F371304

General Info

Members Datasets Scaffolds Average Seq Length
262 118 524 133

Family's Representative Sequence

Representative Sequence 3300045976|Ga0466967_1574011|Ga0466967_1574011_174_638
Length 154
Sequence LRAFFENAQRNDLYTKPATMNVTDLPLLSMLRERMSWLNSRQALLSQNVANADTPGYAARDLKPQDFESELKRGSAPQFPGLVTTSPMHLAVSTSGPAHVEDADIVQTPASSTQNSVSLEEEMIKVADTQAQYQAASNLYAKAINMMRTAIGQP

Samples

Sample ID Description Type Environment
1 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
4 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
5 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
6 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
7 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
8 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
9 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
10 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
11 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
12 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
13 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
14 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
15 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
16 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
17 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
18 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
19 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
20 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
21 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
22 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
23 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
24 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
25 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
26 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
27 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
28 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
29 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
30 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
31 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
32 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
33 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
34 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
53 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
54 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
55 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
56 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
57 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
58 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
59 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
60 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
61 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
62 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
63 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
64 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
65 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
66 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
67 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
68 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
69 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
70 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
71 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
72 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
73 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
74 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
75 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
76 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
77 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
78 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
79 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
80 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
81 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
82 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
83 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
84 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
85 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
86 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
87 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
88 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
89 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
90 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
91 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
92 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
93 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
94 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
95 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
96 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
97 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
98 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
99 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
100 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
101 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
102 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
103 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
104 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
105 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
106 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
107 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
108 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
109 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
110 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
112 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
113 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
114 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
115 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
116 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
117 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
118 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.91
Nodule 0
Rhizoplane 1.15
Rhizosphere 93.51
Stem 0
Stem Tuber 0
Unclassified 7.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466967_1574011 3300045976 Bacteria 655
2 Ga0070683_100717479 3300005329 Bacteria 958
3 Ga0070683_101136499 3300005329 Bacteria 750
4 Ga0070661_100249364 3300005344 Bacteria 1369
5 Ga0070661_100265611 3300005344 Bacteria 1328
6 Ga0070685_10784360 3300005466 Bacteria 701
7 Ga0070679_100950321 3300005530 Unclassified 803
8 Ga0070684_100597038 3300005535 Bacteria 1026
9 Ga0068853_100006450 3300005539 Bacteria 9327
10 Ga0068853_100626274 3300005539 Bacteria 1023
11 Ga0070693_100060607 3300005547 Bacteria 2197
12 Ga0070665_101773264 3300005548 Unclassified 624
13 Ga0068855_100012265 3300005563 Bacteria 10358
14 Ga0068856_100602368 3300005614 Bacteria 1120
15 Ga0068856_100801331 3300005614 Unclassified 962
16 Ga0068852_100037369 3300005616 Bacteria 4070
17 Ga0068852_100255746 3300005616 Unclassified 1680
18 Ga0068852_100397933 3300005616 Bacteria 1354
19 Ga0068852_100755286 3300005616 Bacteria 985
20 Ga0068858_100041992 3300005842 Bacteria 4240
21 Ga0068860_100091261 3300005843 Bacteria 2902
22 Ga0097621_100188316 3300006237 Unclassified 1786
23 Ga0105240_10015971 3300009093 Bacteria 10178
24 Ga0105240_10023059 3300009093 Bacteria 8242
25 Ga0105240_10246554 3300009093 Bacteria 2068
26 Ga0105240_10575302 3300009093 Bacteria 1243
27 Ga0105240_11211093 3300009093 Bacteria 799
28 Ga0105247_10005921 3300009101 Bacteria 7630
29 Ga0105247_10302631 3300009101 Bacteria 1110
30 Ga0105241_10022660 3300009174 Bacteria 4654
31 Ga0105241_10065201 3300009174 Bacteria 2814
32 Ga0105241_10145340 3300009174 Bacteria 1934
33 Ga0105241_10661139 3300009174 Bacteria 950
34 Ga0105241_11983478 3300009174 Bacteria 572
35 Ga0105242_10018310 3300009176 Bacteria 5474
36 Ga0105242_11015456 3300009176 Bacteria 838
37 Ga0105248_10000015 3300009177 Bacteria 322959
38 Ga0105248_10765207 3300009177 Bacteria 1090
39 Ga0105237_10121329 3300009545 Bacteria 2608
40 Ga0105237_10145603 3300009545 Bacteria 2364
41 Ga0105237_10268240 3300009545 Bacteria 1710
42 Ga0105237_11821126 3300009545 Unclassified 616
43 Ga0105238_10008006 3300009551 Bacteria 10573
44 Ga0105238_10301695 3300009551 Bacteria 1585
45 Ga0105238_10662612 3300009551 Unclassified 1054
46 Ga0105238_11007799 3300009551 Bacteria 854
47 Ga0105238_11390811 3300009551 Bacteria 729
48 Ga0105238_11500664 3300009551 Bacteria 703
49 Ga0105238_12721012 3300009551 Unclassified 531
50 Ga0105249_11155911 3300009553 Unclassified 845
51 Ga0105239_10010201 3300010375 Bacteria 10523
52 Ga0105239_10072469 3300010375 Bacteria 3787
53 Ga0105239_10286117 3300010375 Bacteria 1856
54 Ga0105239_11114110 3300010375 Bacteria 909
55 Ga0105239_11681059 3300010375 Bacteria 735
56 Ga0157369_10001437 3300013105 Bacteria 29219
57 Ga0157369_10097058 3300013105 Bacteria 3144
58 Ga0157369_10402533 3300013105 Bacteria 1420
59 Ga0157374_10773586 3300013296 Unclassified 975
60 Ga0157374_11114495 3300013296 Bacteria 810
61 Ga0163162_10260642 3300013306 Bacteria 1865
62 Ga0163162_10553519 3300013306 Bacteria 1278
63 Ga0157372_10351379 3300013307 Bacteria 1717
64 Ga0157375_10825037 3300013308 Unclassified 1075
65 Ga0163163_10000004 3300014325 Bacteria 416569
66 Ga0157379_10000434 3300014968 Bacteria 33885
67 Ga0157379_10421617 3300014968 Bacteria 1229
68 Ga0157379_10996061 3300014968 Bacteria 799
69 Ga0213874_10019442 3300021377 Bacteria 1848
70 Ga0213876_10013351 3300021384 Bacteria 4366
71 Ga0207710_10020352 3300025900 Bacteria 2836
72 Ga0207705_10503446 3300025909 Bacteria 941
73 Ga0207654_10049607 3300025911 Bacteria 2408
74 Ga0207654_10052175 3300025911 Bacteria 2356
75 Ga0207654_10106278 3300025911 Unclassified 1738
76 Ga0207654_10320886 3300025911 Bacteria 1059
77 Ga0207654_10961419 3300025911 Bacteria 620
78 Ga0207695_10005700 3300025913 Bacteria 16424
79 Ga0207695_10017972 3300025913 Bacteria 8188
80 Ga0207695_10129831 3300025913 Bacteria 2478
81 Ga0207695_10344992 3300025913 Bacteria 1376
82 Ga0207695_10849307 3300025913 Bacteria 793
83 Ga0207671_10239205 3300025914 Bacteria 1426
84 Ga0207671_10345343 3300025914 Bacteria 1180
85 Ga0207671_10532024 3300025914 Bacteria 937
86 Ga0207649_10078819 3300025920 Bacteria 2127
87 Ga0207649_10102765 3300025920 Bacteria 1895
88 Ga0207694_10000015 3300025924 Bacteria 363898
89 Ga0207694_10047580 3300025924 Bacteria 3317
90 Ga0207694_11031817 3300025924 Bacteria 696
91 Ga0207686_10006963 3300025934 Bacteria 6087
92 Ga0207686_11406794 3300025934 Bacteria 574
93 Ga0207711_10000003 3300025941 Bacteria 1042791
94 Ga0207711_10000005 3300025941 Bacteria 822972
95 Ga0207711_10000009 3300025941 Bacteria 580864
96 Ga0207711_10502585 3300025941 Bacteria 1130
97 Ga0207661_10243773 3300025944 Bacteria 1596
98 Ga0207667_10000012 3300025949 Bacteria 445492
99 Ga0207667_10019570 3300025949 Bacteria 7552
100 Ga0207703_10038065 3300026035 Bacteria 3836
101 Ga0207639_10009346 3300026041 Bacteria 6760
102 Ga0207639_10452445 3300026041 Bacteria 1166
103 Ga0207702_10800205 3300026078 Unclassified 932
104 Ga0207674_11864643 3300026116 Unclassified 568
105 Ga0207698_10001858 3300026142 Bacteria 12330
106 Ga0207698_10077116 3300026142 Bacteria 2671
107 Ga0207698_10244537 3300026142 Bacteria 1637
108 Ga0207698_10795560 3300026142 Bacteria 947
109 Ga0268266_11135104 3300028379 Bacteria 756
110 Ga0268264_10107178 3300028381 Bacteria 2440
111 Ga0265338_10017239 3300028800 Bacteria 7800
112 Ga0265338_10090820 3300028800 Bacteria 2526
113 Ga0265338_10097101 3300028800 Bacteria 2415
114 Ga0265338_10189429 3300028800 Bacteria 1561
115 Ga0265338_10290092 3300028800 Bacteria 1193
116 Ga0265338_10599399 3300028800 Bacteria 767
117 Ga0265330_10079966 3300031235 Bacteria 1409
118 Ga0265332_10110446 3300031238 Unclassified 1158
119 Ga0265332_10134691 3300031238 Bacteria 1036
120 Ga0265332_10145811 3300031238 Bacteria 991
121 Ga0265328_10192854 3300031239 Bacteria 772
122 Ga0265328_10219136 3300031239 Bacteria 725
123 Ga0265320_10001423 3300031240 Bacteria 17387
124 Ga0265325_10000370 3300031241 Bacteria 31688
125 Ga0265325_10004529 3300031241 Bacteria 8760
126 Ga0265325_10020126 3300031241 Bacteria 3682
127 Ga0265325_10077527 3300031241 Bacteria 1656
128 Ga0265329_10165568 3300031242 Unclassified 720
129 Ga0265340_10001761 3300031247 Bacteria 12390
130 Ga0265340_10002318 3300031247 Bacteria 10895
131 Ga0265340_10027285 3300031247 Bacteria 2880
132 Ga0265340_10384270 3300031247 Bacteria 619
133 Ga0265339_10002816 3300031249 Bacteria 12356
134 Ga0265339_10005712 3300031249 Bacteria 8256
135 Ga0265339_10062798 3300031249 Bacteria 1996
136 Ga0265339_10124120 3300031249 Bacteria 1325
137 Ga0265331_10046592 3300031250 Bacteria 2089
138 Ga0265316_10015142 3300031344 Bacteria 6755
139 Ga0265316_10117249 3300031344 Bacteria 2013
140 Ga0265316_10281954 3300031344 Bacteria 1214
141 Ga0265316_11116330 3300031344 Bacteria 547
142 Ga0265313_10003271 3300031595 Bacteria 13311
143 Ga0265313_10029036 3300031595 Bacteria 2866
144 Ga0265313_10037576 3300031595 Bacteria 2419
145 Ga0265313_10045920 3300031595 Bacteria 2124
146 Ga0265314_10003393 3300031711 Bacteria 15435
147 Ga0265314_10019049 3300031711 Bacteria 5326
148 Ga0265314_10029582 3300031711 Bacteria 4068
149 Ga0265314_10097342 3300031711 Bacteria 1901
150 Ga0265314_10108648 3300031711 Bacteria 1767
151 Ga0265342_10053539 3300031712 Bacteria 2401
152 Ga0265342_10074026 3300031712 Bacteria 1980
153 Ga0265342_10150342 3300031712 Bacteria 1293
154 Ga0307516_10044326 3300031730 Bacteria 4402
155 Ga0373923_0191274 3300035111 Unclassified 943
156 Ga0373939_0470216 3300035114 Bacteria 532
157 Ga0373954_0229896 3300035118 Bacteria 913
158 Ga0373955_0156203 3300035172 Bacteria 1344
159 Ga0373937_0015628 3300036401 Bacteria 6720
160 Ga0373937_0611246 3300036401 Bacteria 1035
161 Ga0373937_1839998 3300036401 Bacteria 552
162 Ga0395899_0107610 3300037312 Bacteria 2007
163 Ga0395900_0063307 3300037418 Bacteria 3802
164 Ga0395898_0892168 3300037466 Bacteria 827
165 Ga0395901_0197958 3300038443 Bacteria 2106
166 Ga0436365_0974062 3300039437 Bacteria 945
167 Ga0436365_1603232 3300039437 Bacteria 1299
168 Ga0436365_1633760 3300039437 Bacteria 4631
169 Ga0436365_1858594 3300039437 Bacteria 1774
170 Ga0436363_0488678 3300039450 Bacteria 2209
171 Ga0436362_0445312 3300039453 Bacteria 1068
172 Ga0495651_0223929 3300046462 Bacteria 1300
173 Ga0495664_0057370 3300046477 Bacteria 2317
174 Ga0495606_0188399 3300046507 Bacteria 1184
175 Ga0495608_0612436 3300046511 Unclassified 653
176 Ga0495628_0776593 3300046516 Bacteria 672
177 Ga0495600_0248491 3300046809 Bacteria 1132
178 Ga0495684_0139946 3300047471 Bacteria 1815
179 Ga0496106_1204094 3300048909 Bacteria 591
180 Ga0496107_0678004 3300048910 Bacteria 759
181 Ga0496114_0955590 3300048917 Bacteria 739
182 Ga0496126_0000159 3300048929 Bacteria 155348
183 Ga0501031_0020070 3300049568 Bacteria 4356
184 Ga0501031_0357000 3300049568 Bacteria 946
185 Ga0501031_0478141 3300049568 Bacteria 804
186 Ga0501032_0075601 3300049569 Bacteria 2243
187 Ga0501032_0111430 3300049569 Bacteria 1811
188 Ga0501032_0157006 3300049569 Bacteria 1494
189 Ga0501032_0167911 3300049569 Bacteria 1439
190 Ga0501032_0265758 3300049569 Bacteria 1112
191 Ga0501032_0273099 3300049569 Bacteria 1095
192 Ga0501032_0319967 3300049569 Bacteria 1001
193 Ga0501033_0026223 3300049570 Bacteria 4388
194 Ga0501033_0033403 3300049570 Bacteria 3862
195 Ga0501033_0156643 3300049570 Bacteria 1641
196 Ga0501033_0170072 3300049570 Bacteria 1565
197 Ga0501033_1082847 3300049570 Bacteria 533
198 Ga0501034_0035597 3300049571 Bacteria 5047
199 Ga0501034_0140060 3300049571 Bacteria 2399
200 Ga0501034_0154506 3300049571 Bacteria 2269
201 Ga0501034_1025328 3300049571 Bacteria 708
202 Ga0501036_0061377 3300049572 Bacteria 3184
203 Ga0501037_0140172 3300049573 Bacteria 1731
204 Ga0501037_0204253 3300049573 Bacteria 1395
205 Ga0501037_0244707 3300049573 Bacteria 1256
206 Ga0501037_0325541 3300049573 Bacteria 1063
207 Ga0501038_0064216 3300049574 Bacteria 3131
208 Ga0501038_0069076 3300049574 Bacteria 3002
209 Ga0501039_0426337 3300049575 Bacteria 1042
210 Ga0501042_0592050 3300049578 Bacteria 806
211 Ga0501043_0049548 3300049579 Bacteria 3302
212 Ga0501043_0198521 3300049579 Bacteria 1558
213 Ga0501047_0002288 3300049581 Bacteria 18324
214 Ga0501047_0005046 3300049581 Bacteria 12389
215 Ga0501047_0123369 3300049581 Bacteria 2471
216 Ga0501047_0171288 3300049581 Bacteria 2040
217 Ga0501047_0178321 3300049581 Bacteria 1992
218 Ga0501047_0425974 3300049581 Bacteria 1158
219 Ga0501047_0773767 3300049581 Bacteria 775
220 Ga0501067_0003044 3300049583 Bacteria 9255
221 Ga0501067_0022123 3300049583 Bacteria 3518
222 Ga0501069_0005988 3300049585 Bacteria 6344
223 Ga0501069_0363926 3300049585 Unclassified 853
224 Ga0501070_0000017 3300049586 Bacteria 173127
225 Ga0501070_0014487 3300049586 Bacteria 6635
226 Ga0501070_0285541 3300049586 Bacteria 1346
227 Ga0501070_0439640 3300049586 Bacteria 1052
228 Ga0501072_0016392 3300049588 Bacteria 5687
229 Ga0501073_0057294 3300049589 Bacteria 2724
230 Ga0501073_0154123 3300049589 Bacteria 1592
231 Ga0501074_0080795 3300049590 Bacteria 2332
232 Ga0501079_0002026 3300049741 Bacteria 14503
233 Ga0501079_0259140 3300049741 Bacteria 1359
234 Ga0501080_0000444 3300049742 Bacteria 32129
235 Ga0501080_0632743 3300049742 Bacteria 948
236 Ga0501080_0654265 3300049742 Bacteria 929
237 Ga0501083_0113070 3300049744 Bacteria 1784
238 Ga0501083_0194874 3300049744 Bacteria 1322
239 Ga0501035_0004489 3300049822 Bacteria 13248
240 Ga0501035_0018758 3300049822 Bacteria 6371
241 Ga0501035_0056228 3300049822 Bacteria 3511
242 Ga0501035_0173213 3300049822 Bacteria 1863
243 Ga0501035_0287797 3300049822 Bacteria 1387
244 Ga0501035_0401058 3300049822 Bacteria 1141
245 Ga0501035_0673965 3300049822 Bacteria 836
246 Ga0501035_1025056 3300049822 Bacteria 648
247 Ga0501044_0001761 3300049823 Bacteria 25293
248 Ga0501044_0057834 3300049823 Bacteria 3978
249 Ga0501044_0064424 3300049823 Bacteria 3742
250 Ga0501044_0130845 3300049823 Bacteria 2503
251 Ga0501044_0194167 3300049823 Bacteria 1991
252 Ga0501044_0391987 3300049823 Bacteria 1302
253 Ga0501044_0403288 3300049823 Unclassified 1279
254 Ga0501044_1181274 3300049823 Bacteria 633
255 Ga0500655_028606 3300053133 Bacteria 1067
256 Ga0500559_0053890 3300053136 Bacteria 1781
257 Ga0500616_0267102 3300053153 Bacteria 724
258 Ga0500639_033151 3300053163 Bacteria 2730
259 Ga0500576_127320 3300053725 Bacteria 993
260 Ga0501084_0035878 3300054114 Bacteria 4145
261 Ga0501082_0384043 3300060353 Bacteria 1225
262 Ga0501082_0409976 3300060353 Bacteria 1183
263 Ga0466967_1574011
264 Ga0070683_100717479
265 Ga0070683_101136499
266 Ga0070661_100249364
267 Ga0070661_100265611
268 Ga0070685_10784360
269 Ga0070679_100950321
270 Ga0070684_100597038
271 Ga0068853_100006450
272 Ga0068853_100626274
273 Ga0070693_100060607
274 Ga0070665_101773264
275 Ga0068855_100012265
276 Ga0068856_100602368
277 Ga0068856_100801331
278 Ga0068852_100037369
279 Ga0068852_100255746
280 Ga0068852_100397933
281 Ga0068852_100755286
282 Ga0068858_100041992
283 Ga0068860_100091261
284 Ga0097621_100188316
285 Ga0105240_10015971
286 Ga0105240_10023059
287 Ga0105240_10246554
288 Ga0105240_10575302
289 Ga0105240_11211093
290 Ga0105247_10005921
291 Ga0105247_10302631
292 Ga0105241_10022660
293 Ga0105241_10065201
294 Ga0105241_10145340
295 Ga0105241_10661139
296 Ga0105241_11983478
297 Ga0105242_10018310
298 Ga0105242_11015456
299 Ga0105248_10000015
300 Ga0105248_10765207
301 Ga0105237_10121329
302 Ga0105237_10145603
303 Ga0105237_10268240
304 Ga0105237_11821126
305 Ga0105238_10008006
306 Ga0105238_10301695
307 Ga0105238_10662612
308 Ga0105238_11007799
309 Ga0105238_11390811
310 Ga0105238_11500664
311 Ga0105238_12721012
312 Ga0105249_11155911
313 Ga0105239_10010201
314 Ga0105239_10072469
315 Ga0105239_10286117
316 Ga0105239_11114110
317 Ga0105239_11681059
318 Ga0157369_10001437
319 Ga0157369_10097058
320 Ga0157369_10402533
321 Ga0157374_10773586
322 Ga0157374_11114495
323 Ga0163162_10260642
324 Ga0163162_10553519
325 Ga0157372_10351379
326 Ga0157375_10825037
327 Ga0163163_10000004
328 Ga0157379_10000434
329 Ga0157379_10421617
330 Ga0157379_10996061
331 Ga0213874_10019442
332 Ga0213876_10013351
333 Ga0207710_10020352
334 Ga0207705_10503446
335 Ga0207654_10049607
336 Ga0207654_10052175
337 Ga0207654_10106278
338 Ga0207654_10320886
339 Ga0207654_10961419
340 Ga0207695_10005700
341 Ga0207695_10017972
342 Ga0207695_10129831
343 Ga0207695_10344992
344 Ga0207695_10849307
345 Ga0207671_10239205
346 Ga0207671_10345343
347 Ga0207671_10532024
348 Ga0207649_10078819
349 Ga0207649_10102765
350 Ga0207694_10000015
351 Ga0207694_10047580
352 Ga0207694_11031817
353 Ga0207686_10006963
354 Ga0207686_11406794
355 Ga0207711_10000003
356 Ga0207711_10000005
357 Ga0207711_10000009
358 Ga0207711_10502585
359 Ga0207661_10243773
360 Ga0207667_10000012
361 Ga0207667_10019570
362 Ga0207703_10038065
363 Ga0207639_10009346
364 Ga0207639_10452445
365 Ga0207702_10800205
366 Ga0207674_11864643
367 Ga0207698_10001858
368 Ga0207698_10077116
369 Ga0207698_10244537
370 Ga0207698_10795560
371 Ga0268266_11135104
372 Ga0268264_10107178
373 Ga0265338_10017239
374 Ga0265338_10090820
375 Ga0265338_10097101
376 Ga0265338_10189429
377 Ga0265338_10290092
378 Ga0265338_10599399
379 Ga0265330_10079966
380 Ga0265332_10110446
381 Ga0265332_10134691
382 Ga0265332_10145811
383 Ga0265328_10192854
384 Ga0265328_10219136
385 Ga0265320_10001423
386 Ga0265325_10000370
387 Ga0265325_10004529
388 Ga0265325_10020126
389 Ga0265325_10077527
390 Ga0265329_10165568
391 Ga0265340_10001761
392 Ga0265340_10002318
393 Ga0265340_10027285
394 Ga0265340_10384270
395 Ga0265339_10002816
396 Ga0265339_10005712
397 Ga0265339_10062798
398 Ga0265339_10124120
399 Ga0265331_10046592
400 Ga0265316_10015142
401 Ga0265316_10117249
402 Ga0265316_10281954
403 Ga0265316_11116330
404 Ga0265313_10003271
405 Ga0265313_10029036
406 Ga0265313_10037576
407 Ga0265313_10045920
408 Ga0265314_10003393
409 Ga0265314_10019049
410 Ga0265314_10029582
411 Ga0265314_10097342
412 Ga0265314_10108648
413 Ga0265342_10053539
414 Ga0265342_10074026
415 Ga0265342_10150342
416 Ga0307516_10044326
417 Ga0373923_0191274
418 Ga0373939_0470216
419 Ga0373954_0229896
420 Ga0373955_0156203
421 Ga0373937_0015628
422 Ga0373937_0611246
423 Ga0373937_1839998
424 Ga0395899_0107610
425 Ga0395900_0063307
426 Ga0395898_0892168
427 Ga0395901_0197958
428 Ga0436365_0974062
429 Ga0436365_1603232
430 Ga0436365_1633760
431 Ga0436365_1858594
432 Ga0436363_0488678
433 Ga0436362_0445312
434 Ga0495651_0223929
435 Ga0495664_0057370
436 Ga0495606_0188399
437 Ga0495608_0612436
438 Ga0495628_0776593
439 Ga0495600_0248491
440 Ga0495684_0139946
441 Ga0496106_1204094
442 Ga0496107_0678004
443 Ga0496114_0955590
444 Ga0496126_0000159
445 Ga0501031_0020070
446 Ga0501031_0357000
447 Ga0501031_0478141
448 Ga0501032_0075601
449 Ga0501032_0111430
450 Ga0501032_0157006
451 Ga0501032_0167911
452 Ga0501032_0265758
453 Ga0501032_0273099
454 Ga0501032_0319967
455 Ga0501033_0026223
456 Ga0501033_0033403
457 Ga0501033_0156643
458 Ga0501033_0170072
459 Ga0501033_1082847
460 Ga0501034_0035597
461 Ga0501034_0140060
462 Ga0501034_0154506
463 Ga0501034_1025328
464 Ga0501036_0061377
465 Ga0501037_0140172
466 Ga0501037_0204253
467 Ga0501037_0244707
468 Ga0501037_0325541
469 Ga0501038_0064216
470 Ga0501038_0069076
471 Ga0501039_0426337
472 Ga0501042_0592050
473 Ga0501043_0049548
474 Ga0501043_0198521
475 Ga0501047_0002288
476 Ga0501047_0005046
477 Ga0501047_0123369
478 Ga0501047_0171288
479 Ga0501047_0178321
480 Ga0501047_0425974
481 Ga0501047_0773767
482 Ga0501067_0003044
483 Ga0501067_0022123
484 Ga0501069_0005988
485 Ga0501069_0363926
486 Ga0501070_0000017
487 Ga0501070_0014487
488 Ga0501070_0285541
489 Ga0501070_0439640
490 Ga0501072_0016392
491 Ga0501073_0057294
492 Ga0501073_0154123
493 Ga0501074_0080795
494 Ga0501079_0002026
495 Ga0501079_0259140
496 Ga0501080_0000444
497 Ga0501080_0632743
498 Ga0501080_0654265
499 Ga0501083_0113070
500 Ga0501083_0194874
501 Ga0501035_0004489
502 Ga0501035_0018758
503 Ga0501035_0056228
504 Ga0501035_0173213
505 Ga0501035_0287797
506 Ga0501035_0401058
507 Ga0501035_0673965
508 Ga0501035_1025056
509 Ga0501044_0001761
510 Ga0501044_0057834
511 Ga0501044_0064424
512 Ga0501044_0130845
513 Ga0501044_0194167
514 Ga0501044_0391987
515 Ga0501044_0403288
516 Ga0501044_1181274
517 Ga0500655_028606
518 Ga0500559_0053890
519 Ga0500616_0267102
520 Ga0500639_033151
521 Ga0500576_127320
522 Ga0501084_0035878
523 Ga0501082_0384043
524 Ga0501082_0409976

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00460

Flg_bb_rod

Flagella basal body rod protein

28

57

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
7nvg-assembly1.cif.gz_q2 salmonella flagellar basal body refined in c1 map 0.8294 6 44
7nvg-assembly1.cif.gz_l2 salmonella flagellar basal body refined in c1 map 0.8237 6 47
7cbm-assembly1.cif.gz_U cryo-em structure of the flagellar distal rod with partial hook from salmonella 0.8204 6 44
7cgo-assembly1.cif.gz_P cryo-em structure of the flagellar motor-hook complex from salmonella 0.8202 6 44
7cgo-assembly1.cif.gz_N cryo-em structure of the flagellar motor-hook complex from salmonella 0.8174 6 44
ID Description Score Start End Superfamily
af_A4I5B6_12_131_1.10.287.370 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.5999 9 132 1.10.287.370
af_Q8I3Y6_5_111_1.10.287.370 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.5623 8 134 1.10.287.370
af_Q4E4M8_17_118_1.10.287.370 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.5307 8 135 1.10.287.370
af_Q8I3Y6_5_111_1.10.287.370 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.523 8 134 1.10.287.370
af_A4I5B6_12_131_1.10.287.370 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.4852 9 132 1.10.287.370
ID Description Score Start End GO Terms
AF-A0A2R8A9I0-F1-model_v4 Flagellar basal body rod protein FlgB 0.8547 7 135
AF-A0A1N6X415-F1-model_v4 Flagellar basal body rod protein FlgB 0.8481 1 132 GO:0030694
GO:0071978
AF-A0A142X3E7-F1-model_v4 Flagellar basal body rod protein FlgB 0.8399 7 133 GO:0030694
GO:0071973
AF-A0A1N6X415-F1-model_v4 Flagellar basal body rod protein FlgB 0.8213 1 132 GO:0030694
GO:0071978
AF-A0A2P6WCU9-F1-model_v4 Flagellar basal body rod protein FlgB 0.8198 1 132 GO:0030694
GO:0071978

Map