F370976

General Info

Members Datasets Scaffolds Average Seq Length
262 193 262 194

Family's Representative Sequence

Representative Sequence 3300005983|Ga0081540_1078057|Ga0081540_10780572
Length 203
Sequence MIALVAGDVAVRRPDHVVIETAGGVGYRLAVSSETLRQVPGVGRAASLHTHLVVRDDALALYGFATEEERDLFLALIGVQSVGPKVALAVLSGIEPQELIRAIERGDLARLTAIPGVGKKTSERLVVELKDRLPRAQVAVAAADEAAPTAPALRDDVVSALVNLGYHRPLAEKAAEAAIKTLGPSPDAGFERMLKQALRELAK

Samples

Sample ID Description Type Environment
1 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
38 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
39 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
40 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
41 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
42 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
43 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
44 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
47 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
48 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
59 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
60 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
61 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
62 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
99 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
100 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
101 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
102 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
103 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
104 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
105 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
106 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
107 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
108 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
109 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
110 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
111 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
112 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
113 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
114 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
115 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
116 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
117 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
118 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
119 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
120 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
121 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
122 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
123 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
124 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
125 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
126 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
127 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
128 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
129 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
130 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
131 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
132 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
133 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
134 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
135 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
136 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
137 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
138 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
139 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
140 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
141 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
142 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
143 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
144 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
145 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
146 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
147 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
148 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
149 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
150 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
151 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
152 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
153 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
154 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
155 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
156 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
157 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
158 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
159 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
160 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
161 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
162 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
163 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
176 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
177 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
178 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
179 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
180 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
181 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
182 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
183 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
185 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
186 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
187 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
188 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
189 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
190 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
191 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
192 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
193 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.91
Nodule 0
Rhizoplane 14.12
Rhizosphere 83.59
Stem 0
Stem Tuber 0
Unclassified 0.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25404J52841_10000695 3300003659 Bacteria 5186
2 Ga0070683_100029530 3300005329 Bacteria 4965
3 Ga0070683_100057003 3300005329 Bacteria 3629
4 Ga0070670_100065738 3300005331 Bacteria 3112
5 Ga0070670_100270138 3300005331 Bacteria 1484
6 Ga0070680_100396713 3300005336 Bacteria 1176
7 Ga0068868_100005244 3300005338 Bacteria 9098
8 Ga0068868_100127150 3300005338 Bacteria 2083
9 Ga0070689_100006918 3300005340 Bacteria 7896
10 Ga0070687_100033574 3300005343 Bacteria 2534
11 Ga0070692_10160484 3300005345 Bacteria 1288
12 Ga0070668_100074176 3300005347 Bacteria 2654
13 Ga0070668_100094221 3300005347 Bacteria 2364
14 Ga0070669_100058689 3300005353 Bacteria 2824
15 Ga0070674_100000007 3300005356 Bacteria 145531
16 Ga0070674_100013181 3300005356 Bacteria 5102
17 Ga0070688_100191058 3300005365 Bacteria 1426
18 Ga0070659_100528275 3300005366 Bacteria 1008
19 Ga0070667_100184478 3300005367 Bacteria 1846
20 Ga0070714_101306946 3300005435 Bacteria 708
21 Ga0070713_100617657 3300005436 Bacteria 1031
22 Ga0070713_100824022 3300005436 Unclassified 890
23 Ga0070701_10004733 3300005438 Bacteria 5555
24 Ga0070711_100102386 3300005439 Bacteria 2086
25 Ga0070711_100426915 3300005439 Bacteria 1081
26 Ga0070705_100099721 3300005440 Bacteria 1831
27 Ga0070700_100945458 3300005441 Bacteria 705
28 Ga0070706_100463441 3300005467 Bacteria 1179
29 Ga0070698_100036699 3300005471 Bacteria 5060
30 Ga0070697_100009170 3300005536 Bacteria 7730
31 Ga0068853_100272575 3300005539 Bacteria 1559
32 Ga0070672_100164442 3300005543 Bacteria 1843
33 Ga0070704_100030902 3300005549 Bacteria 3595
34 Ga0070664_100106302 3300005564 Bacteria 2445
35 Ga0070664_100386176 3300005564 Bacteria 1279
36 Ga0068854_100858565 3300005578 Bacteria 795
37 Ga0068856_100088242 3300005614 Bacteria 3084
38 Ga0068856_100623229 3300005614 Bacteria 1099
39 Ga0070702_100056938 3300005615 Bacteria 2260
40 Ga0068852_100355826 3300005616 Bacteria 1431
41 Ga0068866_10000003 3300005718 Bacteria 281675
42 Ga0068866_10031971 3300005718 Bacteria 2540
43 Ga0068866_10036564 3300005718 Bacteria 2406
44 Ga0068861_100034663 3300005719 Bacteria 3734
45 Ga0068861_100042593 3300005719 Bacteria 3403
46 Ga0068851_10095910 3300005834 Bacteria 1568
47 Ga0068863_100171851 3300005841 Bacteria 2079
48 Ga0068863_100975746 3300005841 Bacteria 849
49 Ga0068860_100386422 3300005843 Bacteria 1382
50 Ga0081455_10010460 3300005937 Bacteria 9413
51 Ga0081455_10106353 3300005937 Bacteria 2239
52 Ga0081540_1000100 3300005983 Bacteria 91640
53 Ga0081540_1002140 3300005983 Bacteria 16438
54 Ga0081540_1078057 3300005983 Bacteria 1503
55 Ga0081539_10016382 3300005985 Bacteria 5298
56 Ga0081539_10090119 3300005985 Bacteria 1587
57 Ga0070717_10766905 3300006028 Bacteria 877
58 Ga0075365_10354019 3300006038 Bacteria 1035
59 Ga0075363_100203690 3300006048 Bacteria 1131
60 Ga0075364_10412688 3300006051 Bacteria 921
61 Ga0075431_100241858 3300006847 Bacteria 1836
62 Ga0075434_100000097 3300006871 Bacteria 48724
63 Ga0075436_100000341 3300006914 Bacteria 29776
64 Ga0075436_100398145 3300006914 Bacteria 997
65 Ga0075435_100000149 3300007076 Bacteria 39747
66 Ga0075435_100542473 3300007076 Bacteria 1007
67 Ga0105247_10098294 3300009101 Bacteria 1868
68 Ga0105247_10192256 3300009101 Bacteria 1367
69 Ga0114129_10177852 3300009147 Bacteria 2897
70 Ga0105243_10013883 3300009148 Bacteria 6098
71 Ga0105242_10262839 3300009176 Bacteria 1560
72 Ga0105242_10702475 3300009176 Bacteria 990
73 Ga0105238_11019618 3300009551 Bacteria 849
74 Ga0105249_10638233 3300009553 Bacteria 1122
75 Ga0105246_10159439 3300011119 Bacteria 1717
76 Ga0157369_10305679 3300013105 Bacteria 1654
77 Ga0157372_10308564 3300013307 Bacteria 1841
78 Ga0157375_10090838 3300013308 Bacteria 3114
79 Ga0157375_10188698 3300013308 Bacteria 2216
80 Ga0163163_10348751 3300014325 Bacteria 1536
81 Ga0157380_10114714 3300014326 Bacteria 2271
82 Ga0157380_10119077 3300014326 Bacteria 2233
83 Ga0157379_10136811 3300014968 Bacteria 2207
84 Ga0182007_10068491 3300015262 Bacteria 1163
85 Ga0207656_10038925 3300025321 Bacteria 2008
86 Ga0207642_10000002 3300025899 Bacteria 658166
87 Ga0207642_10113499 3300025899 Bacteria 1384
88 Ga0207710_10027892 3300025900 Bacteria 2449
89 Ga0207643_10011784 3300025908 Bacteria 4719
90 Ga0207663_10033961 3300025916 Bacteria 3045
91 Ga0207663_10068490 3300025916 Bacteria 2279
92 Ga0207660_10205262 3300025917 Bacteria 1541
93 Ga0207660_10530216 3300025917 Bacteria 957
94 Ga0207662_10066255 3300025918 Bacteria 2176
95 Ga0207681_10789873 3300025923 Bacteria 793
96 Ga0207681_10908400 3300025923 Bacteria 737
97 Ga0207650_10011965 3300025925 Bacteria 5981
98 Ga0207650_10183452 3300025925 Bacteria 1669
99 Ga0207687_10011791 3300025927 Bacteria 5718
100 Ga0207664_10194635 3300025929 Bacteria 1747
101 Ga0207644_10227055 3300025931 Bacteria 1482
102 Ga0207690_10304951 3300025932 Bacteria 1247
103 Ga0207706_10073720 3300025933 Bacteria 3002
104 Ga0207686_10046573 3300025934 Bacteria 2676
105 Ga0207686_10115531 3300025934 Bacteria 1818
106 Ga0207709_10025114 3300025935 Bacteria 3409
107 Ga0207709_10030752 3300025935 Bacteria 3127
108 Ga0207670_10005811 3300025936 Bacteria 6811
109 Ga0207670_10029904 3300025936 Bacteria 3474
110 Ga0207669_10000001 3300025937 Bacteria 377747
111 Ga0207669_10010275 3300025937 Bacteria 4501
112 Ga0207704_10199373 3300025938 Bacteria 1463
113 Ga0207691_10252374 3300025940 Bacteria 1522
114 Ga0207661_10141694 3300025944 Bacteria 2069
115 Ga0207679_10030054 3300025945 Bacteria 3790
116 Ga0207679_10463872 3300025945 Bacteria 1125
117 Ga0207668_10021641 3300025972 Bacteria 4104
118 Ga0207668_10059144 3300025972 Bacteria 2683
119 Ga0207640_11121894 3300025981 Bacteria 696
120 Ga0207658_10201760 3300025986 Bacteria 1661
121 Ga0207677_10120797 3300026023 Bacteria 1970
122 Ga0207677_10703531 3300026023 Bacteria 897
123 Ga0207639_10015804 3300026041 Bacteria 5329
124 Ga0207639_10123635 3300026041 Bacteria 2130
125 Ga0207708_10096966 3300026075 Bacteria 2279
126 Ga0207641_10151090 3300026088 Bacteria 2103
127 Ga0207641_10160663 3300026088 Bacteria 2043
128 Ga0207641_10427124 3300026088 Bacteria 1277
129 Ga0207641_10752323 3300026088 Bacteria 962
130 Ga0207676_10152972 3300026095 Bacteria 1989
131 Ga0207674_10230612 3300026116 Bacteria 1799
132 Ga0207675_100055856 3300026118 Bacteria 3684
133 Ga0207683_10068028 3300026121 Bacteria 3143
134 Ga0207683_10312819 3300026121 Bacteria 1438
135 Ga0207698_10371516 3300026142 Bacteria 1358
136 Ga0268265_10010217 3300028380 Bacteria 6337
137 Ga0268264_10146677 3300028381 Bacteria 2111
138 Ga0268264_10493834 3300028381 Bacteria 1193
139 Ga0307405_10178831 3300031731 Bacteria 1521
140 Ga0373930_0028582 3300034816 Bacteria 1135
141 Ga0373948_0034350 3300034817 Bacteria 1036
142 Ga0373950_0012487 3300034818 Bacteria 1402
143 Ga0373959_0027007 3300034820 Bacteria 1137
144 Ga0373938_0000206 3300034957 Bacteria 8908
145 Ga0373928_0003859 3300035084 Bacteria 2859
146 Ga0373940_0004281 3300035088 Bacteria 3005
147 Ga0373949_0005185 3300035090 Bacteria 2922
148 Ga0373951_0000641 3300035091 Bacteria 9649
149 Ga0373952_0001452 3300035092 Bacteria 4312
150 Ga0373932_0000234 3300035112 Bacteria 16783
151 Ga0373939_0005279 3300035114 Bacteria 3072
152 Ga0373941_0000681 3300035115 Bacteria 6910
153 Ga0373960_0002502 3300035121 Bacteria 4132
154 Ga0373942_0001609 3300035207 Bacteria 5780
155 Ga0373961_0002109 3300035241 Bacteria 5278
156 Ga0373962_0001193 3300035242 Bacteria 6081
157 Ga0373931_0073623 3300035691 Bacteria 1869
158 Ga0373947_0212551 3300035725 Bacteria 1269
159 Ga0395898_0231990 3300037466 Bacteria 1760
160 Ga0451800_1677076 3300041459 Bacteria 772
161 Ga0466963_0087561 3300044694 Bacteria 2118
162 Ga0466960_0096266 3300044901 Bacteria 1517
163 Ga0466960_0549813 3300044901 Bacteria 681
164 Ga0451576_0023088 3300045051 Bacteria 6740
165 Ga0466958_0023118 3300045836 Bacteria 3646
166 Ga0466967_0000001 3300045976 Bacteria 229823
167 Ga0466967_0182373 3300045976 Bacteria 1981
168 Ga0495603_0192042 3300046455 Bacteria 1181
169 Ga0495582_0260966 3300046473 Bacteria 994
170 Ga0495605_0086047 3300046474 Bacteria 1463
171 Ga0495594_0285822 3300046499 Bacteria 940
172 Ga0495596_0085786 3300046500 Bacteria 1222
173 Ga0495610_0055328 3300046512 Bacteria 1913
174 Ga0495620_0092536 3300046515 Bacteria 1212
175 Ga0495628_0356588 3300046516 Bacteria 1074
176 Ga0495637_0072143 3300046520 Bacteria 1391
177 Ga0495643_0285832 3300046522 Bacteria 757
178 Ga0495665_0243289 3300046531 Bacteria 927
179 Ga0495640_0082037 3300046533 Bacteria 2143
180 Ga0495586_0000083 3300046535 Bacteria 57851
181 Ga0495621_0001691 3300046539 Bacteria 5781
182 Ga0495661_0327534 3300046665 Bacteria 760
183 Ga0495588_0177074 3300046674 Bacteria 1127
184 Ga0495646_0046517 3300046680 Bacteria 2645
185 Ga0495613_0131514 3300046689 Bacteria 1792
186 Ga0495674_0002248 3300047319 Bacteria 18976
187 Ga0495675_0083360 3300047444 Bacteria 2012
188 Ga0495686_0351173 3300047472 Bacteria 802
189 Ga0496100_0022031 3300048903 Bacteria 3849
190 Ga0496101_0156992 3300048904 Bacteria 1743
191 Ga0496102_0569776 3300048905 Bacteria 1055
192 Ga0496102_0627765 3300048905 Bacteria 998
193 Ga0496103_0048447 3300048906 Bacteria 2626
194 Ga0496103_0297748 3300048906 Bacteria 1038
195 Ga0496103_0314741 3300048906 Bacteria 1007
196 Ga0496104_0000765 3300048907 Bacteria 27516
197 Ga0496104_0082622 3300048907 Bacteria 3063
198 Ga0496105_0012055 3300048908 Bacteria 6842
199 Ga0496105_0712590 3300048908 Bacteria 769
200 Ga0496106_0063421 3300048909 Bacteria 2808
201 Ga0496106_0181687 3300048909 Bacteria 1670
202 Ga0496106_0515766 3300048909 Bacteria 960
203 Ga0496107_0030536 3300048910 Bacteria 3841
204 Ga0496108_0000063 3300048911 Bacteria 118950
205 Ga0496108_0001817 3300048911 Bacteria 17023
206 Ga0496108_0048904 3300048911 Bacteria 3536
207 Ga0496108_0049057 3300048911 Bacteria 3531
208 Ga0496109_0000012 3300048912 Bacteria 229699
209 Ga0496109_0019933 3300048912 Bacteria 5919
210 Ga0496109_0089581 3300048912 Bacteria 2844
211 Ga0496109_0211909 3300048912 Bacteria 1822
212 Ga0496110_0000925 3300048913 Bacteria 20585
213 Ga0496110_0210037 3300048913 Bacteria 1769
214 Ga0496110_1100838 3300048913 Bacteria 702
215 Ga0496111_0021008 3300048914 Bacteria 4552
216 Ga0496111_0034040 3300048914 Bacteria 3636
217 Ga0496111_0687885 3300048914 Bacteria 745
218 Ga0496112_0042069 3300048915 Bacteria 4471
219 Ga0496112_0250972 3300048915 Bacteria 1720
220 Ga0496113_0083815 3300048916 Bacteria 2446
221 Ga0496113_0164603 3300048916 Bacteria 1754
222 Ga0496113_0394839 3300048916 Bacteria 1110
223 Ga0496114_0207699 3300048917 Bacteria 1717
224 Ga0496115_0061855 3300048918 Bacteria 3019
225 Ga0496121_0001035 3300048924 Bacteria 49640
226 Ga0501031_0034770 3300049568 Bacteria 3288
227 Ga0501032_0316024 3300049569 Bacteria 1008
228 Ga0501033_0003925 3300049570 Bacteria 12063
229 Ga0501034_0507847 3300049571 Bacteria 1118
230 Ga0501036_0025360 3300049572 Bacteria 5001
231 Ga0501037_0022603 3300049573 Bacteria 4650
232 Ga0501038_0021156 3300049574 Bacteria 5843
233 Ga0501039_0009096 3300049575 Bacteria 7572
234 Ga0501043_0027399 3300049579 Bacteria 4473
235 Ga0501046_0007168 3300049580 Bacteria 9811
236 Ga0501047_0157443 3300049581 Bacteria 2144
237 Ga0501047_0355700 3300049581 Bacteria 1301
238 Ga0501048_0006124 3300049582 Bacteria 9168
239 Ga0501067_0015622 3300049583 Bacteria 4202
240 Ga0501067_0237622 3300049583 Bacteria 1014
241 Ga0501068_0013576 3300049584 Bacteria 4637
242 Ga0501069_0017148 3300049585 Bacteria 3894
243 Ga0501070_0017785 3300049586 Bacteria 5969
244 Ga0501070_0024035 3300049586 Bacteria 5110
245 Ga0501070_0075995 3300049586 Bacteria 2780
246 Ga0501071_0058880 3300049587 Bacteria 2778
247 Ga0501073_0037037 3300049589 Bacteria 3465
248 Ga0501080_0007821 3300049742 Bacteria 9670
249 Ga0501080_0677287 3300049742 Bacteria 911
250 Ga0501083_0015143 3300049744 Bacteria 5399
251 Ga0501035_0094033 3300049822 Bacteria 2636
252 Ga0501045_0219622 3300049824 Bacteria 1415
253 nmdc:mga09592_310735_c1 3300050508 Bacteria 1366
254 nmdc:mga08y16_420509_c1 3300050511 Bacteria 1366
255 nmdc:mga0n895_501128_c1 3300050512 Bacteria 1223
256 Ga0495601_0022253 3300053077 Bacteria 3890
257 Ga0495601_0149078 3300053077 Bacteria 1527
258 Ga0495655_0000002 3300053083 Bacteria 312752
259 Ga0500556_0002355 3300053104 Bacteria 6140
260 Ga0500628_000001 3300053129 Bacteria 564074
261 Ga0501084_0038216 3300054114 Bacteria 4013
262 Ga0501082_0029258 3300060353 Bacteria 4744

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009147 Ga0114129_10177852 Ga0114129_101778523 154
2 3300050508 nmdc:mga09592_310735_c1 nmdc:mga09592_310735_c1_430_1029 154
3 3300005356 Ga0070674_100000007 Ga0070674_100000007142 159
4 3300005718 Ga0068866_10000003 Ga0068866_10000003284 159
5 3300025899 Ga0207642_10000002 Ga0207642_10000002534 159
6 3300025937 Ga0207669_10000001 Ga0207669_100000018 159
7 3300026121 Ga0207683_10068028 Ga0207683_100680284 160
8 3300005366 Ga0070659_100528275 Ga0070659_1005282752 167
9 3300025944 Ga0207661_10141694 Ga0207661_101416943 167
10 3300025945 Ga0207679_10463872 Ga0207679_104638722 167
11 3300005467 Ga0070706_100463441 Ga0070706_1004634411 168
12 3300044901 Ga0466960_0549813 Ga0466960_0549813_57_653 169
13 3300046535 Ga0495586_0000083 Ga0495586_0000083_5515_6114 172
14 3300048907 Ga0496104_0000765 Ga0496104_0000765_10519_11118 172
15 3300048908 Ga0496105_0012055 Ga0496105_0012055_4374_4973 172
16 3300053077 Ga0495601_0022253 Ga0495601_0022253_2452_3051 172
17 3300034817 Ga0373948_0034350 Ga0373948_0034350_361_969 175
18 3300034818 Ga0373950_0012487 Ga0373950_0012487_412_1020 175
19 3300034820 Ga0373959_0027007 Ga0373959_0027007_451_1059 175
20 3300034957 Ga0373938_0000206 Ga0373938_0000206_2530_3138 175
21 3300035084 Ga0373928_0003859 Ga0373928_0003859_1847_2455 175
22 3300035088 Ga0373940_0004281 Ga0373940_0004281_802_1410 175
23 3300035090 Ga0373949_0005185 Ga0373949_0005185_2171_2779 175
24 3300035091 Ga0373951_0000641 Ga0373951_0000641_8381_8989 175
25 3300035092 Ga0373952_0001452 Ga0373952_0001452_2111_2719 175
26 3300035112 Ga0373932_0000234 Ga0373932_0000234_10410_11018 175
27 3300035114 Ga0373939_0005279 Ga0373939_0005279_2082_2690 175
28 3300035115 Ga0373941_0000681 Ga0373941_0000681_6032_6640 175
29 3300035121 Ga0373960_0002502 Ga0373960_0002502_3117_3725 175
30 3300035207 Ga0373942_0001609 Ga0373942_0001609_2556_3164 175
31 3300035241 Ga0373961_0002109 Ga0373961_0002109_2663_3271 175
32 3300035242 Ga0373962_0001193 Ga0373962_0001193_3331_3939 175
33 3300035691 Ga0373931_0073623 Ga0373931_0073623_1199_1807 175
34 3300005347 Ga0070668_100074176 Ga0070668_1000741762 176
35 3300005719 Ga0068861_100034663 Ga0068861_1000346635 176
36 3300009553 Ga0105249_10638233 Ga0105249_106382332 176
37 3300025972 Ga0207668_10021641 Ga0207668_100216415 176
38 3300046499 Ga0495594_0285822 Ga0495594_0285822_12_548 176
39 3300053077 Ga0495601_0149078 Ga0495601_0149078_564_1160 181
40 3300015262 Ga0182007_10068491 Ga0182007_100684912 184
41 3300034816 Ga0373930_0028582 Ga0373930_0028582_514_1119 184
42 3300045051 Ga0451576_0023088 Ga0451576_0023088_5997_6602 184
43 3300005331 Ga0070670_100270138 Ga0070670_1002701382 185
44 3300005347 Ga0070668_100094221 Ga0070668_1000942213 185
45 3300005353 Ga0070669_100058689 Ga0070669_1000586893 185
46 3300005356 Ga0070674_100013181 Ga0070674_1000131817 185
47 3300005440 Ga0070705_100099721 Ga0070705_1000997212 185
48 3300005441 Ga0070700_100945458 Ga0070700_1009454581 185
49 3300005471 Ga0070698_100036699 Ga0070698_1000366997 185
50 3300005536 Ga0070697_100009170 Ga0070697_1000091704 185
51 3300005718 Ga0068866_10031971 Ga0068866_100319712 185
52 3300005719 Ga0068861_100042593 Ga0068861_1000425932 185
53 3300005841 Ga0068863_100975746 Ga0068863_1009757462 185
54 3300006871 Ga0075434_100000097 Ga0075434_10000009715 185
55 3300006914 Ga0075436_100000341 Ga0075436_10000034114 185
56 3300006914 Ga0075436_100398145 Ga0075436_1003981451 185
57 3300007076 Ga0075435_100000149 Ga0075435_10000014915 185
58 3300009148 Ga0105243_10013883 Ga0105243_100138833 185
59 3300011119 Ga0105246_10159439 Ga0105246_101594392 185
60 3300014325 Ga0163163_10348751 Ga0163163_103487512 185
61 3300014326 Ga0157380_10119077 Ga0157380_101190773 185
62 3300025917 Ga0207660_10530216 Ga0207660_105302162 185
63 3300025923 Ga0207681_10908400 Ga0207681_109084001 185
64 3300025925 Ga0207650_10011965 Ga0207650_100119652 185
65 3300025925 Ga0207650_10183452 Ga0207650_101834522 185
66 3300025933 Ga0207706_10073720 Ga0207706_100737203 185
67 3300025934 Ga0207686_10046573 Ga0207686_100465732 185
68 3300025935 Ga0207709_10030752 Ga0207709_100307524 185
69 3300025937 Ga0207669_10010275 Ga0207669_100102755 185
70 3300025938 Ga0207704_10199373 Ga0207704_101993732 185
71 3300025940 Ga0207691_10252374 Ga0207691_102523742 185
72 3300025972 Ga0207668_10059144 Ga0207668_100591444 185
73 3300026088 Ga0207641_10160663 Ga0207641_101606632 185
74 3300026088 Ga0207641_10752323 Ga0207641_107523232 185
75 3300026118 Ga0207675_100055856 Ga0207675_1000558561 185
76 3300028380 Ga0268265_10010217 Ga0268265_100102175 185
77 3300028381 Ga0268264_10493834 Ga0268264_104938342 185
78 3300005331 Ga0070670_100065738 Ga0070670_1000657385 186
79 3300046680 Ga0495646_0046517 Ga0495646_0046517_254_847 186
80 3300005983 Ga0081540_1078057 Ga0081540_10780572 187
81 3300005336 Ga0070680_100396713 Ga0070680_1003967131 191
82 3300005343 Ga0070687_100033574 Ga0070687_1000335742 191
83 3300005345 Ga0070692_10160484 Ga0070692_101604842 191
84 3300005365 Ga0070688_100191058 Ga0070688_1001910581 191
85 3300005438 Ga0070701_10004733 Ga0070701_100047335 191
86 3300005539 Ga0068853_100272575 Ga0068853_1002725753 191
87 3300005543 Ga0070672_100164442 Ga0070672_1001644422 191
88 3300005549 Ga0070704_100030902 Ga0070704_1000309024 191
89 3300005564 Ga0070664_100106302 Ga0070664_1001063022 191
90 3300005718 Ga0068866_10036564 Ga0068866_100365643 191
91 3300005834 Ga0068851_10095910 Ga0068851_100959102 191
92 3300005843 Ga0068860_100386422 Ga0068860_1003864222 191
93 3300009101 Ga0105247_10098294 Ga0105247_100982942 191
94 3300009176 Ga0105242_10262839 Ga0105242_102628392 191
95 3300013307 Ga0157372_10308564 Ga0157372_103085642 191
96 3300014326 Ga0157380_10114714 Ga0157380_101147143 191
97 3300014968 Ga0157379_10136811 Ga0157379_101368113 191
98 3300025321 Ga0207656_10038925 Ga0207656_100389252 191
99 3300025899 Ga0207642_10113499 Ga0207642_101134992 191
100 3300025900 Ga0207710_10027892 Ga0207710_100278922 191
101 3300025908 Ga0207643_10011784 Ga0207643_100117842 191
102 3300025917 Ga0207660_10205262 Ga0207660_102052622 191
103 3300025918 Ga0207662_10066255 Ga0207662_100662552 191
104 3300025927 Ga0207687_10011791 Ga0207687_100117913 191
105 3300025931 Ga0207644_10227055 Ga0207644_102270553 191
106 3300025932 Ga0207690_10304951 Ga0207690_103049512 191
107 3300025934 Ga0207686_10115531 Ga0207686_101155313 191
108 3300025935 Ga0207709_10025114 Ga0207709_100251144 191
109 3300025936 Ga0207670_10029904 Ga0207670_100299043 191
110 3300025945 Ga0207679_10030054 Ga0207679_100300542 191
111 3300026041 Ga0207639_10123635 Ga0207639_101236352 191
112 3300026075 Ga0207708_10096966 Ga0207708_100969662 191
113 3300026088 Ga0207641_10427124 Ga0207641_104271242 191
114 3300026095 Ga0207676_10152972 Ga0207676_101529723 191
115 3300026116 Ga0207674_10230612 Ga0207674_102306122 191
116 3300026121 Ga0207683_10312819 Ga0207683_103128192 191
117 3300028381 Ga0268264_10146677 Ga0268264_101466772 191
118 3300045976 Ga0466967_0182373 Ga0466967_0182373_1333_1917 191
119 3300048904 Ga0496101_0156992 Ga0496101_0156992_1119_1703 191
120 3300048906 Ga0496103_0048447 Ga0496103_0048447_1019_1603 191
121 3300048907 Ga0496104_0082622 Ga0496104_0082622_1181_1765 191
122 3300048908 Ga0496105_0712590 Ga0496105_0712590_23_607 191
123 3300048909 Ga0496106_0063421 Ga0496106_0063421_1508_2092 191
124 3300048911 Ga0496108_0048904 Ga0496108_0048904_2638_3222 191
125 3300048912 Ga0496109_0089581 Ga0496109_0089581_1576_2160 191
126 3300048916 Ga0496113_0083815 Ga0496113_0083815_191_775 191
127 3300048916 Ga0496113_0394839 Ga0496113_0394839_191_775 191
128 3300048918 Ga0496115_0061855 Ga0496115_0061855_1613_2197 191
129 3300050511 nmdc:mga08y16_420509_c1 nmdc:mga08y16_420509_c1_219_803 191
130 3300050512 nmdc:mga0n895_501128_c1 nmdc:mga0n895_501128_c1_611_1192 191
131 3300005338 Ga0068868_100127150 Ga0068868_1001271502 192
132 3300005435 Ga0070714_101306946 Ga0070714_1013069461 192
133 3300005436 Ga0070713_100617657 Ga0070713_1006176572 192
134 3300005564 Ga0070664_100386176 Ga0070664_1003861762 192
135 3300005578 Ga0068854_100858565 Ga0068854_1008585652 192
136 3300005614 Ga0068856_100088242 Ga0068856_1000882422 192
137 3300005614 Ga0068856_100623229 Ga0068856_1006232292 192
138 3300005615 Ga0070702_100056938 Ga0070702_1000569382 192
139 3300005616 Ga0068852_100355826 Ga0068852_1003558262 192
140 3300005937 Ga0081455_10010460 Ga0081455_100104608 192
141 3300005937 Ga0081455_10106353 Ga0081455_101063532 192
142 3300005983 Ga0081540_1002140 Ga0081540_10021406 192
143 3300005985 Ga0081539_10016382 Ga0081539_100163823 192
144 3300005985 Ga0081539_10090119 Ga0081539_100901192 192
145 3300006028 Ga0070717_10766905 Ga0070717_107669052 192
146 3300006048 Ga0075363_100203690 Ga0075363_1002036902 192
147 3300006847 Ga0075431_100241858 Ga0075431_1002418581 192
148 3300009176 Ga0105242_10702475 Ga0105242_107024752 192
149 3300009551 Ga0105238_11019618 Ga0105238_110196182 192
150 3300013105 Ga0157369_10305679 Ga0157369_103056792 192
151 3300025923 Ga0207681_10789873 Ga0207681_107898732 192
152 3300025929 Ga0207664_10194635 Ga0207664_101946353 192
153 3300025981 Ga0207640_11121894 Ga0207640_111218941 192
154 3300026023 Ga0207677_10120797 Ga0207677_101207972 192
155 3300026023 Ga0207677_10703531 Ga0207677_107035312 192
156 3300026142 Ga0207698_10371516 Ga0207698_103715162 192
157 3300031731 Ga0307405_10178831 Ga0307405_101788312 192
158 3300035725 Ga0373947_0212551 Ga0373947_0212551_349_933 192
159 3300044694 Ga0466963_0087561 Ga0466963_0087561_677_1279 192
160 3300044901 Ga0466960_0096266 Ga0466960_0096266_267_848 192
161 3300046455 Ga0495603_0192042 Ga0495603_0192042_141_725 192
162 3300046473 Ga0495582_0260966 Ga0495582_0260966_380_964 192
163 3300046474 Ga0495605_0086047 Ga0495605_0086047_280_864 192
164 3300046500 Ga0495596_0085786 Ga0495596_0085786_486_1070 192
165 3300046515 Ga0495620_0092536 Ga0495620_0092536_312_896 192
166 3300046520 Ga0495637_0072143 Ga0495637_0072143_709_1293 192
167 3300046522 Ga0495643_0285832 Ga0495643_0285832_99_683 192
168 3300046531 Ga0495665_0243289 Ga0495665_0243289_224_808 192
169 3300046665 Ga0495661_0327534 Ga0495661_0327534_82_666 192
170 3300046674 Ga0495588_0177074 Ga0495588_0177074_401_985 192
171 3300048903 Ga0496100_0022031 Ga0496100_0022031_2219_2803 192
172 3300048905 Ga0496102_0627765 Ga0496102_0627765_124_708 192
173 3300048906 Ga0496103_0297748 Ga0496103_0297748_124_708 192
174 3300048909 Ga0496106_0181687 Ga0496106_0181687_93_677 192
175 3300048909 Ga0496106_0515766 Ga0496106_0515766_100_684 192
176 3300048911 Ga0496108_0001817 Ga0496108_0001817_12716_13300 192
177 3300048911 Ga0496108_0049057 Ga0496108_0049057_211_795 192
178 3300048912 Ga0496109_0019933 Ga0496109_0019933_2193_2777 192
179 3300048912 Ga0496109_0211909 Ga0496109_0211909_227_826 192
180 3300048913 Ga0496110_0000925 Ga0496110_0000925_2176_2760 192
181 3300048913 Ga0496110_0210037 Ga0496110_0210037_671_1255 192
182 3300048914 Ga0496111_0034040 Ga0496111_0034040_1113_1697 192
183 3300048914 Ga0496111_0687885 Ga0496111_0687885_125_709 192
184 3300048915 Ga0496112_0042069 Ga0496112_0042069_203_787 192
185 3300048915 Ga0496112_0250972 Ga0496112_0250972_1068_1652 192
186 3300048917 Ga0496114_0207699 Ga0496114_0207699_804_1388 192
187 3300048924 Ga0496121_0001035 Ga0496121_0001035_13466_14050 192
188 3300049568 Ga0501031_0034770 Ga0501031_0034770_1233_1814 192
189 3300049569 Ga0501032_0316024 Ga0501032_0316024_246_827 192
190 3300049570 Ga0501033_0003925 Ga0501033_0003925_4141_4722 192
191 3300049571 Ga0501034_0507847 Ga0501034_0507847_313_894 192
192 3300049572 Ga0501036_0025360 Ga0501036_0025360_1986_2567 192
193 3300049573 Ga0501037_0022603 Ga0501037_0022603_2379_2960 192
194 3300049574 Ga0501038_0021156 Ga0501038_0021156_2052_2633 192
195 3300049575 Ga0501039_0009096 Ga0501039_0009096_5955_6536 192
196 3300049579 Ga0501043_0027399 Ga0501043_0027399_374_955 192
197 3300049580 Ga0501046_0007168 Ga0501046_0007168_3023_3604 192
198 3300049581 Ga0501047_0157443 Ga0501047_0157443_84_665 192
199 3300049582 Ga0501048_0006124 Ga0501048_0006124_1916_2497 192
200 3300049583 Ga0501067_0015622 Ga0501067_0015622_891_1472 192
201 3300049583 Ga0501067_0237622 Ga0501067_0237622_60_647 192
202 3300049584 Ga0501068_0013576 Ga0501068_0013576_204_785 192
203 3300049585 Ga0501069_0017148 Ga0501069_0017148_1727_2308 192
204 3300049586 Ga0501070_0017785 Ga0501070_0017785_5076_5657 192
205 3300049586 Ga0501070_0075995 Ga0501070_0075995_1406_1984 192
206 3300049587 Ga0501071_0058880 Ga0501071_0058880_1848_2429 192
207 3300049589 Ga0501073_0037037 Ga0501073_0037037_2052_2633 192
208 3300049742 Ga0501080_0007821 Ga0501080_0007821_6359_6940 192
209 3300049742 Ga0501080_0677287 Ga0501080_0677287_208_786 192
210 3300049744 Ga0501083_0015143 Ga0501083_0015143_1908_2489 192
211 3300049822 Ga0501035_0094033 Ga0501035_0094033_313_894 192
212 3300049824 Ga0501045_0219622 Ga0501045_0219622_35_616 192
213 3300053104 Ga0500556_0002355 Ga0500556_0002355_1869_2456 192
214 3300054114 Ga0501084_0038216 Ga0501084_0038216_293_874 192
215 3300060353 Ga0501082_0029258 Ga0501082_0029258_1877_2458 192
216 3300003659 JGI25404J52841_10000695 JGI25404J52841_100006952 195
217 3300005329 Ga0070683_100029530 Ga0070683_1000295303 195
218 3300005329 Ga0070683_100057003 Ga0070683_1000570032 195
219 3300005338 Ga0068868_100005244 Ga0068868_1000052443 195
220 3300005340 Ga0070689_100006918 Ga0070689_1000069184 195
221 3300005367 Ga0070667_100184478 Ga0070667_1001844782 195
222 3300005436 Ga0070713_100824022 Ga0070713_1008240221 195
223 3300005439 Ga0070711_100102386 Ga0070711_1001023863 195
224 3300005439 Ga0070711_100426915 Ga0070711_1004269152 195
225 3300005841 Ga0068863_100171851 Ga0068863_1001718512 195
226 3300005983 Ga0081540_1000100 Ga0081540_100010018 195
227 3300006038 Ga0075365_10354019 Ga0075365_103540192 195
228 3300006051 Ga0075364_10412688 Ga0075364_104126882 195
229 3300007076 Ga0075435_100542473 Ga0075435_1005424731 195
230 3300009101 Ga0105247_10192256 Ga0105247_101922562 195
231 3300013308 Ga0157375_10090838 Ga0157375_100908383 195
232 3300013308 Ga0157375_10188698 Ga0157375_101886982 195
233 3300025916 Ga0207663_10033961 Ga0207663_100339615 195
234 3300025916 Ga0207663_10068490 Ga0207663_100684903 195
235 3300025936 Ga0207670_10005811 Ga0207670_100058113 195
236 3300025986 Ga0207658_10201760 Ga0207658_102017602 195
237 3300026041 Ga0207639_10015804 Ga0207639_100158048 195
238 3300026088 Ga0207641_10151090 Ga0207641_101510902 195
239 3300037466 Ga0395898_0231990 Ga0395898_0231990_315_914 195
240 3300041459 Ga0451800_1677076 Ga0451800_1677076_155_754 195
241 3300045836 Ga0466958_0023118 Ga0466958_0023118_833_1429 195
242 3300045976 Ga0466967_0000001 Ga0466967_0000001_133233_133829 195
243 3300046512 Ga0495610_0055328 Ga0495610_0055328_131_727 195
244 3300046516 Ga0495628_0356588 Ga0495628_0356588_140_736 195
245 3300046533 Ga0495640_0082037 Ga0495640_0082037_950_1546 195
246 3300046539 Ga0495621_0001691 Ga0495621_0001691_3309_3908 195
247 3300046689 Ga0495613_0131514 Ga0495613_0131514_156_749 195
248 3300047319 Ga0495674_0002248 Ga0495674_0002248_5058_5654 195
249 3300047444 Ga0495675_0083360 Ga0495675_0083360_978_1577 195
250 3300047472 Ga0495686_0351173 Ga0495686_0351173_120_716 195
251 3300048905 Ga0496102_0569776 Ga0496102_0569776_412_1005 195
252 3300048906 Ga0496103_0314741 Ga0496103_0314741_87_680 195
253 3300048910 Ga0496107_0030536 Ga0496107_0030536_1034_1630 195
254 3300048911 Ga0496108_0000063 Ga0496108_0000063_71007_71603 195
255 3300048912 Ga0496109_0000012 Ga0496109_0000012_41144_41740 195
256 3300048913 Ga0496110_1100838 Ga0496110_1100838_90_686 195
257 3300048914 Ga0496111_0021008 Ga0496111_0021008_1207_1803 195
258 3300048916 Ga0496113_0164603 Ga0496113_0164603_650_1249 195
259 3300049581 Ga0501047_0355700 Ga0501047_0355700_317_913 195
260 3300049586 Ga0501070_0024035 Ga0501070_0024035_520_1116 195
261 3300053083 Ga0495655_0000002 Ga0495655_0000002_137155_137751 195
262 3300053129 Ga0500628_000001 Ga0500628_000001_225824_226420 195

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01330

RuvA_N

RuvA N terminal domain

1

63

0.97

PF07499

RuvA_C

RuvA, C-terminal domain

152

202

0.94

PF14520

HHH_5

Helix-hairpin-helix domain

73

131

0.87

Feature Viewer

pLDDT pTM Quality
86.11 0.49 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map