F371066

General Info

Members Datasets Scaffolds Average Seq Length
262 156 524 213

Family's Representative Sequence

Representative Sequence 3300009553|Ga0105249_10327025|Ga0105249_103270252
Length 247
Sequence MSQSSVGNQRLPAEARGASEGGPGAIPSAREVNEAPGDARRIIVDALAAATRPCLTCSFQAEDVAVLHMLLAVKPDIPVLFLDTVHHFAQTYTYRDELARAWNLNLINLRAVEPAPGLWQTSTDACCAKHKVEPLFSALEAYDVWFTGLRRQQSASRANLAVTEPFSLPSGRPITKVSPLAAWTTKDVYTYNKGHAVPLLPLYELGYTSIGCEPCTSVPLDPNDPRSGRWQGQKLECGIHIQPAGKH

Samples

Sample ID Description Type Environment
1 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
44 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
45 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
46 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
47 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
50 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
51 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
61 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
62 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
63 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
64 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
94 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
95 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
96 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
97 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
98 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
99 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
100 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
101 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
102 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
103 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
104 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
105 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
106 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
107 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
108 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
109 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
110 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
111 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
112 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
113 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
114 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
115 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
116 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
117 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
118 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
119 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
120 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
121 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
122 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
123 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
124 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
125 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
126 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
127 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
128 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
129 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
130 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
136 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
137 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
138 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
139 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
140 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
141 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
142 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
143 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
144 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
145 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
146 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
147 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
148 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
149 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
150 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
151 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
152 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
153 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
154 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
155 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
156 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.29
Rhizosphere 96.56
Stem 0
Stem Tuber 0
Unclassified 9.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105249_10327025 3300009553 Bacteria 1546
2 SwRhRL2b_contig_3542673 2162886007 Bacteria 1237
3 Ga0065712_10068454 3300005290 Bacteria 10564
4 Ga0065712_10208505 3300005290 Bacteria 1081
5 Ga0065712_10287985 3300005290 Bacteria 883
6 Ga0065712_10379509 3300005290 Bacteria 754
7 Ga0065715_10331813 3300005293 Unclassified 982
8 Ga0065715_10378561 3300005293 Unclassified 911
9 Ga0065715_10520019 3300005293 Bacteria 764
10 Ga0065707_10177945 3300005295 Bacteria 1437
11 Ga0065707_10229456 3300005295 Bacteria 1187
12 Ga0070658_10119430 3300005327 Bacteria 2190
13 Ga0070683_100000267 3300005329 Bacteria 35857
14 Ga0070670_100047767 3300005331 Bacteria 3683
15 Ga0070670_100319010 3300005331 Bacteria 1361
16 Ga0070689_100445368 3300005340 Bacteria 1101
17 Ga0070691_10119460 3300005341 Bacteria 1326
18 Ga0070661_100035246 3300005344 Bacteria 3633
19 Ga0070668_100431506 3300005347 Bacteria 1130
20 Ga0070675_100052847 3300005354 Bacteria 3341
21 Ga0070675_100629140 3300005354 Bacteria 975
22 Ga0070671_100090066 3300005355 Bacteria 2568
23 Ga0070671_100636155 3300005355 Bacteria 923
24 Ga0070673_100154253 3300005364 Bacteria 1948
25 Ga0070659_100125863 3300005366 Bacteria 2079
26 Ga0070659_100877402 3300005366 Bacteria 783
27 Ga0070667_100277886 3300005367 Bacteria 1503
28 Ga0070667_100467013 3300005367 Bacteria 1154
29 Ga0070713_100081983 3300005436 Bacteria 2753
30 Ga0070701_10002435 3300005438 Bacteria 7177
31 Ga0070711_100481679 3300005439 Bacteria 1020
32 Ga0070694_100000734 3300005444 Bacteria 18310
33 Ga0070694_100137688 3300005444 Bacteria 1770
34 Ga0070694_100296251 3300005444 Unclassified 1238
35 Ga0070694_100337987 3300005444 Bacteria 1163
36 Ga0070708_100037198 3300005445 Bacteria 4246
37 Ga0070663_100036913 3300005455 Bacteria 3398
38 Ga0070678_100542943 3300005456 Unclassified 1031
39 Ga0070662_100058449 3300005457 Bacteria 2806
40 Ga0070681_10258219 3300005458 Bacteria 1654
41 Ga0070685_10353538 3300005466 Bacteria 1005
42 Ga0070706_100753610 3300005467 Unclassified 902
43 Ga0070707_100116706 3300005468 Bacteria 2590
44 Ga0070707_100632632 3300005468 Bacteria 1033
45 Ga0070698_100001371 3300005471 Bacteria 27083
46 Ga0070698_100761203 3300005471 Bacteria 912
47 Ga0070699_100000912 3300005518 Bacteria 27543
48 Ga0070699_100017703 3300005518 Bacteria 6118
49 Ga0070699_100028001 3300005518 Bacteria 4859
50 Ga0070699_100120566 3300005518 Bacteria 2306
51 Ga0070679_100106751 3300005530 Bacteria 2786
52 Ga0070684_100003909 3300005535 Bacteria 11286
53 Ga0070697_100022936 3300005536 Bacteria 4963
54 Ga0070697_101161772 3300005536 Bacteria 688
55 Ga0070695_100159140 3300005545 Bacteria 1583
56 Ga0070695_100202325 3300005545 Bacteria 1420
57 Ga0070696_100009846 3300005546 Bacteria 6393
58 Ga0070693_100694946 3300005547 Unclassified 744
59 Ga0070704_100008054 3300005549 Bacteria 6295
60 Ga0070704_100210496 3300005549 Bacteria 1575
61 Ga0070704_100416348 3300005549 Bacteria 1150
62 Ga0070704_100527224 3300005549 Bacteria 1029
63 Ga0070704_100618424 3300005549 Bacteria 953
64 Ga0070664_100001345 3300005564 Bacteria 19609
65 Ga0068870_10341953 3300005840 Bacteria 957
66 Ga0068858_100005470 3300005842 Bacteria 12432
67 Ga0068860_100336800 3300005843 Bacteria 1483
68 Ga0081539_10017038 3300005985 Bacteria 5133
69 Ga0075428_100002966 3300006844 Bacteria 18502
70 Ga0075428_100003564 3300006844 Bacteria 17047
71 Ga0075428_100245818 3300006844 Bacteria 1929
72 Ga0075430_100024287 3300006846 Bacteria 5157
73 Ga0075430_100047322 3300006846 Bacteria 3631
74 Ga0075430_100116761 3300006846 Bacteria 2224
75 Ga0075430_100414387 3300006846 Bacteria 1112
76 Ga0075431_100020000 3300006847 Bacteria 6835
77 Ga0075431_100069896 3300006847 Bacteria 3622
78 Ga0075431_100179252 3300006847 Bacteria 2175
79 Ga0075431_100252435 3300006847 Bacteria 1792
80 Ga0075431_100328845 3300006847 Bacteria 1540
81 Ga0075433_10020637 3300006852 Bacteria 5513
82 Ga0075433_10076883 3300006852 Bacteria 2940
83 Ga0075434_100010796 3300006871 Bacteria 8579
84 Ga0075434_100198703 3300006871 Bacteria 2025
85 Ga0075434_100407187 3300006871 Bacteria 1381
86 Ga0075434_100488322 3300006871 Bacteria 1252
87 Ga0075434_101008299 3300006871 Bacteria 846
88 Ga0075429_100010413 3300006880 Bacteria 8047
89 Ga0075429_100036491 3300006880 Bacteria 4275
90 Ga0075429_100120775 3300006880 Bacteria 2291
91 Ga0075436_100367910 3300006914 Bacteria 1038
92 Ga0075435_100100928 3300007076 Bacteria 2391
93 Ga0075435_100112504 3300007076 Bacteria 2265
94 Ga0075435_100446082 3300007076 Bacteria 1116
95 Ga0111539_10111190 3300009094 Unclassified 3215
96 Ga0105245_10401118 3300009098 Unclassified 1370
97 Ga0105245_10764730 3300009098 Bacteria 1002
98 Ga0105247_10021272 3300009101 Bacteria 3903
99 Ga0114129_10010753 3300009147 Bacteria 13044
100 Ga0114129_10014899 3300009147 Bacteria 11077
101 Ga0114129_10022809 3300009147 Bacteria 8875
102 Ga0114129_10023683 3300009147 Bacteria 8704
103 Ga0114129_10061956 3300009147 Bacteria 5227
104 Ga0114129_10145365 3300009147 Bacteria 3249
105 Ga0114129_10329400 3300009147 Bacteria 2028
106 Ga0114129_10329940 3300009147 Bacteria 2026
107 Ga0114129_10598708 3300009147 Bacteria 1428
108 Ga0114129_10903121 3300009147 Bacteria 1119
109 Ga0114129_11166151 3300009147 Bacteria 961
110 Ga0105242_10349508 3300009176 Bacteria 1365
111 Ga0105248_10054651 3300009177 Bacteria 4478
112 Ga0105248_10263245 3300009177 Bacteria 1941
113 Ga0105249_10312427 3300009553 Bacteria 1580
114 Ga0157374_10090578 3300013296 Bacteria 2916
115 Ga0157374_10994128 3300013296 Bacteria 858
116 Ga0157375_10037510 3300013308 Bacteria 4644
117 Ga0163163_10236156 3300014325 Bacteria 1877
118 Ga0157379_10024930 3300014968 Bacteria 5308
119 Ga0157376_10285660 3300014969 Bacteria 1556
120 Ga0157376_10369996 3300014969 Unclassified 1377
121 Ga0213875_10000057 3300021388 Bacteria 136082
122 Ga0207710_10079212 3300025900 Bacteria 1521
123 Ga0207684_10645578 3300025910 Unclassified 902
124 Ga0207684_10750055 3300025910 Bacteria 827
125 Ga0207649_10305889 3300025920 Unclassified 1164
126 Ga0207646_10051923 3300025922 Bacteria 3668
127 Ga0207646_10114289 3300025922 Bacteria 2424
128 Ga0207646_10159119 3300025922 Bacteria 2038
129 Ga0207646_10770637 3300025922 Bacteria 858
130 Ga0207681_10106840 3300025923 Bacteria 2029
131 Ga0207650_10017061 3300025925 Bacteria 5082
132 Ga0207650_10339042 3300025925 Bacteria 1234
133 Ga0207659_10908471 3300025926 Bacteria 757
134 Ga0207687_10349093 3300025927 Bacteria 1205
135 Ga0207700_10046230 3300025928 Bacteria 3218
136 Ga0207644_10071083 3300025931 Bacteria 2545
137 Ga0207690_10303631 3300025932 Bacteria 1250
138 Ga0207706_10121217 3300025933 Bacteria 2299
139 Ga0207670_10170668 3300025936 Bacteria 1631
140 Ga0207669_10840014 3300025937 Bacteria 764
141 Ga0207711_10058315 3300025941 Bacteria 3322
142 Ga0207689_10124912 3300025942 Bacteria 2117
143 Ga0207661_10014322 3300025944 Bacteria 5810
144 Ga0207679_10008829 3300025945 Bacteria 6424
145 Ga0207668_10426391 3300025972 Bacteria 1127
146 Ga0207658_10219066 3300025986 Bacteria 1600
147 Ga0207703_10013190 3300026035 Bacteria 6437
148 Ga0207678_10043218 3300026067 Bacteria 3900
149 Ga0207708_10167338 3300026075 Bacteria 1739
150 Ga0207648_10142774 3300026089 Bacteria 2111
151 Ga0207648_10195453 3300026089 Bacteria 1794
152 Ga0207676_10049260 3300026095 Bacteria 3276
153 Ga0207676_10937164 3300026095 Unclassified 851
154 Ga0207675_100698410 3300026118 Unclassified 1023
155 Ga0207698_10371399 3300026142 Bacteria 1358
156 Ga0268265_10467343 3300028380 Unclassified 1182
157 Ga0268264_10171056 3300028381 Bacteria 1965
158 Ga0268264_10230330 3300028381 Bacteria 1711
159 Ga0268264_10856643 3300028381 Bacteria 910
160 Ga0307405_10762457 3300031731 Unclassified 807
161 Ga0307413_10126074 3300031824 Bacteria 1744
162 Ga0307410_10153549 3300031852 Bacteria 1717
163 Ga0307410_10162083 3300031852 Bacteria 1677
164 Ga0307412_10126733 3300031911 Bacteria 1848
165 Ga0307409_100111114 3300031995 Bacteria 2298
166 Ga0307416_100023925 3300032002 Bacteria 4445
167 Ga0307416_100407816 3300032002 Unclassified 1399
168 Ga0307415_100098557 3300032126 Bacteria 2137
169 Ga0373956_0048010 3300035119 Bacteria 1911
170 Ga0373933_0091334 3300035724 Bacteria 1879
171 Ga0373947_0028276 3300035725 Bacteria 3286
172 Ga0373937_0017867 3300036401 Bacteria 6328
173 Ga0373925_0562992 3300037068 Unclassified 938
174 Ga0436364_0232728 3300037853 Bacteria 2835
175 Ga0436364_1102754 3300037853 Bacteria 136103
176 Ga0439453_0075201 3300041408 Bacteria 721
177 Ga0439445_0090821 3300042004 Bacteria 860
178 Ga0450923_002577 3300042125 Bacteria 2620
179 Ga0439446_0086919 3300042156 Bacteria 975
180 Ga0451577_1204392 3300042876 Unclassified 675
181 Ga0451576_0053708 3300045051 Bacteria 4219
182 Ga0451576_0065075 3300045051 Unclassified 3796
183 Ga0495584_0022217 3300046491 Bacteria 3220
184 Ga0495594_0019126 3300046499 Bacteria 3638
185 Ga0495594_0167113 3300046499 Bacteria 1251
186 Ga0495663_0006828 3300046525 Bacteria 3149
187 Ga0495642_0002739 3300046528 Bacteria 7072
188 Ga0495598_0234073 3300046537 Bacteria 675
189 Ga0495621_0004674 3300046539 Bacteria 3873
190 Ga0495597_0143438 3300046542 Bacteria 984
191 Ga0495645_0161114 3300046543 Unclassified 1551
192 Ga0495659_0004757 3300046664 Bacteria 4274
193 Ga0495659_0021856 3300046664 Unclassified 2159
194 Ga0495659_0083773 3300046664 Bacteria 1214
195 Ga0495636_0009202 3300047318 Bacteria 3886
196 Ga0495636_0109651 3300047318 Bacteria 1214
197 Ga0495676_0065352 3300047321 Bacteria 2824
198 Ga0495685_040507 3300047447 Bacteria 1593
199 Ga0496104_0002319 3300048907 Bacteria 16438
200 Ga0496108_0022779 3300048911 Bacteria 5153
201 Ga0496109_0009636 3300048912 Bacteria 8239
202 Ga0496110_0022161 3300048913 Bacteria 5389
203 Ga0496111_0001331 3300048914 Bacteria 13912
204 Ga0496112_0054858 3300048915 Bacteria 3916
205 Ga0501031_0111645 3300049568 Bacteria 1785
206 Ga0501038_0148813 3300049574 Bacteria 1910
207 Ga0501039_0558553 3300049575 Unclassified 898
208 Ga0501040_0117474 3300049576 Bacteria 1864
209 Ga0501042_0037860 3300049578 Bacteria 3424
210 Ga0501071_0033939 3300049587 Bacteria 3628
211 Ga0501072_0159787 3300049588 Bacteria 1797
212 Ga0501073_0194720 3300049589 Bacteria 1402
213 Ga0501073_0457004 3300049589 Bacteria 883
214 Ga0501076_0036067 3300049592 Bacteria 3873
215 Ga0501076_0050860 3300049592 Bacteria 3279
216 Ga0501076_0146787 3300049592 Bacteria 1918
217 Ga0501077_0140990 3300049593 Bacteria 1529
218 Ga0501077_0336134 3300049593 Unclassified 963
219 Ga0501079_0045182 3300049741 Bacteria 3399
220 Ga0501079_0048107 3300049741 Bacteria 3291
221 Ga0501080_0430445 3300049742 Unclassified 1184
222 Ga0501081_0720567 3300049743 Bacteria 749
223 Ga0501283_008448 3300049779 Bacteria 1485
224 Ga0501045_0030389 3300049824 Bacteria 3910
225 Ga0501045_0061632 3300049824 Bacteria 2752
226 nmdc:mga05p37_176647_c1 3300050507 Bacteria 2601
227 nmdc:mga05p37_31659_c1 3300050507 Bacteria 6462
228 nmdc:mga05p37_34799_c1 3300050507 Bacteria 6171
229 nmdc:mga05p37_3579_c1 3300050507 Bacteria 18153
230 nmdc:mga05p37_365165_c1 3300050507 Bacteria 1696
231 nmdc:mga05p37_393424_c1 3300050507 Bacteria 1620
232 nmdc:mga05p37_48759_c1 3300050507 Bacteria 5208
233 nmdc:mga05p37_55254_c1 3300050507 Bacteria 4885
234 nmdc:mga05p37_59980_c2 3300050507 Bacteria 2917
235 nmdc:mga05p37_706079_c1 3300050507 Bacteria 1119
236 nmdc:mga09592_11382_c1 3300050508 Bacteria 7235
237 nmdc:mga09592_31341_c1 3300050508 Bacteria 4430
238 nmdc:mga09592_91917_c1 3300050508 Bacteria 2594
239 nmdc:mga0qj67_62131_c1 3300050509 Bacteria 2968
240 nmdc:mga0qj67_95842_c1 3300050509 Bacteria 2389
241 nmdc:mga06r32_111386_c1 3300050510 Bacteria 2693
242 nmdc:mga06r32_194393_c1 3300050510 Bacteria 2016
243 nmdc:mga06r32_30911_c1 3300050510 Bacteria 5025
244 nmdc:mga06r32_430750_c1 3300050510 Bacteria 1300
245 nmdc:mga06r32_902750_c1 3300050510 Bacteria 840
246 nmdc:mga08y16_172511_c1 3300050511 Bacteria 2246
247 nmdc:mga0n895_137418_c1 3300050512 Bacteria 2471
248 nmdc:mga0n895_15844_c1 3300050512 Bacteria 6893
249 nmdc:mga0n895_216028_c1 3300050512 Bacteria 1947
250 nmdc:mga0n895_216548_c1 3300050512 Bacteria 1945
251 nmdc:mga0n895_268266_c1 3300050512 Bacteria 1731
252 nmdc:mga0rr50_118642_c1 3300050513 Bacteria 2102
253 nmdc:mga0rr50_384999_c1 3300050513 Bacteria 1183
254 nmdc:mga0rr50_92484_c1 3300050513 Bacteria 2358
255 nmdc:mga08x19_97516_c1 3300050514 Bacteria 1946
256 nmdc:mga0a205_13505_c1 3300050515 Bacteria 7606
257 nmdc:mga0a205_19274_c1 3300050515 Bacteria 6429
258 nmdc:mga0a205_503953_c1 3300050515 Bacteria 1067
259 nmdc:mga0a205_9714_c1 3300050515 Bacteria 8811
260 Ga0501084_0535143 3300054114 Bacteria 990
261 Ga0501082_0089889 3300060353 Bacteria 2652
262 Ga0530510_0007192 3300061734 Bacteria 7745
263 Ga0105249_10327025
264 SwRhRL2b_contig_3542673
265 Ga0065712_10068454
266 Ga0065712_10208505
267 Ga0065712_10287985
268 Ga0065712_10379509
269 Ga0065715_10331813
270 Ga0065715_10378561
271 Ga0065715_10520019
272 Ga0065707_10177945
273 Ga0065707_10229456
274 Ga0070658_10119430
275 Ga0070683_100000267
276 Ga0070670_100047767
277 Ga0070670_100319010
278 Ga0070689_100445368
279 Ga0070691_10119460
280 Ga0070661_100035246
281 Ga0070668_100431506
282 Ga0070675_100052847
283 Ga0070675_100629140
284 Ga0070671_100090066
285 Ga0070671_100636155
286 Ga0070673_100154253
287 Ga0070659_100125863
288 Ga0070659_100877402
289 Ga0070667_100277886
290 Ga0070667_100467013
291 Ga0070713_100081983
292 Ga0070701_10002435
293 Ga0070711_100481679
294 Ga0070694_100000734
295 Ga0070694_100137688
296 Ga0070694_100296251
297 Ga0070694_100337987
298 Ga0070708_100037198
299 Ga0070663_100036913
300 Ga0070678_100542943
301 Ga0070662_100058449
302 Ga0070681_10258219
303 Ga0070685_10353538
304 Ga0070706_100753610
305 Ga0070707_100116706
306 Ga0070707_100632632
307 Ga0070698_100001371
308 Ga0070698_100761203
309 Ga0070699_100000912
310 Ga0070699_100017703
311 Ga0070699_100028001
312 Ga0070699_100120566
313 Ga0070679_100106751
314 Ga0070684_100003909
315 Ga0070697_100022936
316 Ga0070697_101161772
317 Ga0070695_100159140
318 Ga0070695_100202325
319 Ga0070696_100009846
320 Ga0070693_100694946
321 Ga0070704_100008054
322 Ga0070704_100210496
323 Ga0070704_100416348
324 Ga0070704_100527224
325 Ga0070704_100618424
326 Ga0070664_100001345
327 Ga0068870_10341953
328 Ga0068858_100005470
329 Ga0068860_100336800
330 Ga0081539_10017038
331 Ga0075428_100002966
332 Ga0075428_100003564
333 Ga0075428_100245818
334 Ga0075430_100024287
335 Ga0075430_100047322
336 Ga0075430_100116761
337 Ga0075430_100414387
338 Ga0075431_100020000
339 Ga0075431_100069896
340 Ga0075431_100179252
341 Ga0075431_100252435
342 Ga0075431_100328845
343 Ga0075433_10020637
344 Ga0075433_10076883
345 Ga0075434_100010796
346 Ga0075434_100198703
347 Ga0075434_100407187
348 Ga0075434_100488322
349 Ga0075434_101008299
350 Ga0075429_100010413
351 Ga0075429_100036491
352 Ga0075429_100120775
353 Ga0075436_100367910
354 Ga0075435_100100928
355 Ga0075435_100112504
356 Ga0075435_100446082
357 Ga0111539_10111190
358 Ga0105245_10401118
359 Ga0105245_10764730
360 Ga0105247_10021272
361 Ga0114129_10010753
362 Ga0114129_10014899
363 Ga0114129_10022809
364 Ga0114129_10023683
365 Ga0114129_10061956
366 Ga0114129_10145365
367 Ga0114129_10329400
368 Ga0114129_10329940
369 Ga0114129_10598708
370 Ga0114129_10903121
371 Ga0114129_11166151
372 Ga0105242_10349508
373 Ga0105248_10054651
374 Ga0105248_10263245
375 Ga0105249_10312427
376 Ga0157374_10090578
377 Ga0157374_10994128
378 Ga0157375_10037510
379 Ga0163163_10236156
380 Ga0157379_10024930
381 Ga0157376_10285660
382 Ga0157376_10369996
383 Ga0213875_10000057
384 Ga0207710_10079212
385 Ga0207684_10645578
386 Ga0207684_10750055
387 Ga0207649_10305889
388 Ga0207646_10051923
389 Ga0207646_10114289
390 Ga0207646_10159119
391 Ga0207646_10770637
392 Ga0207681_10106840
393 Ga0207650_10017061
394 Ga0207650_10339042
395 Ga0207659_10908471
396 Ga0207687_10349093
397 Ga0207700_10046230
398 Ga0207644_10071083
399 Ga0207690_10303631
400 Ga0207706_10121217
401 Ga0207670_10170668
402 Ga0207669_10840014
403 Ga0207711_10058315
404 Ga0207689_10124912
405 Ga0207661_10014322
406 Ga0207679_10008829
407 Ga0207668_10426391
408 Ga0207658_10219066
409 Ga0207703_10013190
410 Ga0207678_10043218
411 Ga0207708_10167338
412 Ga0207648_10142774
413 Ga0207648_10195453
414 Ga0207676_10049260
415 Ga0207676_10937164
416 Ga0207675_100698410
417 Ga0207698_10371399
418 Ga0268265_10467343
419 Ga0268264_10171056
420 Ga0268264_10230330
421 Ga0268264_10856643
422 Ga0307405_10762457
423 Ga0307413_10126074
424 Ga0307410_10153549
425 Ga0307410_10162083
426 Ga0307412_10126733
427 Ga0307409_100111114
428 Ga0307416_100023925
429 Ga0307416_100407816
430 Ga0307415_100098557
431 Ga0373956_0048010
432 Ga0373933_0091334
433 Ga0373947_0028276
434 Ga0373937_0017867
435 Ga0373925_0562992
436 Ga0436364_0232728
437 Ga0436364_1102754
438 Ga0439453_0075201
439 Ga0439445_0090821
440 Ga0450923_002577
441 Ga0439446_0086919
442 Ga0451577_1204392
443 Ga0451576_0053708
444 Ga0451576_0065075
445 Ga0495584_0022217
446 Ga0495594_0019126
447 Ga0495594_0167113
448 Ga0495663_0006828
449 Ga0495642_0002739
450 Ga0495598_0234073
451 Ga0495621_0004674
452 Ga0495597_0143438
453 Ga0495645_0161114
454 Ga0495659_0004757
455 Ga0495659_0021856
456 Ga0495659_0083773
457 Ga0495636_0009202
458 Ga0495636_0109651
459 Ga0495676_0065352
460 Ga0495685_040507
461 Ga0496104_0002319
462 Ga0496108_0022779
463 Ga0496109_0009636
464 Ga0496110_0022161
465 Ga0496111_0001331
466 Ga0496112_0054858
467 Ga0501031_0111645
468 Ga0501038_0148813
469 Ga0501039_0558553
470 Ga0501040_0117474
471 Ga0501042_0037860
472 Ga0501071_0033939
473 Ga0501072_0159787
474 Ga0501073_0194720
475 Ga0501073_0457004
476 Ga0501076_0036067
477 Ga0501076_0050860
478 Ga0501076_0146787
479 Ga0501077_0140990
480 Ga0501077_0336134
481 Ga0501079_0045182
482 Ga0501079_0048107
483 Ga0501080_0430445
484 Ga0501081_0720567
485 Ga0501283_008448
486 Ga0501045_0030389
487 Ga0501045_0061632
488 nmdc:mga05p37_176647_c1
489 nmdc:mga05p37_31659_c1
490 nmdc:mga05p37_34799_c1
491 nmdc:mga05p37_3579_c1
492 nmdc:mga05p37_365165_c1
493 nmdc:mga05p37_393424_c1
494 nmdc:mga05p37_48759_c1
495 nmdc:mga05p37_55254_c1
496 nmdc:mga05p37_59980_c2
497 nmdc:mga05p37_706079_c1
498 nmdc:mga09592_11382_c1
499 nmdc:mga09592_31341_c1
500 nmdc:mga09592_91917_c1
501 nmdc:mga0qj67_62131_c1
502 nmdc:mga0qj67_95842_c1
503 nmdc:mga06r32_111386_c1
504 nmdc:mga06r32_194393_c1
505 nmdc:mga06r32_30911_c1
506 nmdc:mga06r32_430750_c1
507 nmdc:mga06r32_902750_c1
508 nmdc:mga08y16_172511_c1
509 nmdc:mga0n895_137418_c1
510 nmdc:mga0n895_15844_c1
511 nmdc:mga0n895_216028_c1
512 nmdc:mga0n895_216548_c1
513 nmdc:mga0n895_268266_c1
514 nmdc:mga0rr50_118642_c1
515 nmdc:mga0rr50_384999_c1
516 nmdc:mga0rr50_92484_c1
517 nmdc:mga08x19_97516_c1
518 nmdc:mga0a205_13505_c1
519 nmdc:mga0a205_19274_c1
520 nmdc:mga0a205_503953_c1
521 nmdc:mga0a205_9714_c1
522 Ga0501084_0535143
523 Ga0501082_0089889
524 Ga0530510_0007192

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01507

PAPS_reduct

Phosphoadenosine phosphosulfate reductase family

52

218

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
2o8v-assembly1.cif.gz_A paps reductase in a covalent complex with thioredoxin c35a 0.9099 9 182
7lhu-assembly1.cif.gz_A crystal structure of adenosine-5'-phosphosulfate reductase from mycobacterium tuberculosis in a complex with product amp 0.9081 9 187
7lhs-assembly1.cif.gz_A crystal structure of adenosine-5'-phosphosulfate reductase from mycobacterium tuberculosis in a complex with substrate aps 0.9072 9 187
6vpu-assembly8.cif.gz_H 1.90 angstrom resolution crystal structure phosphoadenosine phosphosulfate reductase (cysh) from vibrio vulnificus 0.9067 8 188
7lhs-assembly2.cif.gz_B crystal structure of adenosine-5'-phosphosulfate reductase from mycobacterium tuberculosis in a complex with substrate aps 0.9003 6 189
ID Description Score Start End Superfamily
af_P9WIK3_10_254_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9111 6 211 3.40.50.620
af_P17854_2_216_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9054 9 183 3.40.50.620
af_Q60377_225_441_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8868 4 182 3.40.50.620
2oq2D00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8762 9 210 3.40.50.620
2goyE00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8746 5 203 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A7W1PDH3-F1-model_v4 Phosphoadenosine phosphosulfate reductase family protein 0.9979 10 142 GO:0004604
GO:0005737
GO:0019379
AF-A0A7V4A288-F1-model_v4 Phosphoadenylyl-sulfate reductase (EC 1.8.4.8) 0.9878 4 189 GO:0004604
GO:0005737
GO:0019379
AF-A0A7Y5WSP3-F1-model_v4 Adenosine 5'-phosphosulfate reductase (APS reductase) (EC 1.8.4.10) (5'-adenylylsulfate reductase) (Thioredoxin-dependent 5'-adenylylsulfate reductase) 0.9868 8 214 GO:0004604
GO:0005737
GO:0019379
GO:0046872
GO:0051539
GO:0070814
AF-A0A7X2TZ32-F1-model_v4 Adenosine 5'-phosphosulfate reductase (APS reductase) (EC 1.8.4.10) (5'-adenylylsulfate reductase) (Thioredoxin-dependent 5'-adenylylsulfate reductase) 0.9758 5 212 GO:0004604
GO:0005737
GO:0019379
GO:0046872
GO:0051539
GO:0070814
AF-A0A372IMM3-F1-model_v4 Adenosine 5'-phosphosulfate reductase (APS reductase) (EC 1.8.4.10) (5'-adenylylsulfate reductase) (Thioredoxin-dependent 5'-adenylylsulfate reductase) 0.9746 5 212 GO:0004604
GO:0005737
GO:0019379
GO:0043866
GO:0046872
GO:0051539
GO:0070814

Map