249
114 3300025986 Ga0207658_10454552 Ga0207658_104545522 249
115 3300026023 Ga0207677_10020196 Ga0207677_100201965 249
116 3300026035 Ga0207703_10655477 Ga0207703_106554771 249
117 3300026089 Ga0207648_10240589 Ga0207648_102405892 249
118 3300026089 Ga0207648_10294752 Ga0207648_102947522 249
119 3300026121 Ga0207683_10000117 Ga0207683_1000011725 249
120 3300026142 Ga0207698_10364538 Ga0207698_103645382 249
121 3300027717 Ga0209998_10038517 Ga0209998_100385171 249
122 3300027907 Ga0207428_10007444 Ga0207428_100074449 249
123 3300028379 Ga0268266_10077402 Ga0268266_100774023 249
124 3300028786 Ga0307517_10192059 Ga0307517_101920592 249
125 3300028794 Ga0307515_10008957 Ga0307515_1000895710 249
126 3300030731 Ga0316177_1072788 Ga0316177_10727883 249
127 3300030736 Ga0316180_1052560 Ga0316180_10525602 249
128 3300031242 Ga0265329_10009695 Ga0265329_100096954 249
129 3300031344 Ga0265316_10022811 Ga0265316_100228115 249
130 3300031507 Ga0307509_10008837 Ga0307509_1000883711 249
131 3300031507 Ga0307509_10009520 Ga0307509_1000952010 249
132 3300031507 Ga0307509_10288615 Ga0307509_102886152 249
133 3300031616 Ga0307508_10001017 Ga0307508_1000101710 249
134 3300031616 Ga0307508_10001048 Ga0307508_1000104814 249
135 3300031649 Ga0307514_10005406 Ga0307514_100054067 249
136 3300031730 Ga0307516_10032628 Ga0307516_100326286 249
137 3300033179 Ga0307507_10041370 Ga0307507_100413705 249
138 3300033179 Ga0307507_10088138 Ga0307507_100881382 249
139 3300033180 Ga0307510_10048595 Ga0307510_100485954 249
140 3300035117 Ga0373953_0123382 Ga0373953_0123382_73_822 249
141 3300035118 Ga0373954_0195119 Ga0373954_0195119_38_787 249
142 3300035120 Ga0373957_0112383 Ga0373957_0112383_292_1041 249
143 3300036401 Ga0373937_0010695 Ga0373937_0010695_2713_3462 249
144 3300037471 Ga0395905_0000427 Ga0395905_0000427_34485_35234 249
145 3300044656 Ga0466969_0025088 Ga0466969_0025088_1723_2484 249
146 3300044658 Ga0466972_0050366 Ga0466972_0050366_1068_1829 249
147 3300044671 Ga0466978_0001040 Ga0466978_0001040_2589_3350 249
148 3300044693 Ga0466961_0000077 Ga0466961_0000077_54269_55030 249
149 3300044694 Ga0466963_0069624 Ga0466963_0069624_1403_2164 249
150 3300044765 Ga0466970_0001869 Ga0466970_0001869_5362_6123 249
151 3300044901 Ga0466960_0066296 Ga0466960_0066296_653_1414 249
152 3300045049 Ga0466959_0004694 Ga0466959_0004694_2817_3578 249
153 3300046453 Ga0495627_054279 Ga0495627_054279_57_806 249
154 3300046457 Ga0495590_0000002 Ga0495590_0000002_423928_424677 249
155 3300046460 Ga0495638_0000030 Ga0495638_0000030_256481_257230 249
156 3300046460 Ga0495638_0022011 Ga0495638_0022011_1290_2039 249
157 3300046471 Ga0495650_0003168 Ga0495650_0003168_8132_8881 249
158 3300046492 Ga0495585_0068758 Ga0495585_0068758_1136_1885 249
159 3300046499 Ga0495594_0196358 Ga0495594_0196358_218_967 249
160 3300046501 Ga0495607_0001827 Ga0495607_0001827_1693_2442 249
161 3300046506 Ga0495583_0000058 Ga0495583_0000058_138456_139205 249
162 3300046506 Ga0495583_0018439 Ga0495583_0018439_2134_2883 249
163 3300046507 Ga0495606_0000422 Ga0495606_0000422_61945_62694 249
164 3300046507 Ga0495606_0001596 Ga0495606_0001596_23669_24418 249
165 3300046507 Ga0495606_0001776 Ga0495606_0001776_23281_24030 249
166 3300046507 Ga0495606_0004619 Ga0495606_0004619_8830_9579 249
167 3300046512 Ga0495610_0017107 Ga0495610_0017107_2303_3052 249
168 3300046512 Ga0495610_0044344 Ga0495610_0044344_129_878 249
169 3300046513 Ga0495616_0000248 Ga0495616_0000248_16344_17093 249
170 3300046518 Ga0495631_0000004 Ga0495631_0000004_130715_131464 249
171 3300046522 Ga0495643_0000078 Ga0495643_0000078_101137_101886 249
172 3300046522 Ga0495643_0000099 Ga0495643_0000099_73486_74235 249
173 3300046524 Ga0495648_0000009 Ga0495648_0000009_255261_256010 249
174 3300046524 Ga0495648_0003566 Ga0495648_0003566_10498_11247 249
175 3300046524 Ga0495648_0023740 Ga0495648_0023740_3380_4129 249
176 3300046524 Ga0495648_0058388 Ga0495648_0058388_980_1729 249
177 3300046525 Ga0495663_0003293 Ga0495663_0003293_3858_4607 249
178 3300046538 Ga0495609_0074209 Ga0495609_0074209_332_1081 249
179 3300046539 Ga0495621_0002395 Ga0495621_0002395_2252_3001 249
180 3300046542 Ga0495597_0000014 Ga0495597_0000014_117150_117899 249
181 3300046557 Ga0495622_0001368 Ga0495622_0001368_3742_4491 249
182 3300046558 Ga0495633_0000041 Ga0495633_0000041_157655_158404 249
183 3300046558 Ga0495633_0000065 Ga0495633_0000065_129941_130690 249
184 3300046558 Ga0495633_0003229 Ga0495633_0003229_6374_7123 249
185 3300046558 Ga0495633_0039613 Ga0495633_0039613_1432_2181 249
186 3300046616 Ga0495668_0000750 Ga0495668_0000750_16385_17134 249
187 3300046660 Ga0495625_0000023 Ga0495625_0000023_122840_123589 249
188 3300046660 Ga0495625_0036623 Ga0495625_0036623_2081_2836 249
189 3300046660 Ga0495625_0041501 Ga0495625_0041501_263_1012 249
190 3300046660 Ga0495625_0150416 Ga0495625_0150416_162_911 249
191 3300046660 Ga0495625_0210220 Ga0495625_0210220_106_855 249
192 3300046664 Ga0495659_0000266 Ga0495659_0000266_6748_7503 249
193 3300046674 Ga0495588_0108896 Ga0495588_0108896_664_1413 249
194 3300046683 Ga0495658_0078044 Ga0495658_0078044_803_1552 249
195 3300046684 Ga0495669_0033163 Ga0495669_0033163_556_1305 249
196 3300046684 Ga0495669_0033283 Ga0495669_0033283_1046_1795 249
197 3300046690 Ga0495624_0108069 Ga0495624_0108069_801_1550 249
198 3300046691 Ga0495670_0094282 Ga0495670_0094282_16_765 249
199 3300046691 Ga0495670_0135608 Ga0495670_0135608_43_792 249
200 3300046694 Ga0495649_0010719 Ga0495649_0010719_4350_5099 249
201 3300047318 Ga0495636_0108922 Ga0495636_0108922_148_897 249
202 3300047318 Ga0495636_0139110 Ga0495636_0139110_262_1011 249
203 3300047319 Ga0495674_0230095 Ga0495674_0230095_245_994 249
204 3300047320 Ga0495672_0000277 Ga0495672_0000277_61403_62152 249
205 3300047321 Ga0495676_0005555 Ga0495676_0005555_9716_10465 249
206 3300047444 Ga0495675_0113643 Ga0495675_0113643_652_1401 249
207 3300047445 Ga0495677_0077853 Ga0495677_0077853_60_809 249
208 3300047447 Ga0495685_037740 Ga0495685_037740_445_1194 249
209 3300047469 Ga0495673_0000015 Ga0495673_0000015_143770_144519 249
210 3300047673 Ga0495593_0040447 Ga0495593_0040447_1432_2181 249
211 3300048903 Ga0496100_0001227 Ga0496100_0001227_1970_2719 249
212 3300048904 Ga0496101_0002551 Ga0496101_0002551_4879_5628 249
213 3300048905 Ga0496102_0032143 Ga0496102_0032143_659_1408 249
214 3300048905 Ga0496102_0078838 Ga0496102_0078838_1402_2151 249
215 3300048906 Ga0496103_0003049 Ga0496103_0003049_6492_7241 249
216 3300048907 Ga0496104_0035804 Ga0496104_0035804_3359_4108 249
217 3300048908 Ga0496105_0110132 Ga0496105_0110132_1213_1962 249
218 3300048909 Ga0496106_0115981 Ga0496106_0115981_233_982 249
219 3300048910 Ga0496107_0252255 Ga0496107_0252255_185_934 249
220 3300048911 Ga0496108_0037023 Ga0496108_0037023_1918_2667 249
221 3300048912 Ga0496109_0003293 Ga0496109_0003293_2514_3317 249
222 3300048912 Ga0496109_0458800 Ga0496109_0458800_442_1191 249
223 3300048913 Ga0496110_0227459 Ga0496110_0227459_482_1231 249
224 3300048915 Ga0496112_0122263 Ga0496112_0122263_682_1431 249
225 3300048916 Ga0496113_0145825 Ga0496113_0145825_981_1730 249
226 3300048916 Ga0496113_0549639 Ga0496113_0549639_38_787 249
227 3300048917 Ga0496114_0024995 Ga0496114_0024995_3902_4651 249
228 3300048918 Ga0496115_0252761 Ga0496115_0252761_92_841 249
229 3300048926 Ga0496123_0043757 Ga0496123_0043757_821_1570 249
230 3300048929 Ga0496126_0530584 Ga0496126_0530584_67_816 249
231 3300049459 Ga0495678_000165 Ga0495678_000165_72649_73398 249
232 3300049459 Ga0495678_002129 Ga0495678_002129_12331_13080 249
233 3300049459 Ga0495678_016344 Ga0495678_016344_1693_2442 249
234 3300049579 Ga0501043_0401405 Ga0501043_0401405_230_979 249
235 3300049822 Ga0501035_0028056 Ga0501035_0028056_543_1292 249
236 3300049822 Ga0501035_0031180 Ga0501035_0031180_1715_2464 249
237 3300049823 Ga0501044_0000132 Ga0501044_0000132_33033_33782 249
238 3300050507 nmdc:mga05p37_177195_c1 nmdc:mga05p37_177195_c1_1379_2131 249
239 3300050509 nmdc:mga0qj67_136942_c1 nmdc:mga0qj67_136942_c1_102_944 249
240 3300050510 nmdc:mga06r32_17852_c1 nmdc:mga06r32_17852_c1_1711_2460 249
241 3300050510 nmdc:mga06r32_285808_c1 nmdc:mga06r32_285808_c1_799_1548 249
242 3300050510 nmdc:mga06r32_315914_c1 nmdc:mga06r32_315914_c1_438_1187 249
243 3300050511 nmdc:mga08y16_280_c1 nmdc:mga08y16_280_c1_20315_21064 249
244 3300050511 nmdc:mga08y16_554848_c1 nmdc:mga08y16_554848_c1_23_772 249
245 3300053079 Ga0500610_0000013 Ga0500610_0000013_27972_28721 249
246 3300053092 Ga0500583_0005295 Ga0500583_0005295_304_1053 249
247 3300053098 Ga0500650_0075041 Ga0500650_0075041_615_1409 249
248 3300053108 Ga0500562_013621 Ga0500562_013621_319_1068 249
249 3300053110 Ga0500571_000009 Ga0500571_000009_11032_11781 249
250 3300053116 Ga0500592_004621 Ga0500592_004621_584_1333 249
251 3300053117 Ga0500593_000491 Ga0500593_000491_11003_11752 249
252 3300053118 Ga0500594_0002142 Ga0500594_0002142_2180_2929 249
253 3300053118 Ga0500594_0003248 Ga0500594_0003248_1831_2580 249
254 3300053119 Ga0500595_041149 Ga0500595_041149_38_787 249
255 3300053122 Ga0500608_025984 Ga0500608_025984_466_1215 249
256 3300053133 Ga0500655_000045 Ga0500655_000045_11196_11945 249
257 3300053138 Ga0500564_005985 Ga0500564_005985_4083_4832 249
258 3300053145 Ga0500586_000021 Ga0500586_000021_24214_24963 249
259 3300053156 Ga0500622_0189233 Ga0500622_0189233_99_848 249
260 3300053162 Ga0500638_038201 Ga0500638_038201_1550_2299 249
261 3300053177 Ga0500636_0038539 Ga0500636_0038539_1318_2067 249
262 3300061719 Ga0466962_0017583 Ga0466962_0017583_1615_2376 249
263 iso_pu_bacteria 2501025504 2501411659 249

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

48

223

0.99

PF00106

adh_short

short chain dehydrogenase

45

174

0.95

PF00106

adh_short

short chain dehydrogenase

7

59

0.93

PF08659

KR

KR domain

42

165

0.86

PF23441

33

225

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
4bmn-assembly1.cif.gz_B apo structure of short-chain alcohol dehydrogenase from ralstonia sp. dsm 6428 0.9441 1 249
4i5g-assembly1.cif.gz_C crystal structure of ralstonia sp. alcohol dehydrogenase mutant n15g, g37d, r38v, r39s, a86n, s88a 0.9426 1 249
4bmn-assembly1.cif.gz_C apo structure of short-chain alcohol dehydrogenase from ralstonia sp. dsm 6428 0.9417 1 249
4i5d-assembly1.cif.gz_A crystal structure of ralstonia sp. alcohol dehydrogenase in its apo form 0.9404 1 249
4i5f-assembly1.cif.gz_A crystal structure of ralstonia sp. alcohol dehydrogenase mutant n15g, g37d, r38v, r39s 0.94 1 249
ID Description Score Start End Superfamily
af_A0A0R0HUJ2_8_65_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9609 7 50 3.40.50.720
4bmnA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9323 1 249 3.40.50.720
af_Q9VWP2_2_241_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9272 1 248 3.40.50.720
af_Q9BL81_2_252_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9265 8 246 3.40.50.720
4cqmK00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9258 6 244 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A6B1JS83-F1-model_v4 deleted 0.964 1 138
AF-A0A074V982-F1-model_v4 Dehydrogenase with different specificitie (Related to short-chain alcohol dehydrogenase) 0.9592 1 182 GO:0016491
AF-A0A2V6STH1-F1-model_v4 Oxidoreductase 0.957 1 183 GO:0016491
AF-A2VZ60-F1-model_v4 deleted 0.9558 1 249
AF-A0A5N7W2A1-F1-model_v4 SDR family oxidoreductase 0.9541 1 249 GO:0016491

Feature Viewer

pLDDT pTM Quality
91.37 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map