F371970

General Info

Members Datasets Scaffolds Average Seq Length
263 138 526 333

Family's Representative Sequence

Representative Sequence 3300031344|Ga0265316_10008949|Ga0265316_100089497
Length 389
Sequence LFVLSGFVKKSFDSGRIKNLHPRRASKKHKKITVFYPAPGLDFGEGFPNIRLVALFTIQSDFSYDVVRKIFEGGMGVVYEAEQHGSRDFAKRVAIKIIRPSFASQKMFIENFIGEAKLVADLIHTNIVQTYHLGEANGACFICMELIRGVNLEQFTRQLAEKKRVLPKELAVFITSRVARGLAYAHAKTDKDGKPLGIVHRDVSFKNIMIAFEGDVKLTDFGIAKARGFLTDQEGEVVAGKADYMSPEQANFQVTDKRSDLFSAGVVLSHLLLGRNLFKGATPEESRQRIINQPIPDLRTLDSRIDDGLNDILHHCLARDLKHRYATADELMYDLEYYIYHGGYGPTNETLGKFIRELFEQAIPRGAAEDKRNRTAMLEESARLKQRAK

Samples

Sample ID Description Type Environment
1 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
9 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
10 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
11 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
12 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
13 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
14 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
15 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
16 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
17 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
18 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
19 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
20 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
21 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
22 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
23 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
24 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
25 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
26 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
27 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
28 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
29 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
31 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
32 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
33 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
34 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
35 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
36 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
37 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
38 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
56 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
57 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
58 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
59 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
60 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
61 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
62 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
63 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
64 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
65 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
66 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
67 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
68 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
69 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
70 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
71 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
72 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
73 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
74 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
75 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
76 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
77 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
78 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
79 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
80 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
81 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
82 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
83 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
84 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
85 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
86 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
87 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
88 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
89 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
90 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
91 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
92 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
93 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
94 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
95 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
96 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
97 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
98 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
99 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
100 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
101 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
102 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
103 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
104 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
105 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
106 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
107 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
108 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
109 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
110 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
111 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
112 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
113 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
114 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
115 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
116 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
117 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
118 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
119 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
120 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
121 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
122 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
123 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
124 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
125 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
132 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
134 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
135 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
136 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
137 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
138 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.76
Nodule 0
Rhizoplane 0.38
Rhizosphere 98.48
Stem 0
Stem Tuber 0
Unclassified 4.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265316_10008949 3300031344 Bacteria 9235
2 rootH2_10065111 3300003320 Bacteria 2053
3 Ga0070690_100037154 3300005330 Bacteria 3068
4 Ga0070670_100096066 3300005331 Bacteria 2549
5 Ga0070689_100185828 3300005340 Bacteria 1690
6 Ga0070688_100042330 3300005365 Bacteria 2801
7 Ga0070688_100096672 3300005365 Bacteria 1940
8 Ga0070714_100034963 3300005435 Bacteria 4209
9 Ga0070701_10024663 3300005438 Bacteria 2911
10 Ga0070705_100142512 3300005440 Bacteria 1579
11 Ga0070705_100159473 3300005440 Bacteria 1506
12 Ga0070694_100040247 3300005444 Bacteria 3115
13 Ga0070679_100350255 3300005530 Bacteria 1424
14 Ga0070684_100121972 3300005535 Bacteria 2345
15 Ga0070686_100004430 3300005544 Bacteria 7747
16 Ga0070686_100092338 3300005544 Bacteria 2027
17 Ga0068855_100059320 3300005563 Bacteria 4477
18 Ga0068855_100259558 3300005563 Bacteria 1936
19 Ga0068857_100000613 3300005577 Bacteria 26259
20 Ga0068856_100003974 3300005614 Bacteria 14814
21 Ga0068856_100006046 3300005614 Bacteria 11897
22 Ga0068859_100054796 3300005617 Bacteria 4012
23 Ga0068859_100093376 3300005617 Bacteria 3061
24 Ga0068859_100329882 3300005617 Bacteria 1620
25 Ga0068864_100052269 3300005618 Bacteria 3521
26 Ga0068864_100129685 3300005618 Bacteria 2264
27 Ga0068863_100049477 3300005841 Bacteria 3986
28 Ga0068863_100058805 3300005841 Bacteria 3638
29 Ga0070715_10166800 3300006163 Unclassified 1093
30 Ga0097621_100267916 3300006237 Bacteria 1500
31 Ga0068871_100006917 3300006358 Bacteria 8080
32 Ga0075428_100000842 3300006844 Bacteria 32151
33 Ga0075431_100261180 3300006847 Bacteria 1757
34 Ga0068865_100147376 3300006881 Bacteria 1782
35 Ga0097620_100054796 3300006931 Bacteria 4012
36 Ga0097620_100093378 3300006931 Bacteria 3061
37 Ga0097620_100329878 3300006931 Bacteria 1620
38 Ga0075435_100312422 3300007076 Unclassified 1345
39 Ga0105240_10008477 3300009093 Bacteria 14699
40 Ga0105240_10024256 3300009093 Bacteria 8003
41 Ga0105240_10071787 3300009093 Bacteria 4281
42 Ga0105240_10145973 3300009093 Bacteria 2823
43 Ga0105240_10225163 3300009093 Bacteria 2183
44 Ga0105240_10304413 3300009093 Bacteria 1822
45 Ga0111539_10012838 3300009094 Bacteria 10484
46 Ga0111539_10072559 3300009094 Bacteria 4059
47 Ga0111539_10107455 3300009094 Bacteria 3274
48 Ga0111539_10151841 3300009094 Bacteria 2711
49 Ga0111539_10338495 3300009094 Bacteria 1751
50 Ga0105242_10027078 3300009176 Unclassified 4548
51 Ga0105238_10001693 3300009551 Bacteria 22183
52 Ga0105238_10013489 3300009551 Bacteria 8249
53 Ga0105238_10173795 3300009551 Bacteria 2131
54 Ga0105249_10176281 3300009553 Bacteria 2077
55 Ga0157370_10362834 3300013104 Bacteria 1335
56 Ga0157374_10305484 3300013296 Bacteria 1574
57 Ga0157375_10000048 3300013308 Bacteria 140600
58 Ga0163163_10000146 3300014325 Bacteria 73162
59 Ga0163163_10200284 3300014325 Bacteria 2045
60 Ga0157376_10039677 3300014969 Bacteria 3842
61 Ga0207684_10355685 3300025910 Bacteria 1260
62 Ga0207654_10120112 3300025911 Bacteria 1649
63 Ga0207707_10065372 3300025912 Bacteria 3168
64 Ga0207695_10034017 3300025913 Bacteria 5549
65 Ga0207695_10059463 3300025913 Bacteria 3962
66 Ga0207695_10061854 3300025913 Bacteria 3868
67 Ga0207695_10085212 3300025913 Bacteria 3189
68 Ga0207663_10015583 3300025916 Bacteria 4198
69 Ga0207660_10091633 3300025917 Bacteria 2255
70 Ga0207646_10223754 3300025922 Bacteria 1700
71 Ga0207664_10030232 3300025929 Bacteria 4136
72 Ga0207670_10005625 3300025936 Bacteria 6892
73 Ga0207670_10006119 3300025936 Bacteria 6654
74 Ga0207667_10023483 3300025949 Bacteria 6790
75 Ga0207667_10149571 3300025949 Bacteria 2404
76 Ga0207667_10186011 3300025949 Bacteria 2132
77 Ga0207712_10300711 3300025961 Bacteria 1317
78 Ga0207677_10090380 3300026023 Bacteria 2225
79 Ga0207702_10002801 3300026078 Bacteria 16327
80 Ga0207702_10007584 3300026078 Bacteria 9238
81 Ga0207641_10231031 3300026088 Bacteria 1719
82 Ga0207676_10131599 3300026095 Bacteria 2128
83 Ga0207674_10003585 3300026116 Bacteria 18926
84 Ga0207674_10116487 3300026116 Bacteria 2643
85 Ga0207675_100144000 3300026118 Bacteria 2265
86 Ga0265337_1000262 3300028556 Bacteria 28541
87 Ga0265337_1000338 3300028556 Bacteria 25034
88 Ga0265337_1009534 3300028556 Bacteria 3460
89 Ga0265337_1018823 3300028556 Bacteria 2186
90 Ga0265337_1026655 3300028556 Bacteria 1748
91 Ga0265326_10014579 3300028558 Bacteria 2288
92 Ga0265319_1000013 3300028563 Bacteria 180699
93 Ga0265319_1002375 3300028563 Bacteria 10335
94 Ga0265319_1013157 3300028563 Bacteria 3306
95 Ga0265319_1034631 3300028563 Bacteria 1736
96 Ga0265334_10005136 3300028573 Bacteria 5732
97 Ga0265334_10009566 3300028573 Bacteria 4101
98 Ga0265334_10062352 3300028573 Unclassified 1403
99 Ga0265323_10000285 3300028653 Bacteria 29242
100 Ga0265323_10005625 3300028653 Bacteria 5319
101 Ga0265323_10008918 3300028653 Bacteria 4120
102 Ga0265336_10003299 3300028666 Bacteria 6362
103 Ga0265336_10017939 3300028666 Bacteria 2299
104 Ga0265338_10000008 3300028800 Bacteria 481542
105 Ga0265338_10000016 3300028800 Bacteria 347424
106 Ga0265338_10000269 3300028800 Bacteria 95081
107 Ga0265338_10000382 3300028800 Bacteria 79298
108 Ga0265338_10000510 3300028800 Bacteria 68748
109 Ga0265338_10001031 3300028800 Bacteria 46585
110 Ga0265338_10001481 3300028800 Bacteria 38038
111 Ga0265338_10002506 3300028800 Bacteria 27353
112 Ga0265338_10002567 3300028800 Bacteria 26851
113 Ga0265338_10003191 3300028800 Bacteria 23379
114 Ga0265338_10003690 3300028800 Bacteria 21328
115 Ga0265338_10007207 3300028800 Bacteria 13898
116 Ga0265338_10026182 3300028800 Bacteria 5892
117 Ga0265338_10051666 3300028800 Bacteria 3698
118 Ga0265338_10059372 3300028800 Unclassified 3370
119 Ga0265338_10066875 3300028800 Bacteria 3108
120 Ga0265338_10083155 3300028800 Bacteria 2678
121 Ga0265338_10102512 3300028800 Bacteria 2327
122 Ga0265338_10106062 3300028800 Bacteria 2276
123 Ga0265338_10125398 3300028800 Bacteria 2038
124 Ga0265338_10183012 3300028800 Bacteria 1595
125 Ga0265338_10205039 3300028800 Bacteria 1484
126 Ga0265324_10000487 3300029957 Bacteria 27736
127 Ga0265324_10000543 3300029957 Bacteria 25808
128 Ga0265324_10012395 3300029957 Bacteria 3214
129 Ga0265324_10015069 3300029957 Bacteria 2847
130 Ga0265324_10017512 3300029957 Bacteria 2605
131 Ga0265324_10043221 3300029957 Bacteria 1556
132 Ga0265332_10054120 3300031238 Bacteria 1722
133 Ga0265332_10095324 3300031238 Bacteria 1257
134 Ga0265320_10000572 3300031240 Bacteria 28290
135 Ga0265320_10000641 3300031240 Bacteria 26751
136 Ga0265320_10008027 3300031240 Bacteria 6500
137 Ga0265320_10019766 3300031240 Bacteria 3671
138 Ga0265320_10029521 3300031240 Bacteria 2836
139 Ga0265320_10041110 3300031240 Bacteria 2300
140 Ga0265320_10088176 3300031240 Bacteria 1439
141 Ga0265325_10003462 3300031241 Bacteria 10296
142 Ga0265329_10001827 3300031242 Bacteria 10112
143 Ga0265329_10033596 3300031242 Bacteria 1659
144 Ga0265340_10001426 3300031247 Bacteria 13719
145 Ga0265340_10012549 3300031247 Bacteria 4473
146 Ga0265339_10051547 3300031249 Bacteria 2245
147 Ga0265339_10089548 3300031249 Bacteria 1615
148 Ga0265327_10001087 3300031251 Bacteria 37858
149 Ga0265327_10014849 3300031251 Bacteria 5071
150 Ga0265327_10032232 3300031251 Bacteria 2935
151 Ga0265327_10059790 3300031251 Bacteria 1950
152 Ga0265327_10073689 3300031251 Bacteria 1703
153 Ga0265316_10008489 3300031344 Bacteria 9524
154 Ga0265316_10043092 3300031344 Bacteria 3601
155 Ga0265313_10000877 3300031595 Bacteria 30400
156 Ga0265313_10003469 3300031595 Bacteria 12730
157 Ga0265314_10000876 3300031711 Bacteria 35825
158 Ga0265314_10004014 3300031711 Bacteria 13914
159 Ga0307405_10040575 3300031731 Bacteria 2820
160 Ga0307412_10132300 3300031911 Bacteria 1814
161 Ga0307409_100459447 3300031995 Bacteria 1231
162 Ga0307411_10093975 3300032005 Bacteria 2101
163 Ga0373930_0005602 3300034816 Bacteria 2094
164 Ga0373928_0001431 3300035084 Bacteria 4628
165 Ga0373929_0000788 3300035085 Bacteria 6170
166 Ga0373944_0000150 3300035089 Bacteria 13698
167 Ga0373949_0002913 3300035090 Bacteria 4220
168 Ga0373932_0000005 3300035112 Bacteria 259528
169 Ga0373954_0001547 3300035118 Bacteria 9376
170 Ga0373954_0028343 3300035118 Bacteria 2575
171 Ga0373955_0095145 3300035172 Bacteria 1703
172 Ga0373962_0006398 3300035242 Bacteria 2853
173 Ga0316574_0095973 3300035398 Bacteria 1895
174 Ga0373924_0031518 3300035410 Bacteria 2132
175 Ga0373931_0000016 3300035691 Bacteria 217932
176 Ga0373935_0001894 3300035692 Bacteria 11754
177 Ga0373927_0012449 3300035695 Bacteria 5665
178 Ga0373927_0087338 3300035695 Bacteria 2024
179 Ga0373933_0217265 3300035724 Bacteria 1226
180 Ga0373947_0033439 3300035725 Bacteria 3036
181 Ga0373947_0066145 3300035725 Bacteria 2206
182 Ga0373937_0005902 3300036401 Bacteria 10535
183 Ga0373937_0132812 3300036401 Bacteria 2326
184 Ga0373925_0000485 3300037068 Bacteria 39875
185 Ga0373925_0000755 3300037068 Bacteria 29746
186 Ga0395905_0040227 3300037471 Bacteria 4385
187 Ga0453684_0001344 3300044712 Bacteria 72038
188 Ga0453684_0009067 3300044712 Bacteria 17552
189 Ga0453684_0034932 3300044712 Bacteria 6962
190 Ga0451576_0007854 3300045051 Bacteria 12644
191 Ga0451576_0020725 3300045051 Bacteria 7156
192 Ga0451576_0072396 3300045051 Bacteria 3587
193 Ga0451576_0109325 3300045051 Bacteria 2877
194 Ga0451576_0471222 3300045051 Bacteria 1319
195 Ga0495592_0015043 3300046454 Bacteria 5876
196 Ga0495629_0038836 3300046459 Bacteria 3353
197 Ga0495629_0080675 3300046459 Bacteria 2271
198 Ga0495641_0014158 3300046461 Bacteria 4329
199 Ga0495651_0141003 3300046462 Bacteria 1748
200 Ga0495639_0023414 3300046475 Unclassified 2714
201 Ga0495664_0017364 3300046477 Bacteria 4113
202 Ga0495608_0183606 3300046511 Unclassified 1323
203 Ga0495618_0003763 3300046514 Bacteria 9388
204 Ga0495618_0152814 3300046514 Unclassified 1474
205 Ga0495628_0001641 3300046516 Bacteria 20495
206 Ga0495630_0000067 3300046517 Bacteria 84296
207 Ga0495630_0082273 3300046517 Bacteria 2430
208 Ga0495630_0267356 3300046517 Bacteria 1306
209 Ga0495666_0069717 3300046526 Bacteria 1672
210 Ga0495640_0091684 3300046533 Bacteria 2005
211 Ga0495640_0172877 3300046533 Bacteria 1380
212 Ga0495586_0000028 3300046535 Bacteria 97992
213 Ga0495586_0001216 3300046535 Bacteria 14461
214 Ga0495586_0001372 3300046535 Bacteria 13525
215 Ga0495586_0055302 3300046535 Bacteria 2151
216 Ga0495645_0032056 3300046543 Bacteria 3832
217 Ga0495645_0048474 3300046543 Bacteria 3094
218 Ga0495667_0017584 3300046559 Bacteria 4830
219 Ga0495667_0071966 3300046559 Bacteria 2254
220 Ga0495634_0001403 3300046642 Bacteria 21595
221 Ga0495634_0011396 3300046642 Bacteria 6477
222 Ga0495634_0024799 3300046642 Bacteria 4204
223 Ga0495634_0045242 3300046642 Bacteria 2977
224 Ga0495635_0080580 3300046663 Bacteria 2228
225 Ga0495635_0124757 3300046663 Bacteria 1756
226 Ga0495657_0065809 3300046675 Bacteria 2383
227 Ga0495658_0001793 3300046683 Bacteria 11053
228 Ga0495658_0019174 3300046683 Bacteria 3567
229 Ga0495613_0002117 3300046689 Bacteria 15066
230 Ga0495613_0029389 3300046689 Bacteria 4086
231 Ga0495624_0075665 3300046690 Bacteria 2090
232 Ga0495581_0115767 3300047315 Bacteria 1559
233 Ga0495674_0003427 3300047319 Bacteria 15412
234 Ga0495674_0003764 3300047319 Bacteria 14750
235 Ga0495674_0025890 3300047319 Bacteria 5370
236 Ga0495676_0148036 3300047321 Unclassified 1674
237 Ga0495680_0087714 3300047322 Bacteria 2340
238 Ga0495680_0294511 3300047322 Bacteria 1141
239 Ga0495675_0061542 3300047444 Bacteria 2378
240 Ga0495675_0117316 3300047444 Bacteria 1659
241 Ga0495684_0026237 3300047471 Bacteria 4477
242 Ga0495684_0088517 3300047471 Bacteria 2347
243 Ga0496115_0023021 3300048918 Bacteria 4832
244 Ga0501031_0000039 3300049568 Bacteria 72794
245 Ga0501032_0008417 3300049569 Bacteria 7525
246 Ga0501032_0124366 3300049569 Bacteria 1704
247 Ga0501033_0002435 3300049570 Bacteria 15815
248 Ga0501033_0073865 3300049570 Bacteria 2504
249 Ga0501036_0313083 3300049572 Unclassified 1312
250 Ga0501037_0027628 3300049573 Bacteria 4193
251 Ga0501047_0049837 3300049581 Bacteria 4043
252 Ga0501080_0449018 3300049742 Bacteria 1156
253 Ga0501035_0121800 3300049822 Bacteria 2279
254 Ga0501044_0000133 3300049823 Bacteria 91116
255 Ga0501044_0006544 3300049823 Bacteria 12860
256 Ga0501044_0153247 3300049823 Bacteria 2286
257 nmdc:mga05p37_268489_c1 3300050507 Bacteria 2039
258 nmdc:mga06r32_143904_c1 3300050510 Bacteria 2361
259 nmdc:mga06r32_53546_c1 3300050510 Bacteria 3866
260 nmdc:mga08y16_205728_c1 3300050511 Bacteria 2039
261 nmdc:mga08y16_582964_c1 3300050511 Unclassified 1129
262 Ga0500650_0057876 3300053098 Bacteria 1807
263 Ga0500636_0039931 3300053177 Bacteria 2776
264 Ga0265316_10008949
265 rootH2_10065111
266 Ga0070690_100037154
267 Ga0070670_100096066
268 Ga0070689_100185828
269 Ga0070688_100042330
270 Ga0070688_100096672
271 Ga0070714_100034963
272 Ga0070701_10024663
273 Ga0070705_100142512
274 Ga0070705_100159473
275 Ga0070694_100040247
276 Ga0070679_100350255
277 Ga0070684_100121972
278 Ga0070686_100004430
279 Ga0070686_100092338
280 Ga0068855_100059320
281 Ga0068855_100259558
282 Ga0068857_100000613
283 Ga0068856_100003974
284 Ga0068856_100006046
285 Ga0068859_100054796
286 Ga0068859_100093376
287 Ga0068859_100329882
288 Ga0068864_100052269
289 Ga0068864_100129685
290 Ga0068863_100049477
291 Ga0068863_100058805
292 Ga0070715_10166800
293 Ga0097621_100267916
294 Ga0068871_100006917
295 Ga0075428_100000842
296 Ga0075431_100261180
297 Ga0068865_100147376
298 Ga0097620_100054796
299 Ga0097620_100093378
300 Ga0097620_100329878
301 Ga0075435_100312422
302 Ga0105240_10008477
303 Ga0105240_10024256
304 Ga0105240_10071787
305 Ga0105240_10145973
306 Ga0105240_10225163
307 Ga0105240_10304413
308 Ga0111539_10012838
309 Ga0111539_10072559
310 Ga0111539_10107455
311 Ga0111539_10151841
312 Ga0111539_10338495
313 Ga0105242_10027078
314 Ga0105238_10001693
315 Ga0105238_10013489
316 Ga0105238_10173795
317 Ga0105249_10176281
318 Ga0157370_10362834
319 Ga0157374_10305484
320 Ga0157375_10000048
321 Ga0163163_10000146
322 Ga0163163_10200284
323 Ga0157376_10039677
324 Ga0207684_10355685
325 Ga0207654_10120112
326 Ga0207707_10065372
327 Ga0207695_10034017
328 Ga0207695_10059463
329 Ga0207695_10061854
330 Ga0207695_10085212
331 Ga0207663_10015583
332 Ga0207660_10091633
333 Ga0207646_10223754
334 Ga0207664_10030232
335 Ga0207670_10005625
336 Ga0207670_10006119
337 Ga0207667_10023483
338 Ga0207667_10149571
339 Ga0207667_10186011
340 Ga0207712_10300711
341 Ga0207677_10090380
342 Ga0207702_10002801
343 Ga0207702_10007584
344 Ga0207641_10231031
345 Ga0207676_10131599
346 Ga0207674_10003585
347 Ga0207674_10116487
348 Ga0207675_100144000
349 Ga0265337_1000262
350 Ga0265337_1000338
351 Ga0265337_1009534
352 Ga0265337_1018823
353 Ga0265337_1026655
354 Ga0265326_10014579
355 Ga0265319_1000013
356 Ga0265319_1002375
357 Ga0265319_1013157
358 Ga0265319_1034631
359 Ga0265334_10005136
360 Ga0265334_10009566
361 Ga0265334_10062352
362 Ga0265323_10000285
363 Ga0265323_10005625
364 Ga0265323_10008918
365 Ga0265336_10003299
366 Ga0265336_10017939
367 Ga0265338_10000008
368 Ga0265338_10000016
369 Ga0265338_10000269
370 Ga0265338_10000382
371 Ga0265338_10000510
372 Ga0265338_10001031
373 Ga0265338_10001481
374 Ga0265338_10002506
375 Ga0265338_10002567
376 Ga0265338_10003191
377 Ga0265338_10003690
378 Ga0265338_10007207
379 Ga0265338_10026182
380 Ga0265338_10051666
381 Ga0265338_10059372
382 Ga0265338_10066875
383 Ga0265338_10083155
384 Ga0265338_10102512
385 Ga0265338_10106062
386 Ga0265338_10125398
387 Ga0265338_10183012
388 Ga0265338_10205039
389 Ga0265324_10000487
390 Ga0265324_10000543
391 Ga0265324_10012395
392 Ga0265324_10015069
393 Ga0265324_10017512
394 Ga0265324_10043221
395 Ga0265332_10054120
396 Ga0265332_10095324
397 Ga0265320_10000572
398 Ga0265320_10000641
399 Ga0265320_10008027
400 Ga0265320_10019766
401 Ga0265320_10029521
402 Ga0265320_10041110
403 Ga0265320_10088176
404 Ga0265325_10003462
405 Ga0265329_10001827
406 Ga0265329_10033596
407 Ga0265340_10001426
408 Ga0265340_10012549
409 Ga0265339_10051547
410 Ga0265339_10089548
411 Ga0265327_10001087
412 Ga0265327_10014849
413 Ga0265327_10032232
414 Ga0265327_10059790
415 Ga0265327_10073689
416 Ga0265316_10008489
417 Ga0265316_10043092
418 Ga0265313_10000877
419 Ga0265313_10003469
420 Ga0265314_10000876
421 Ga0265314_10004014
422 Ga0307405_10040575
423 Ga0307412_10132300
424 Ga0307409_100459447
425 Ga0307411_10093975
426 Ga0373930_0005602
427 Ga0373928_0001431
428 Ga0373929_0000788
429 Ga0373944_0000150
430 Ga0373949_0002913
431 Ga0373932_0000005
432 Ga0373954_0001547
433 Ga0373954_0028343
434 Ga0373955_0095145
435 Ga0373962_0006398
436 Ga0316574_0095973
437 Ga0373924_0031518
438 Ga0373931_0000016
439 Ga0373935_0001894
440 Ga0373927_0012449
441 Ga0373927_0087338
442 Ga0373933_0217265
443 Ga0373947_0033439
444 Ga0373947_0066145
445 Ga0373937_0005902
446 Ga0373937_0132812
447 Ga0373925_0000485
448 Ga0373925_0000755
449 Ga0395905_0040227
450 Ga0453684_0001344
451 Ga0453684_0009067
452 Ga0453684_0034932
453 Ga0451576_0007854
454 Ga0451576_0020725
455 Ga0451576_0072396
456 Ga0451576_0109325
457 Ga0451576_0471222
458 Ga0495592_0015043
459 Ga0495629_0038836
460 Ga0495629_0080675
461 Ga0495641_0014158
462 Ga0495651_0141003
463 Ga0495639_0023414
464 Ga0495664_0017364
465 Ga0495608_0183606
466 Ga0495618_0003763
467 Ga0495618_0152814
468 Ga0495628_0001641
469 Ga0495630_0000067
470 Ga0495630_0082273
471 Ga0495630_0267356
472 Ga0495666_0069717
473 Ga0495640_0091684
474 Ga0495640_0172877
475 Ga0495586_0000028
476 Ga0495586_0001216
477 Ga0495586_0001372
478 Ga0495586_0055302
479 Ga0495645_0032056
480 Ga0495645_0048474
481 Ga0495667_0017584
482 Ga0495667_0071966
483 Ga0495634_0001403
484 Ga0495634_0011396
485 Ga0495634_0024799
486 Ga0495634_0045242
487 Ga0495635_0080580
488 Ga0495635_0124757
489 Ga0495657_0065809
490 Ga0495658_0001793
491 Ga0495658_0019174
492 Ga0495613_0002117
493 Ga0495613_0029389
494 Ga0495624_0075665
495 Ga0495581_0115767
496 Ga0495674_0003427
497 Ga0495674_0003764
498 Ga0495674_0025890
499 Ga0495676_0148036
500 Ga0495680_0087714
501 Ga0495680_0294511
502 Ga0495675_0061542
503 Ga0495675_0117316
504 Ga0495684_0026237
505 Ga0495684_0088517
506 Ga0496115_0023021
507 Ga0501031_0000039
508 Ga0501032_0008417
509 Ga0501032_0124366
510 Ga0501033_0002435
511 Ga0501033_0073865
512 Ga0501036_0313083
513 Ga0501037_0027628
514 Ga0501047_0049837
515 Ga0501080_0449018
516 Ga0501035_0121800
517 Ga0501044_0000133
518 Ga0501044_0006544
519 Ga0501044_0153247
520 nmdc:mga05p37_268489_c1
521 nmdc:mga06r32_143904_c1
522 nmdc:mga06r32_53546_c1
523 nmdc:mga08y16_205728_c1
524 nmdc:mga08y16_582964_c1
525 Ga0500650_0057876
526 Ga0500636_0039931

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00069

Pkinase

Protein kinase domain

64

335

0.9

PF07714

PK_Tyr_Ser-Thr

Protein tyrosine and serine/threonine kinase

64

335

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
1o6y-assembly1.cif.gz_A catalytic domain of pknb kinase from mycobacterium tuberculosis 0.9125 11 286
2wqn-assembly1.cif.gz_A structure of adp-bound human nek7 0.8987 12 286
6b2q-assembly2.cif.gz_C dual inhibition of the essential protein kinases a and b in mycobacterium tuberculosis 0.8973 11 295
2fum-assembly1.cif.gz_A catalytic domain of protein kinase pknb from mycobacterium tuberculosis in complex with mitoxantrone 0.8965 11 286
5u94-assembly1.cif.gz_A crystal structure of the mycobacterium tuberculosis pasta kinase pknb in complex with the potential theraputic kinase inhibitor gsk690693. 0.8964 11 286
ID Description Score Start End Superfamily
2fumD02 Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 0.9146 97 286 1.10.510.10
2fumD02 Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 0.8986 97 286 1.10.510.10
af_A0A1D6QCK6_91_175_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.8935 12 95 3.30.200.20
3db8A01 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.8839 10 94 3.30.200.20
4eqmD02 Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 0.883 96 292 1.10.510.10
ID Description Score Start End GO Terms
AF-A0A349J7U7-F1-model_v4 Serine/threonine protein kinase 0.9365 3 103 GO:0004674
GO:0005524
AF-A0A7W0VBB9-F1-model_v4 Protein kinase 0.9187 12 308 GO:0004674
GO:0005524
GO:0016020
AF-A0A7Y5NQ59-F1-model_v4 Protein kinase 0.9149 7 307 GO:0004674
GO:0005524
AF-A0A349J7U7-F1-model_v4 Serine/threonine protein kinase 0.9109 3 103 GO:0004674
GO:0005524
AF-A0A2N2H118-F1-model_v4 Protein kinase domain-containing protein 0.9098 12 308 GO:0004674
GO:0005524

Map