F371937

General Info

Members Datasets Scaffolds Average Seq Length
263 145 526 154

Family's Representative Sequence

Representative Sequence 3300025972|Ga0207668_11311705|Ga0207668_113117051
Length 152
Sequence MPNTYTQLYIQFVFAVKYRAALIQPEWKGMLHQYITGIFQSNKHKMLQINSMPDHIHIFIGMRPHQSISALIQNVKTESSKYIKANNFCKAFAWQEGYGAFSYSKSHADNVIRYIQNQEIHHRKENFLDEYRRLLTAFEINYEEQYIFKDPE

Samples

Sample ID Description Type Environment
1 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
6 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
51 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
79 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
83 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
84 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
85 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
122 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
123 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
124 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
125 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
126 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
127 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
128 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
129 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
130 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
131 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
132 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
133 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
134 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
135 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
136 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
137 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
138 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
139 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
140 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
141 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
142 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
143 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
144 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
145 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.48
Metatranscriptomes 0
Isolates 1.52

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.8
Nodule 0
Rhizoplane 0.76
Rhizosphere 92.78
Stem 0
Stem Tuber 0
Unclassified 15.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207668_11311705 3300025972 Bacteria 652
2 JGI24743J22301_10094705 3300001991 Unclassified 639
3 rootH2_10086569 3300003320 Bacteria 3263
4 rootL2_10061570 3300003322 Bacteria 1337
5 Ga0055536_1000006 3300003781 Bacteria 347733
6 Ga0055530_10003396 3300003791 Bacteria 9087
7 Ga0065712_10001085 3300005290 Bacteria 6936
8 Ga0065715_10127663 3300005293 Bacteria 2082
9 Ga0070658_10282512 3300005327 Bacteria 1413
10 Ga0070676_10493058 3300005328 Unclassified 868
11 Ga0070690_100077065 3300005330 Bacteria 2176
12 Ga0070670_100061375 3300005331 Bacteria 3227
13 Ga0070670_100072310 3300005331 Bacteria 2961
14 Ga0070670_100094262 3300005331 Bacteria 2575
15 Ga0068869_100019868 3300005334 Bacteria 4599
16 Ga0070682_100462260 3300005337 Bacteria 974
17 Ga0068868_100014894 3300005338 Bacteria 5741
18 Ga0068868_100812848 3300005338 Bacteria 844
19 Ga0070689_100026475 3300005340 Bacteria 4367
20 Ga0070687_100083869 3300005343 Bacteria 1746
21 Ga0070661_100217262 3300005344 Unclassified 1465
22 Ga0070661_101315888 3300005344 Bacteria 606
23 Ga0070668_100321946 3300005347 Unclassified 1302
24 Ga0070669_100068982 3300005353 Bacteria 2611
25 Ga0070669_100924050 3300005353 Bacteria 746
26 Ga0070675_100246998 3300005354 Bacteria 1561
27 Ga0070675_101914120 3300005354 Bacteria 547
28 Ga0070671_100117476 3300005355 Bacteria 2237
29 Ga0070671_100276668 3300005355 Bacteria 1427
30 Ga0070674_100039638 3300005356 Bacteria 3182
31 Ga0070673_100019736 3300005364 Bacteria 4845
32 Ga0070673_100153392 3300005364 Bacteria 1953
33 Ga0070673_100178884 3300005364 Bacteria 1815
34 Ga0070688_100078212 3300005365 Bacteria 2134
35 Ga0070688_100116700 3300005365 Bacteria 1782
36 Ga0070659_100957520 3300005366 Unclassified 750
37 Ga0070667_100003966 3300005367 Bacteria 12554
38 Ga0070667_100313688 3300005367 Bacteria 1414
39 Ga0070700_100573827 3300005441 Bacteria 880
40 Ga0070678_100685625 3300005456 Bacteria 922
41 Ga0070662_100026162 3300005457 Bacteria 4039
42 Ga0068867_101998811 3300005459 Bacteria 548
43 Ga0070685_10003391 3300005466 Bacteria 8104
44 Ga0070685_10073462 3300005466 Bacteria 2033
45 Ga0070707_100205408 3300005468 Bacteria 1920
46 Ga0070679_100707111 3300005530 Unclassified 950
47 Ga0070684_100487669 3300005535 Bacteria 1141
48 Ga0068853_101309547 3300005539 Unclassified 700
49 Ga0070672_100095431 3300005543 Bacteria 2405
50 Ga0070672_101295942 3300005543 Bacteria 650
51 Ga0068855_100129888 3300005563 Bacteria 2878
52 Ga0068855_100721615 3300005563 Bacteria 1065
53 Ga0068855_100927484 3300005563 Bacteria 918
54 Ga0068855_101161409 3300005563 Bacteria 804
55 Ga0068857_100109099 3300005577 Unclassified 2487
56 Ga0068857_100339472 3300005577 Bacteria 1390
57 Ga0068854_100305797 3300005578 Bacteria 1288
58 Ga0068852_100256521 3300005616 Bacteria 1677
59 Ga0068852_100905226 3300005616 Bacteria 899
60 Ga0068859_100006778 3300005617 Bacteria 11636
61 Ga0068859_100278737 3300005617 Bacteria 1764
62 Ga0068864_100050731 3300005618 Bacteria 3572
63 Ga0068864_100136630 3300005618 Bacteria 2208
64 Ga0068864_100365659 3300005618 Unclassified 1364
65 Ga0068864_100685800 3300005618 Bacteria 1000
66 Ga0068864_101680245 3300005618 Bacteria 639
67 Ga0068861_101132776 3300005719 Bacteria 753
68 Ga0068851_10026368 3300005834 Unclassified 2855
69 Ga0068851_10356813 3300005834 Bacteria 852
70 Ga0068870_10872656 3300005840 Bacteria 634
71 Ga0068863_100033305 3300005841 Bacteria 4909
72 Ga0068863_100123917 3300005841 Bacteria 2465
73 Ga0068863_100125028 3300005841 Bacteria 2453
74 Ga0068858_100113065 3300005842 Bacteria 2536
75 Ga0068858_100610326 3300005842 Bacteria 1059
76 Ga0068860_100480859 3300005843 Bacteria 1238
77 Ga0068860_100873412 3300005843 Unclassified 915
78 Ga0068860_101063630 3300005843 Unclassified 828
79 Ga0070715_10097487 3300006163 Bacteria 1365
80 Ga0075366_10014568 3300006195 Bacteria 4492
81 Ga0075366_10390410 3300006195 Bacteria 856
82 Ga0097621_100057013 3300006237 Bacteria 3193
83 Ga0097621_100107467 3300006237 Bacteria 2354
84 Ga0097621_100352419 3300006237 Bacteria 1309
85 Ga0097621_100896579 3300006237 Bacteria 826
86 Ga0068871_100028555 3300006358 Bacteria 4374
87 Ga0068871_100168724 3300006358 Bacteria 1875
88 Ga0068871_100516237 3300006358 Bacteria 1078
89 Ga0075428_100275203 3300006844 Bacteria 1811
90 Ga0075430_100049266 3300006846 Unclassified 3555
91 Ga0075431_100182301 3300006847 Unclassified 2154
92 Ga0075434_100323098 3300006871 Unclassified 1564
93 Ga0097620_100006778 3300006931 Bacteria 11636
94 Ga0097620_100278753 3300006931 Bacteria 1764
95 Ga0111539_10308716 3300009094 Bacteria 1841
96 Ga0111539_12279256 3300009094 Bacteria 628
97 Ga0105247_10337932 3300009101 Bacteria 1056
98 Ga0114129_10236777 3300009147 Unclassified 2456
99 Ga0114129_11840050 3300009147 Bacteria 735
100 Ga0105241_10980740 3300009174 Bacteria 789
101 Ga0105242_10005641 3300009176 Bacteria 9662
102 Ga0105242_10043457 3300009176 Bacteria 3635
103 Ga0105242_10096750 3300009176 Bacteria 2495
104 Ga0105242_10110054 3300009176 Bacteria 2346
105 Ga0105248_10355793 3300009177 Bacteria 1649
106 Ga0105248_11850073 3300009177 Bacteria 685
107 Ga0105237_10429720 3300009545 Bacteria 1326
108 Ga0105237_11550247 3300009545 Bacteria 669
109 Ga0105249_10018127 3300009553 Bacteria 6258
110 Ga0105249_10308024 3300009553 Bacteria 1591
111 Ga0105249_10857894 3300009553 Bacteria 974
112 Ga0105249_11713416 3300009553 Unclassified 701
113 Ga0105249_11743046 3300009553 Bacteria 695
114 Ga0105249_12102771 3300009553 Bacteria 637
115 Ga0105239_10701771 3300010375 Bacteria 1157
116 Ga0105239_10966546 3300010375 Bacteria 979
117 Ga0105246_10424825 3300011119 Bacteria 1110
118 Ga0157371_10006529 3300013102 Bacteria 9599
119 Ga0157371_10364898 3300013102 Unclassified 1053
120 Ga0157370_10036382 3300013104 Bacteria 4777
121 Ga0157370_10579123 3300013104 Bacteria 1028
122 Ga0157370_10580342 3300013104 Bacteria 1027
123 Ga0157370_10704942 3300013104 Unclassified 921
124 Ga0157374_10019577 3300013296 Bacteria 5992
125 Ga0157374_10272727 3300013296 Unclassified 1668
126 Ga0157374_10759922 3300013296 Bacteria 984
127 Ga0157374_12027921 3300013296 Bacteria 602
128 Ga0157378_10002883 3300013297 Bacteria 15306
129 Ga0157378_10003255 3300013297 Bacteria 14444
130 Ga0157378_10134668 3300013297 Bacteria 2290
131 Ga0157378_10253981 3300013297 Bacteria 1684
132 Ga0157378_10283686 3300013297 Unclassified 1597
133 Ga0157378_10918910 3300013297 Bacteria 906
134 Ga0163162_10000895 3300013306 Bacteria 27750
135 Ga0163162_10001949 3300013306 Bacteria 19370
136 Ga0163162_10072938 3300013306 Bacteria 3488
137 Ga0163162_10087876 3300013306 Unclassified 3188
138 Ga0163162_10142546 3300013306 Unclassified 2510
139 Ga0163162_10216870 3300013306 Bacteria 2044
140 Ga0163162_12782322 3300013306 Bacteria 563
141 Ga0157372_10746430 3300013307 Bacteria 1138
142 Ga0157372_11438961 3300013307 Bacteria 794
143 Ga0157372_11559991 3300013307 Bacteria 760
144 Ga0157372_12059977 3300013307 Unclassified 656
145 Ga0157375_10151194 3300013308 Bacteria 2457
146 Ga0157375_10371712 3300013308 Bacteria 1596
147 Ga0157375_10712814 3300013308 Bacteria 1156
148 Ga0157375_10867496 3300013308 Bacteria 1048
149 Ga0157375_11660206 3300013308 Unclassified 756
150 Ga0163163_10296263 3300014325 Bacteria 1670
151 Ga0163163_11152591 3300014325 Bacteria 838
152 Ga0163163_11836242 3300014325 Bacteria 666
153 Ga0157380_10002513 3300014326 Bacteria 12359
154 Ga0182008_10000132 3300014497 Bacteria 56231
155 Ga0157377_10205341 3300014745 Bacteria 1253
156 Ga0157377_10312757 3300014745 Unclassified 1041
157 Ga0157377_10845274 3300014745 Bacteria 679
158 Ga0157379_10093162 3300014968 Unclassified 2703
159 Ga0157379_10320853 3300014968 Bacteria 1414
160 Ga0157379_10538814 3300014968 Unclassified 1085
161 Ga0157376_10146924 3300014969 Bacteria 2122
162 Ga0157376_10298376 3300014969 Bacteria 1524
163 Ga0157376_11678467 3300014969 Bacteria 670
164 Ga0157376_11689697 3300014969 Bacteria 668
165 Ga0182006_1000179 3300015261 Bacteria 66779
166 Ga0182006_1000182 3300015261 Bacteria 65171
167 Ga0183373_1002 3300015682 Bacteria 990153
168 Ga0163161_10000838 3300017792 Bacteria 23986
169 Ga0163161_10017514 3300017792 Bacteria 5013
170 Ga0163161_10134807 3300017792 Bacteria 1866
171 Ga0163161_10179132 3300017792 Bacteria 1624
172 Ga0209676_1000039 3300025292 Bacteria 443158
173 Ga0209050_1000033 3300025298 Bacteria 442615
174 Ga0207656_10041195 3300025321 Unclassified 1961
175 Ga0207682_10108042 3300025893 Bacteria 1222
176 Ga0207685_10497109 3300025905 Unclassified 641
177 Ga0207705_10255672 3300025909 Bacteria 1337
178 Ga0207671_10118404 3300025914 Bacteria 2022
179 Ga0207671_10999886 3300025914 Bacteria 659
180 Ga0207662_10081203 3300025918 Bacteria 1979
181 Ga0207652_10955136 3300025921 Unclassified 755
182 Ga0207681_10699593 3300025923 Bacteria 843
183 Ga0207650_10016172 3300025925 Bacteria 5210
184 Ga0207650_10055352 3300025925 Bacteria 2945
185 Ga0207659_10250345 3300025926 Bacteria 1437
186 Ga0207690_10261211 3300025932 Unclassified 1342
187 Ga0207706_10137508 3300025933 Bacteria 2149
188 Ga0207686_10000840 3300025934 Bacteria 18672
189 Ga0207686_10002379 3300025934 Bacteria 10261
190 Ga0207686_10531255 3300025934 Unclassified 917
191 Ga0207670_10006951 3300025936 Bacteria 6296
192 Ga0207670_10038884 3300025936 Bacteria 3110
193 Ga0207669_11068104 3300025937 Bacteria 680
194 Ga0207691_10076529 3300025940 Unclassified 3015
195 Ga0207691_10203883 3300025940 Bacteria 1720
196 Ga0207711_10633286 3300025941 Bacteria 998
197 Ga0207689_10068260 3300025942 Bacteria 2922
198 Ga0207689_10943990 3300025942 Bacteria 728
199 Ga0207651_10315467 3300025960 Bacteria 1305
200 Ga0207651_11773241 3300025960 Bacteria 556
201 Ga0207651_11958171 3300025960 Bacteria 527
202 Ga0207712_10204750 3300025961 Bacteria 1567
203 Ga0207712_10275339 3300025961 Bacteria 1371
204 Ga0207712_10675563 3300025961 Bacteria 899
205 Ga0207668_11168052 3300025972 Bacteria 691
206 Ga0207640_10443369 3300025981 Bacteria 1068
207 Ga0207658_10015666 3300025986 Bacteria 5204
208 Ga0207658_10728154 3300025986 Bacteria 897
209 Ga0207677_10003165 3300026023 Bacteria 8688
210 Ga0207677_10250534 3300026023 Bacteria 1438
211 Ga0207677_10560280 3300026023 Unclassified 997
212 Ga0207703_10639853 3300026035 Bacteria 1008
213 Ga0207639_10418673 3300026041 Bacteria 1211
214 Ga0207708_10152637 3300026075 Bacteria 1819
215 Ga0207641_10000090 3300026088 Bacteria 127735
216 Ga0207641_10058106 3300026088 Bacteria 3291
217 Ga0207641_10115212 3300026088 Bacteria 2389
218 Ga0207641_10330262 3300026088 Bacteria 1448
219 Ga0207676_10034349 3300026095 Bacteria 3839
220 Ga0207676_10836940 3300026095 Bacteria 899
221 Ga0207674_10127688 3300026116 Unclassified 2507
222 Ga0207674_10372212 3300026116 Bacteria 1381
223 Ga0207675_100069240 3300026118 Bacteria 3298
224 Ga0207675_100402198 3300026118 Bacteria 1350
225 Ga0207683_10660131 3300026121 Bacteria 969
226 Ga0207683_10706658 3300026121 Bacteria 935
227 Ga0207698_10372666 3300026142 Bacteria 1356
228 Ga0207698_10393578 3300026142 Bacteria 1322
229 Ga0207698_10574385 3300026142 Bacteria 1108
230 Ga0207698_10752164 3300026142 Bacteria 974
231 Ga0207698_11381576 3300026142 Bacteria 719
232 Ga0209996_1035926 3300027395 Unclassified 729
233 Ga0268264_10013246 3300028381 Bacteria 6788
234 Ga0268264_10351392 3300028381 Bacteria 1403
235 Ga0307508_10000677 3300031616 Bacteria 40943
236 Ga0307508_10554863 3300031616 Bacteria 747
237 Ga0307516_10467876 3300031730 Bacteria 916
238 Ga0307416_101594686 3300032002 Bacteria 758
239 Ga0307414_10002610 3300032004 Bacteria 9482
240 Ga0307414_10986512 3300032004 Bacteria 775
241 Ga0373952_0038401 3300035092 Bacteria 1097
242 Ga0451789_0645955 3300041443 Bacteria 976
243 Ga0451793_1881956 3300041452 Unclassified 833
244 Ga0451851_0172074 3300041507 Bacteria 862
245 Ga0451855_0947978 3300041511 Bacteria 596
246 Ga0466957_0601676 3300044842 Bacteria 770
247 Ga0495610_0046314 3300046512 Bacteria 2146
248 Ga0495672_0033591 3300047320 Bacteria 3177
249 Ga0495686_0119035 3300047472 Bacteria 1576
250 Ga0501044_0554272 3300049823 Bacteria 1046
251 nmdc:mga0k408_378957_c1 3300050493 Bacteria 843
252 nmdc:mga0k408_87470_c1 3300050493 Bacteria 1830
253 nmdc:mga05p37_1076167_c1 3300050507 Unclassified 845
254 nmdc:mga05p37_1498003_c1 3300050507 Bacteria 672
255 nmdc:mga09592_844477_c1 3300050508 Unclassified 773
256 nmdc:mga06r32_425579_c1 3300050510 Bacteria 1309
257 nmdc:mga0rr50_847650_c1 3300050513 Unclassified 779
258 Ga0500616_0025173 3300053153 Bacteria 3301
259 Ga0500611_000049 3300053727 Bacteria 55086
260 2586208798 2585427687 Bacteria 5544917
261 2904448914 2904445276 Bacteria 5310396
262 2946003192 2945997725 Bacteria 6404843
263 2954020049 2954016120 Bacteria 6446024
264 Ga0207668_11311705
265 JGI24743J22301_10094705
266 rootH2_10086569
267 rootL2_10061570
268 Ga0055536_1000006
269 Ga0055530_10003396
270 Ga0065712_10001085
271 Ga0065715_10127663
272 Ga0070658_10282512
273 Ga0070676_10493058
274 Ga0070690_100077065
275 Ga0070670_100061375
276 Ga0070670_100072310
277 Ga0070670_100094262
278 Ga0068869_100019868
279 Ga0070682_100462260
280 Ga0068868_100014894
281 Ga0068868_100812848
282 Ga0070689_100026475
283 Ga0070687_100083869
284 Ga0070661_100217262
285 Ga0070661_101315888
286 Ga0070668_100321946
287 Ga0070669_100068982
288 Ga0070669_100924050
289 Ga0070675_100246998
290 Ga0070675_101914120
291 Ga0070671_100117476
292 Ga0070671_100276668
293 Ga0070674_100039638
294 Ga0070673_100019736
295 Ga0070673_100153392
296 Ga0070673_100178884
297 Ga0070688_100078212
298 Ga0070688_100116700
299 Ga0070659_100957520
300 Ga0070667_100003966
301 Ga0070667_100313688
302 Ga0070700_100573827
303 Ga0070678_100685625
304 Ga0070662_100026162
305 Ga0068867_101998811
306 Ga0070685_10003391
307 Ga0070685_10073462
308 Ga0070707_100205408
309 Ga0070679_100707111
310 Ga0070684_100487669
311 Ga0068853_101309547
312 Ga0070672_100095431
313 Ga0070672_101295942
314 Ga0068855_100129888
315 Ga0068855_100721615
316 Ga0068855_100927484
317 Ga0068855_101161409
318 Ga0068857_100109099
319 Ga0068857_100339472
320 Ga0068854_100305797
321 Ga0068852_100256521
322 Ga0068852_100905226
323 Ga0068859_100006778
324 Ga0068859_100278737
325 Ga0068864_100050731
326 Ga0068864_100136630
327 Ga0068864_100365659
328 Ga0068864_100685800
329 Ga0068864_101680245
330 Ga0068861_101132776
331 Ga0068851_10026368
332 Ga0068851_10356813
333 Ga0068870_10872656
334 Ga0068863_100033305
335 Ga0068863_100123917
336 Ga0068863_100125028
337 Ga0068858_100113065
338 Ga0068858_100610326
339 Ga0068860_100480859
340 Ga0068860_100873412
341 Ga0068860_101063630
342 Ga0070715_10097487
343 Ga0075366_10014568
344 Ga0075366_10390410
345 Ga0097621_100057013
346 Ga0097621_100107467
347 Ga0097621_100352419
348 Ga0097621_100896579
349 Ga0068871_100028555
350 Ga0068871_100168724
351 Ga0068871_100516237
352 Ga0075428_100275203
353 Ga0075430_100049266
354 Ga0075431_100182301
355 Ga0075434_100323098
356 Ga0097620_100006778
357 Ga0097620_100278753
358 Ga0111539_10308716
359 Ga0111539_12279256
360 Ga0105247_10337932
361 Ga0114129_10236777
362 Ga0114129_11840050
363 Ga0105241_10980740
364 Ga0105242_10005641
365 Ga0105242_10043457
366 Ga0105242_10096750
367 Ga0105242_10110054
368 Ga0105248_10355793
369 Ga0105248_11850073
370 Ga0105237_10429720
371 Ga0105237_11550247
372 Ga0105249_10018127
373 Ga0105249_10308024
374 Ga0105249_10857894
375 Ga0105249_11713416
376 Ga0105249_11743046
377 Ga0105249_12102771
378 Ga0105239_10701771
379 Ga0105239_10966546
380 Ga0105246_10424825
381 Ga0157371_10006529
382 Ga0157371_10364898
383 Ga0157370_10036382
384 Ga0157370_10579123
385 Ga0157370_10580342
386 Ga0157370_10704942
387 Ga0157374_10019577
388 Ga0157374_10272727
389 Ga0157374_10759922
390 Ga0157374_12027921
391 Ga0157378_10002883
392 Ga0157378_10003255
393 Ga0157378_10134668
394 Ga0157378_10253981
395 Ga0157378_10283686
396 Ga0157378_10918910
397 Ga0163162_10000895
398 Ga0163162_10001949
399 Ga0163162_10072938
400 Ga0163162_10087876
401 Ga0163162_10142546
402 Ga0163162_10216870
403 Ga0163162_12782322
404 Ga0157372_10746430
405 Ga0157372_11438961
406 Ga0157372_11559991
407 Ga0157372_12059977
408 Ga0157375_10151194
409 Ga0157375_10371712
410 Ga0157375_10712814
411 Ga0157375_10867496
412 Ga0157375_11660206
413 Ga0163163_10296263
414 Ga0163163_11152591
415 Ga0163163_11836242
416 Ga0157380_10002513
417 Ga0182008_10000132
418 Ga0157377_10205341
419 Ga0157377_10312757
420 Ga0157377_10845274
421 Ga0157379_10093162
422 Ga0157379_10320853
423 Ga0157379_10538814
424 Ga0157376_10146924
425 Ga0157376_10298376
426 Ga0157376_11678467
427 Ga0157376_11689697
428 Ga0182006_1000179
429 Ga0182006_1000182
430 Ga0183373_1002
431 Ga0163161_10000838
432 Ga0163161_10017514
433 Ga0163161_10134807
434 Ga0163161_10179132
435 Ga0209676_1000039
436 Ga0209050_1000033
437 Ga0207656_10041195
438 Ga0207682_10108042
439 Ga0207685_10497109
440 Ga0207705_10255672
441 Ga0207671_10118404
442 Ga0207671_10999886
443 Ga0207662_10081203
444 Ga0207652_10955136
445 Ga0207681_10699593
446 Ga0207650_10016172
447 Ga0207650_10055352
448 Ga0207659_10250345
449 Ga0207690_10261211
450 Ga0207706_10137508
451 Ga0207686_10000840
452 Ga0207686_10002379
453 Ga0207686_10531255
454 Ga0207670_10006951
455 Ga0207670_10038884
456 Ga0207669_11068104
457 Ga0207691_10076529
458 Ga0207691_10203883
459 Ga0207711_10633286
460 Ga0207689_10068260
461 Ga0207689_10943990
462 Ga0207651_10315467
463 Ga0207651_11773241
464 Ga0207651_11958171
465 Ga0207712_10204750
466 Ga0207712_10275339
467 Ga0207712_10675563
468 Ga0207668_11168052
469 Ga0207640_10443369
470 Ga0207658_10015666
471 Ga0207658_10728154
472 Ga0207677_10003165
473 Ga0207677_10250534
474 Ga0207677_10560280
475 Ga0207703_10639853
476 Ga0207639_10418673
477 Ga0207708_10152637
478 Ga0207641_10000090
479 Ga0207641_10058106
480 Ga0207641_10115212
481 Ga0207641_10330262
482 Ga0207676_10034349
483 Ga0207676_10836940
484 Ga0207674_10127688
485 Ga0207674_10372212
486 Ga0207675_100069240
487 Ga0207675_100402198
488 Ga0207683_10660131
489 Ga0207683_10706658
490 Ga0207698_10372666
491 Ga0207698_10393578
492 Ga0207698_10574385
493 Ga0207698_10752164
494 Ga0207698_11381576
495 Ga0209996_1035926
496 Ga0268264_10013246
497 Ga0268264_10351392
498 Ga0307508_10000677
499 Ga0307508_10554863
500 Ga0307516_10467876
501 Ga0307416_101594686
502 Ga0307414_10002610
503 Ga0307414_10986512
504 Ga0373952_0038401
505 Ga0451789_0645955
506 Ga0451793_1881956
507 Ga0451851_0172074
508 Ga0451855_0947978
509 Ga0466957_0601676
510 Ga0495610_0046314
511 Ga0495672_0033591
512 Ga0495686_0119035
513 Ga0501044_0554272
514 nmdc:mga0k408_378957_c1
515 nmdc:mga0k408_87470_c1
516 nmdc:mga05p37_1076167_c1
517 nmdc:mga05p37_1498003_c1
518 nmdc:mga09592_844477_c1
519 nmdc:mga06r32_425579_c1
520 nmdc:mga0rr50_847650_c1
521 Ga0500616_0025173
522 Ga0500611_000049
523 2586208798
524 2904448914
525 2946003192
526 2954020049

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01797

Y1_Tnp

Transposase IS200 like

4

118

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2xo6-assembly1.cif.gz_D deinococcus radiodurans isdra2 transposase y132f mutant complexed with left end recognition and cleavage site 0.8051 19 126
2fyx-assembly1.cif.gz_B crystal structure of a putative transposase (dr_0177) from deinococcus radiodurans r1 at 1.90 a resolution 0.7991 19 131
2xma-assembly1.cif.gz_B deinococcus radiodurans isdra2 transposase right end dna complex 0.7915 19 130
2xqc-assembly1.cif.gz_A deinococcus radiodurans isdra2 transposase complexed with left end recognition and cleavage site and zn 0.7805 19 131
2ec2-assembly1.cif.gz_C crystal structure of transposase from sulfolobus tokodaii 0.7765 19 131
ID Description Score Start End Superfamily
2a6mB01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Transposase IS200-like 0.7876 20 130 3.30.70.1290
2xm3E00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Transposase IS200-like 0.7848 19 128 3.30.70.1290
2vjvB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Transposase IS200-like 0.7744 19 128 3.30.70.1290
4er8A00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Transposase IS200-like 0.7575 17 135 3.30.70.1290
af_Q2G1W3_4_135_3.30.70.1290 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Transposase IS200-like 0.7356 20 131 3.30.70.1290
ID Description Score Start End GO Terms
AF-A0A497CNJ8-F1-model_v4 IS200/IS605 family transposase 0.948 17 137 GO:0003677
GO:0004803
GO:0006313
AF-A0A4Q5UQL2-F1-model_v4 IS200/IS605 family transposase 0.941 13 124 GO:0003677
GO:0004803
GO:0006313
AF-A0A661JNE4-F1-model_v4 IS200/IS605 family transposase 0.9343 17 137 GO:0003677
GO:0004803
GO:0006313
AF-W6THC2-F1-model_v4 Transposase 0.9318 19 98 GO:0003677
GO:0004803
GO:0006313
AF-A0A7Y4RF68-F1-model_v4 IS200/IS605 family transposase 0.9307 20 136 GO:0003677
GO:0004803
GO:0006313

Map