F371944

General Info

Members Datasets Scaffolds Average Seq Length
263 174 526 327

Family's Representative Sequence

Representative Sequence 3300027364|Ga0209967_1006397|Ga0209967_10063972
Length 370
Sequence MAVKVGINGFGRIGRNIMRAALGDGEIDFVAVNDLTSTATLAHLFKYDSILGNLHADVRAAGDSITVDGDSFKVLSIKDPAQLPWKDLGVEVVFEGTGLFTDRDAAAKHLAAGAKKVIITAPGKKPDLMTVMGVNNQTYDPAKHHIISNASCTTNCLAPFAKVLHESFRIVHGWMTTIHSYTNDQNLLDLPHKDLRRARAAALSMIPTTTGAATAVGQVLPDLKGKLDGIAIRVPTPNVSLVDLAAVVEKTTTKDEVNAAYQSLCVLMLPYAARGELRLGMGTHDTALIERVAAHAAGVGIAMVVPGSNGIAMFLGAAIAEGNAKTAQSLLDGTVGQIDKAAKKGVIHDNAAARYKSRLTRKVRSLAAAK

Samples

Sample ID Description Type Environment
1 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
41 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
42 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
43 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
44 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
45 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
46 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
47 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
48 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
61 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
62 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
63 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
97 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
101 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
102 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
103 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
104 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
105 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
106 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
107 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
108 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
109 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
110 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
111 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
112 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
113 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
114 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
115 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
116 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
117 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
118 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
119 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
120 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
121 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
122 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
123 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
124 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
125 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
126 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
127 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
128 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
129 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
130 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
131 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
132 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
133 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
134 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
135 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
136 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
137 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
138 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
139 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
140 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
141 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
142 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
143 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
144 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
145 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
146 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
152 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
153 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
154 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
155 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
156 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
157 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
158 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
160 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
161 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
162 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
163 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
164 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
165 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
166 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
167 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
168 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
169 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
170 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
171 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
172 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
173 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
174 3006969106 Bacillus sp. FJAT-50079 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.86
Metatranscriptomes 0.76
Isolates 0.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.14
Nodule 0
Rhizoplane 0.38
Rhizosphere 97.72
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0209967_1006397 3300027364 Bacteria 1598
2 Ga0065714_10078409 3300005288 Bacteria 2600
3 Ga0065712_10000323 3300005290 Bacteria 14921
4 Ga0065712_10007420 3300005290 Bacteria 4242
5 Ga0065712_10097926 3300005290 Bacteria 2135
6 Ga0065712_10115271 3300005290 Bacteria 1734
7 Ga0065715_10006910 3300005293 Bacteria 2777
8 Ga0065715_10035853 3300005293 Bacteria 1601
9 Ga0065715_10106464 3300005293 Bacteria 2828
10 Ga0065707_10014735 3300005295 Bacteria 2950
11 Ga0070670_100009177 3300005331 Bacteria 8455
12 Ga0070670_100040869 3300005331 Bacteria 3985
13 Ga0070670_100133641 3300005331 Bacteria 2143
14 Ga0070677_10023855 3300005333 Bacteria 2269
15 Ga0068869_100013748 3300005334 Bacteria 5391
16 Ga0070666_10159647 3300005335 Bacteria 1575
17 Ga0070687_100014123 3300005343 Bacteria 3580
18 Ga0070669_100057629 3300005353 Bacteria 2850
19 Ga0070669_100208503 3300005353 Bacteria 1540
20 Ga0070675_100044630 3300005354 Bacteria 3624
21 Ga0070675_100149554 3300005354 Bacteria 2001
22 Ga0070671_100083793 3300005355 Bacteria 2666
23 Ga0070674_100086428 3300005356 Bacteria 2253
24 Ga0070673_100021965 3300005364 Bacteria 4638
25 Ga0070673_100068886 3300005364 Bacteria 2834
26 Ga0070688_100002252 3300005365 Bacteria 9736
27 Ga0070659_100121898 3300005366 Bacteria 2113
28 Ga0070709_10094109 3300005434 Bacteria 1982
29 Ga0070711_100264429 3300005439 Bacteria 1355
30 Ga0070700_100039490 3300005441 Bacteria 2883
31 Ga0070694_100006691 3300005444 Bacteria 7000
32 Ga0070708_100036347 3300005445 Bacteria 4296
33 Ga0068867_100089018 3300005459 Bacteria 2340
34 Ga0068867_100219370 3300005459 Bacteria 1532
35 Ga0070707_100001725 3300005468 Bacteria 21065
36 Ga0070707_100087924 3300005468 Bacteria 3006
37 Ga0070698_100097305 3300005471 Bacteria 2919
38 Ga0070698_100210785 3300005471 Bacteria 1877
39 Ga0070699_100033137 3300005518 Bacteria 4462
40 Ga0070699_100390729 3300005518 Bacteria 1257
41 Ga0070679_100001140 3300005530 Bacteria 23233
42 Ga0070672_100033246 3300005543 Bacteria 3904
43 Ga0070672_100056295 3300005543 Bacteria 3083
44 Ga0070672_100332337 3300005543 Bacteria 1293
45 Ga0070686_100038171 3300005544 Bacteria 2984
46 Ga0070686_100043563 3300005544 Bacteria 2816
47 Ga0070693_100081922 3300005547 Bacteria 1926
48 Ga0070704_100027870 3300005549 Bacteria 3752
49 Ga0070704_100062322 3300005549 Bacteria 2672
50 Ga0070664_100009500 3300005564 Bacteria 7886
51 Ga0068854_100082573 3300005578 Bacteria 2375
52 Ga0070702_100038951 3300005615 Bacteria 2650
53 Ga0068859_100167488 3300005617 Bacteria 2277
54 Ga0068859_100243277 3300005617 Bacteria 1889
55 Ga0068864_100017940 3300005618 Bacteria 5905
56 Ga0068864_100300843 3300005618 Bacteria 1502
57 Ga0068858_100005505 3300005842 Bacteria 12398
58 Ga0068860_100067922 3300005843 Bacteria 3386
59 Ga0068862_100260533 3300005844 Bacteria 1583
60 Ga0081455_10025985 3300005937 Bacteria 5395
61 Ga0070717_10034261 3300006028 Bacteria 4104
62 Ga0075364_10039090 3300006051 Bacteria 3074
63 Ga0075432_10029236 3300006058 Bacteria 1902
64 Ga0075428_100037571 3300006844 Bacteria 5330
65 Ga0075430_100012425 3300006846 Bacteria 7244
66 Ga0075430_100042827 3300006846 Bacteria 3828
67 Ga0075433_10041676 3300006852 Bacteria 3979
68 Ga0075433_10066018 3300006852 Bacteria 3174
69 Ga0075433_10079995 3300006852 Bacteria 2880
70 Ga0075433_10124552 3300006852 Bacteria 2289
71 Ga0075434_100016570 3300006871 Bacteria 7086
72 Ga0075434_100114589 3300006871 Bacteria 2709
73 Ga0075434_100138231 3300006871 Bacteria 2456
74 Ga0075434_100147901 3300006871 Bacteria 2369
75 Ga0075434_100159001 3300006871 Bacteria 2279
76 Ga0075434_100311885 3300006871 Bacteria 1593
77 Ga0075429_100055717 3300006880 Bacteria 3440
78 Ga0068865_100106682 3300006881 Bacteria 2059
79 Ga0075436_100003507 3300006914 Bacteria 10754
80 Ga0097620_100167488 3300006931 Bacteria 2277
81 Ga0097620_100243257 3300006931 Bacteria 1889
82 Ga0075435_100000569 3300007076 Bacteria 22675
83 Ga0075435_100006343 3300007076 Bacteria 8356
84 Ga0075435_100007710 3300007076 Bacteria 7694
85 Ga0075435_100017869 3300007076 Bacteria 5375
86 Ga0075435_100331708 3300007076 Bacteria 1303
87 Ga0111539_10003958 3300009094 Bacteria 19463
88 Ga0111539_10004760 3300009094 Bacteria 17717
89 Ga0111539_10010949 3300009094 Bacteria 11415
90 Ga0111539_10295943 3300009094 Bacteria 1884
91 Ga0111539_10359366 3300009094 Bacteria 1695
92 Ga0111539_10623056 3300009094 Bacteria 1256
93 Ga0105245_10041387 3300009098 Bacteria 4107
94 Ga0105247_10012167 3300009101 Bacteria 5173
95 Ga0114129_10011729 3300009147 Bacteria 12471
96 Ga0114129_10014871 3300009147 Bacteria 11087
97 Ga0114129_10023072 3300009147 Bacteria 8828
98 Ga0114129_10043470 3300009147 Bacteria 6321
99 Ga0114129_10052581 3300009147 Bacteria 5717
100 Ga0114129_10062829 3300009147 Bacteria 5187
101 Ga0114129_10063432 3300009147 Bacteria 5159
102 Ga0114129_10269237 3300009147 Bacteria 2280
103 Ga0105243_10052005 3300009148 Bacteria 3243
104 Ga0105239_10037399 3300010375 Bacteria 5322
105 Ga0157375_10101915 3300013308 Bacteria 2955
106 Ga0157375_10534423 3300013308 Bacteria 1335
107 Ga0163163_10055039 3300014325 Bacteria 3932
108 Ga0163163_10115821 3300014325 Bacteria 2711
109 Ga0163163_10181894 3300014325 Bacteria 2149
110 Ga0163161_10006174 3300017792 Bacteria 8300
111 Ga0209233_1006389 3300025261 Bacteria 3805
112 Ga0207697_10044550 3300025315 Bacteria 1826
113 Ga0207682_10020962 3300025893 Bacteria 2570
114 Ga0207680_10146750 3300025903 Bacteria 1569
115 Ga0207645_10011952 3300025907 Bacteria 5906
116 Ga0207643_10017640 3300025908 Bacteria 3905
117 Ga0207643_10063712 3300025908 Bacteria 2109
118 Ga0207684_10129317 3300025910 Bacteria 2167
119 Ga0207707_10272511 3300025912 Bacteria 1467
120 Ga0207663_10168629 3300025916 Bacteria 1553
121 Ga0207662_10002158 3300025918 Bacteria 9803
122 Ga0207662_10007267 3300025918 Bacteria 6020
123 Ga0207652_10001901 3300025921 Bacteria 18089
124 Ga0207646_10000005 3300025922 Bacteria 523896
125 Ga0207646_10000094 3300025922 Bacteria 119406
126 Ga0207681_10059961 3300025923 Bacteria 2610
127 Ga0207650_10010274 3300025925 Bacteria 6417
128 Ga0207659_10015705 3300025926 Bacteria 4915
129 Ga0207690_10131790 3300025932 Bacteria 1830
130 Ga0207706_10136995 3300025933 Bacteria 2154
131 Ga0207669_10121685 3300025937 Bacteria 1773
132 Ga0207704_10046009 3300025938 Bacteria 2597
133 Ga0207691_10041719 3300025940 Bacteria 4235
134 Ga0207689_10014135 3300025942 Bacteria 6793
135 Ga0207679_10007122 3300025945 Bacteria 7086
136 Ga0207679_10057768 3300025945 Bacteria 2871
137 Ga0207651_10000958 3300025960 Bacteria 12747
138 Ga0207651_10006634 3300025960 Bacteria 6084
139 Ga0207658_10262174 3300025986 Bacteria 1473
140 Ga0207703_10256064 3300026035 Bacteria 1580
141 Ga0207678_10094726 3300026067 Bacteria 2551
142 Ga0207708_10044151 3300026075 Bacteria 3396
143 Ga0207708_10180234 3300026075 Bacteria 1677
144 Ga0207641_10261403 3300026088 Bacteria 1621
145 Ga0207648_10101891 3300026089 Bacteria 2516
146 Ga0207676_10030742 3300026095 Bacteria 4034
147 Ga0207676_10404105 3300026095 Bacteria 1277
148 Ga0207674_10015147 3300026116 Bacteria 8485
149 Ga0207675_100182058 3300026118 Bacteria 2012
150 Ga0207683_10061088 3300026121 Bacteria 3315
151 Ga0209998_10019147 3300027717 Bacteria 1457
152 Ga0207428_10000751 3300027907 Bacteria 37099
153 Ga0268266_10224427 3300028379 Bacteria 1728
154 Ga0268265_10104850 3300028380 Bacteria 2293
155 Ga0268264_10110084 3300028381 Bacteria 2411
156 Ga0268264_10166181 3300028381 Bacteria 1992
157 Ga0265338_10006160 3300028800 Bacteria 15388
158 Ga0265760_10037131 3300031090 Bacteria 1446
159 Ga0265320_10107051 3300031240 Bacteria 1284
160 Ga0265325_10003342 3300031241 Bacteria 10528
161 Ga0265316_10158750 3300031344 Bacteria 1691
162 Ga0307408_100018432 3300031548 Bacteria 4686
163 Ga0316579_10001011 3300031691 Bacteria 9887
164 Ga0316578_10151150 3300031728 Bacteria 1398
165 Ga0307405_10015827 3300031731 Bacteria 4095
166 Ga0316577_10031676 3300031733 Bacteria 2954
167 Ga0307413_10043591 3300031824 Bacteria 2645
168 Ga0307410_10140813 3300031852 Bacteria 1784
169 Ga0307410_10387504 3300031852 Bacteria 1126
170 Ga0307406_10018854 3300031901 Bacteria 4040
171 Ga0307407_10041634 3300031903 Bacteria 2570
172 Ga0307407_10106094 3300031903 Bacteria 1754
173 Ga0307412_10054414 3300031911 Bacteria 2657
174 Ga0307409_100013075 3300031995 Bacteria 5322
175 Ga0307409_100549801 3300031995 Bacteria 1133
176 Ga0307416_100019729 3300032002 Bacteria 4788
177 Ga0307416_100020579 3300032002 Bacteria 4712
178 Ga0307416_100034332 3300032002 Bacteria 3859
179 Ga0307416_100184855 3300032002 Bacteria 1958
180 Ga0307416_100218020 3300032002 Bacteria 1827
181 Ga0307411_10009084 3300032005 Bacteria 5202
182 Ga0307415_100036047 3300032126 Bacteria 3238
183 Ga0316583_10008383 3300032133 Bacteria 3729
184 Ga0316585_10001311 3300032137 Bacteria 6528
185 Ga0316580_10000762 3300032139 Bacteria 7827
186 Ga0316588_1000621 3300033528 Bacteria 5080
187 Ga0373951_0023878 3300035091 Bacteria 1414
188 Ga0373962_0011744 3300035242 Bacteria 2198
189 Ga0316574_0105076 3300035398 Bacteria 1808
190 Ga0373933_0000935 3300035724 Bacteria 17819
191 Ga0373933_0025443 3300035724 Bacteria 3395
192 Ga0373937_0000048 3300036401 Bacteria 106296
193 Ga0373937_0002653 3300036401 Bacteria 14905
194 Ga0316584_0106283 3300036712 Bacteria 2100
195 Ga0373925_0002373 3300037068 Bacteria 15107
196 Ga0395905_0037418 3300037471 Bacteria 4556
197 Ga0436364_1037995 3300037853 Bacteria 6633
198 Ga0436365_1779329 3300039437 Bacteria 1460
199 Ga0439453_0002059 3300041408 Bacteria 2716
200 Ga0450896_003053 3300042133 Bacteria 2202
201 Ga0450900_012044 3300042136 Bacteria 1130
202 Ga0439464_0026893 3300042439 Bacteria 1598
203 Ga0439464_0027557 3300042439 Bacteria 1580
204 Ga0466967_0207461 3300045976 Bacteria 1858
205 Ga0466967_0479399 3300045976 Bacteria 1219
206 Ga0495584_0059089 3300046491 Bacteria 1929
207 Ga0495598_0006597 3300046537 Bacteria 2628
208 Ga0495634_0158748 3300046642 Bacteria 1427
209 Ga0495634_0224958 3300046642 Bacteria 1156
210 Ga0495646_0168620 3300046680 Bacteria 1208
211 Ga0495674_0206899 3300047319 Bacteria 1627
212 Ga0495675_0015814 3300047444 Bacteria 4772
213 Ga0495602_0002854 3300048088 Bacteria 17704
214 Ga0496102_0188489 3300048905 Bacteria 1944
215 Ga0501034_0010887 3300049571 Bacteria 9448
216 Ga0501039_0276861 3300049575 Bacteria 1319
217 Ga0501040_0271949 3300049576 Bacteria 1210
218 Ga0501041_0236249 3300049577 Bacteria 1148
219 Ga0501047_0004990 3300049581 Bacteria 12456
220 Ga0501067_0098486 3300049583 Bacteria 1624
221 Ga0501072_0006143 3300049588 Bacteria 9157
222 Ga0501073_0158983 3300049589 Bacteria 1566
223 Ga0501076_0049907 3300049592 Bacteria 3310
224 Ga0501077_0038857 3300049593 Bacteria 3031
225 Ga0501081_0130740 3300049743 Bacteria 1794
226 Ga0501083_0224094 3300049744 Bacteria 1225
227 Ga0501044_0003961 3300049823 Bacteria 16585
228 Ga0501045_0014316 3300049824 Bacteria 5620
229 nmdc:mga05p37_146219_c1 3300050507 Bacteria 2894
230 nmdc:mga05p37_166689_c1 3300050507 Bacteria 2688
231 nmdc:mga05p37_232079_c1 3300050507 Bacteria 2223
232 nmdc:mga05p37_23684_c1 3300050507 Bacteria 7454
233 nmdc:mga05p37_282114_c1 3300050507 Bacteria 1980
234 nmdc:mga05p37_31179_c1 3300050507 Bacteria 6511
235 nmdc:mga05p37_41767_c1 3300050507 Bacteria 5631
236 nmdc:mga05p37_478059_c1 3300050507 Bacteria 1436
237 nmdc:mga05p37_87015_c1 3300050507 Bacteria 3851
238 nmdc:mga09592_93254_c1 3300050508 Bacteria 2575
239 nmdc:mga0qj67_14709_c1 3300050509 Bacteria 5917
240 nmdc:mga06r32_68478_c1 3300050510 Bacteria 3429
241 nmdc:mga08y16_327225_c1 3300050511 Bacteria 1577
242 nmdc:mga08y16_341281_c1 3300050511 Bacteria 1540
243 nmdc:mga08y16_5651_c1 3300050511 Bacteria 13102
244 nmdc:mga0n895_36605_c1 3300050512 Bacteria 4740
245 nmdc:mga0n895_428885_c1 3300050512 Bacteria 1336
246 nmdc:mga0rr50_181285_c1 3300050513 Bacteria 1722
247 nmdc:mga0rr50_21314_c1 3300050513 Bacteria 4421
248 nmdc:mga0rr50_7916_c1 3300050513 Bacteria 6593
249 nmdc:mga0rr50_8864_c1 3300050513 Bacteria 6283
250 nmdc:mga0rr50_91029_c1 3300050513 Bacteria 2375
251 nmdc:mga08x19_13845_c2 3300050514 Bacteria 4456
252 nmdc:mga0a205_121861_c1 3300050515 Bacteria 2507
253 nmdc:mga0a205_12273_c1 3300050515 Bacteria 7925
254 nmdc:mga0a205_32931_c1 3300050515 Bacteria 4970
255 nmdc:mga0a205_8057_c1 3300050515 Bacteria 7677
256 Ga0495601_0170600 3300053077 Bacteria 1422
257 Ga0495601_0200455 3300053077 Bacteria 1304
258 Ga0500556_0006025 3300053104 Bacteria 3436
259 Ga0501084_0067395 3300054114 Bacteria 2996
260 Ga0501082_0082701 3300060353 Bacteria 2770
261 Ga0501082_0174470 3300060353 Bacteria 1869
262 Ga0530510_0038382 3300061734 Bacteria 3458
263 3006971491 3006969106 Bacteria 4739423
264 Ga0209967_1006397
265 Ga0065714_10078409
266 Ga0065712_10000323
267 Ga0065712_10007420
268 Ga0065712_10097926
269 Ga0065712_10115271
270 Ga0065715_10006910
271 Ga0065715_10035853
272 Ga0065715_10106464
273 Ga0065707_10014735
274 Ga0070670_100009177
275 Ga0070670_100040869
276 Ga0070670_100133641
277 Ga0070677_10023855
278 Ga0068869_100013748
279 Ga0070666_10159647
280 Ga0070687_100014123
281 Ga0070669_100057629
282 Ga0070669_100208503
283 Ga0070675_100044630
284 Ga0070675_100149554
285 Ga0070671_100083793
286 Ga0070674_100086428
287 Ga0070673_100021965
288 Ga0070673_100068886
289 Ga0070688_100002252
290 Ga0070659_100121898
291 Ga0070709_10094109
292 Ga0070711_100264429
293 Ga0070700_100039490
294 Ga0070694_100006691
295 Ga0070708_100036347
296 Ga0068867_100089018
297 Ga0068867_100219370
298 Ga0070707_100001725
299 Ga0070707_100087924
300 Ga0070698_100097305
301 Ga0070698_100210785
302 Ga0070699_100033137
303 Ga0070699_100390729
304 Ga0070679_100001140
305 Ga0070672_100033246
306 Ga0070672_100056295
307 Ga0070672_100332337
308 Ga0070686_100038171
309 Ga0070686_100043563
310 Ga0070693_100081922
311 Ga0070704_100027870
312 Ga0070704_100062322
313 Ga0070664_100009500
314 Ga0068854_100082573
315 Ga0070702_100038951
316 Ga0068859_100167488
317 Ga0068859_100243277
318 Ga0068864_100017940
319 Ga0068864_100300843
320 Ga0068858_100005505
321 Ga0068860_100067922
322 Ga0068862_100260533
323 Ga0081455_10025985
324 Ga0070717_10034261
325 Ga0075364_10039090
326 Ga0075432_10029236
327 Ga0075428_100037571
328 Ga0075430_100012425
329 Ga0075430_100042827
330 Ga0075433_10041676
331 Ga0075433_10066018
332 Ga0075433_10079995
333 Ga0075433_10124552
334 Ga0075434_100016570
335 Ga0075434_100114589
336 Ga0075434_100138231
337 Ga0075434_100147901
338 Ga0075434_100159001
339 Ga0075434_100311885
340 Ga0075429_100055717
341 Ga0068865_100106682
342 Ga0075436_100003507
343 Ga0097620_100167488
344 Ga0097620_100243257
345 Ga0075435_100000569
346 Ga0075435_100006343
347 Ga0075435_100007710
348 Ga0075435_100017869
349 Ga0075435_100331708
350 Ga0111539_10003958
351 Ga0111539_10004760
352 Ga0111539_10010949
353 Ga0111539_10295943
354 Ga0111539_10359366
355 Ga0111539_10623056
356 Ga0105245_10041387
357 Ga0105247_10012167
358 Ga0114129_10011729
359 Ga0114129_10014871
360 Ga0114129_10023072
361 Ga0114129_10043470
362 Ga0114129_10052581
363 Ga0114129_10062829
364 Ga0114129_10063432
365 Ga0114129_10269237
366 Ga0105243_10052005
367 Ga0105239_10037399
368 Ga0157375_10101915
369 Ga0157375_10534423
370 Ga0163163_10055039
371 Ga0163163_10115821
372 Ga0163163_10181894
373 Ga0163161_10006174
374 Ga0209233_1006389
375 Ga0207697_10044550
376 Ga0207682_10020962
377 Ga0207680_10146750
378 Ga0207645_10011952
379 Ga0207643_10017640
380 Ga0207643_10063712
381 Ga0207684_10129317
382 Ga0207707_10272511
383 Ga0207663_10168629
384 Ga0207662_10002158
385 Ga0207662_10007267
386 Ga0207652_10001901
387 Ga0207646_10000005
388 Ga0207646_10000094
389 Ga0207681_10059961
390 Ga0207650_10010274
391 Ga0207659_10015705
392 Ga0207690_10131790
393 Ga0207706_10136995
394 Ga0207669_10121685
395 Ga0207704_10046009
396 Ga0207691_10041719
397 Ga0207689_10014135
398 Ga0207679_10007122
399 Ga0207679_10057768
400 Ga0207651_10000958
401 Ga0207651_10006634
402 Ga0207658_10262174
403 Ga0207703_10256064
404 Ga0207678_10094726
405 Ga0207708_10044151
406 Ga0207708_10180234
407 Ga0207641_10261403
408 Ga0207648_10101891
409 Ga0207676_10030742
410 Ga0207676_10404105
411 Ga0207674_10015147
412 Ga0207675_100182058
413 Ga0207683_10061088
414 Ga0209998_10019147
415 Ga0207428_10000751
416 Ga0268266_10224427
417 Ga0268265_10104850
418 Ga0268264_10110084
419 Ga0268264_10166181
420 Ga0265338_10006160
421 Ga0265760_10037131
422 Ga0265320_10107051
423 Ga0265325_10003342
424 Ga0265316_10158750
425 Ga0307408_100018432
426 Ga0316579_10001011
427 Ga0316578_10151150
428 Ga0307405_10015827
429 Ga0316577_10031676
430 Ga0307413_10043591
431 Ga0307410_10140813
432 Ga0307410_10387504
433 Ga0307406_10018854
434 Ga0307407_10041634
435 Ga0307407_10106094
436 Ga0307412_10054414
437 Ga0307409_100013075
438 Ga0307409_100549801
439 Ga0307416_100019729
440 Ga0307416_100020579
441 Ga0307416_100034332
442 Ga0307416_100184855
443 Ga0307416_100218020
444 Ga0307411_10009084
445 Ga0307415_100036047
446 Ga0316583_10008383
447 Ga0316585_10001311
448 Ga0316580_10000762
449 Ga0316588_1000621
450 Ga0373951_0023878
451 Ga0373962_0011744
452 Ga0316574_0105076
453 Ga0373933_0000935
454 Ga0373933_0025443
455 Ga0373937_0000048
456 Ga0373937_0002653
457 Ga0316584_0106283
458 Ga0373925_0002373
459 Ga0395905_0037418
460 Ga0436364_1037995
461 Ga0436365_1779329
462 Ga0439453_0002059
463 Ga0450896_003053
464 Ga0450900_012044
465 Ga0439464_0026893
466 Ga0439464_0027557
467 Ga0466967_0207461
468 Ga0466967_0479399
469 Ga0495584_0059089
470 Ga0495598_0006597
471 Ga0495634_0158748
472 Ga0495634_0224958
473 Ga0495646_0168620
474 Ga0495674_0206899
475 Ga0495675_0015814
476 Ga0495602_0002854
477 Ga0496102_0188489
478 Ga0501034_0010887
479 Ga0501039_0276861
480 Ga0501040_0271949
481 Ga0501041_0236249
482 Ga0501047_0004990
483 Ga0501067_0098486
484 Ga0501072_0006143
485 Ga0501073_0158983
486 Ga0501076_0049907
487 Ga0501077_0038857
488 Ga0501081_0130740
489 Ga0501083_0224094
490 Ga0501044_0003961
491 Ga0501045_0014316
492 nmdc:mga05p37_146219_c1
493 nmdc:mga05p37_166689_c1
494 nmdc:mga05p37_232079_c1
495 nmdc:mga05p37_23684_c1
496 nmdc:mga05p37_282114_c1
497 nmdc:mga05p37_31179_c1
498 nmdc:mga05p37_41767_c1
499 nmdc:mga05p37_478059_c1
500 nmdc:mga05p37_87015_c1
501 nmdc:mga09592_93254_c1
502 nmdc:mga0qj67_14709_c1
503 nmdc:mga06r32_68478_c1
504 nmdc:mga08y16_327225_c1
505 nmdc:mga08y16_341281_c1
506 nmdc:mga08y16_5651_c1
507 nmdc:mga0n895_36605_c1
508 nmdc:mga0n895_428885_c1
509 nmdc:mga0rr50_181285_c1
510 nmdc:mga0rr50_21314_c1
511 nmdc:mga0rr50_7916_c1
512 nmdc:mga0rr50_8864_c1
513 nmdc:mga0rr50_91029_c1
514 nmdc:mga08x19_13845_c2
515 nmdc:mga0a205_121861_c1
516 nmdc:mga0a205_12273_c1
517 nmdc:mga0a205_32931_c1
518 nmdc:mga0a205_8057_c1
519 Ga0495601_0170600
520 Ga0495601_0200455
521 Ga0500556_0006025
522 Ga0501084_0067395
523 Ga0501082_0082701
524 Ga0501082_0174470
525 Ga0530510_0038382
526 3006971491

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00044

Gp_dh_N

Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain

3

103

0.99

PF02800

Gp_dh_C

Glyceraldehyde 3-phosphate dehydrogenase, C-terminal domain

157

275

0.97

PF01649

Ribosomal_S20p

Ribosomal protein S20

314

364

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4dib-assembly2.cif.gz_C the crystal structure of glyceraldehyde-3-phosphate dehydrogenase from bacillus anthracis str. sterne 0.9689 3 332
4dib-assembly1.cif.gz_E the crystal structure of glyceraldehyde-3-phosphate dehydrogenase from bacillus anthracis str. sterne 0.9685 3 332
4dib-assembly1.cif.gz_D the crystal structure of glyceraldehyde-3-phosphate dehydrogenase from bacillus anthracis str. sterne 0.9658 3 332
2i5p-assembly1.cif.gz_P crystal structure of glyceraldehyde-3-phosphate dehydrogenase isoform 1 from k. marxianus 0.9653 3 330
1vsu-assembly1.cif.gz_A crystal structure of apo-glyceraldehyde 3-phosphate dehydrogenase from cryptosporidium parvum 0.9649 2 335
ID Description Score Start End Superfamily
af_F1M269_1_75_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9761 79 155 3.40.50.720
af_Q2G032_1_148_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9699 1 149 3.40.50.720
1hdgO01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9689 3 149 3.40.50.720
af_M0RCH4_11_120_3.30.360.10 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9673 202 314 3.30.360.10
af_F1M004_3_96_3.30.360.10 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9658 235 314 3.30.360.10
ID Description Score Start End GO Terms
AF-A5Z1X9-F1-model_v4 Chloroplast glyceraldehyde-3-phosphate dehydrogenase 0.9935 236 317 GO:0016620
AF-A0A239P280-F1-model_v4 Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain 0.9921 77 167 GO:0006096
GO:0016620
GO:0051287
AF-A0A7C3X0N2-F1-model_v4 Type I glyceraldehyde-3-phosphate dehydrogenase 0.9867 1 135 GO:0006096
GO:0016620
GO:0051287
AF-A0A357V737-F1-model_v4 Erythrose-4-phosphate dehydrogenase (EC 1.2.1.12) 0.9857 233 321 GO:0004365
AF-A0A6J7NT40-F1-model_v4 Unannotated protein 0.9843 224 332 GO:0016620

Map