F370974

General Info

Members Datasets Scaffolds Average Seq Length
262 172 524 78

Family's Representative Sequence

Representative Sequence 3300005981|Ga0081538_10165005|Ga0081538_101650052
Length 87
Sequence MSENPMPGRSSLLRSLLGPDGPELSCEECFAALDRYVELELSGADADAHVPGMRAHLEGCKACDEDHRSLRALMETGMASAPPPPQD

Samples

Sample ID Description Type Environment
1 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
12 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
20 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
21 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
22 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
23 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
28 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
29 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
30 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
31 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
32 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
33 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
34 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
35 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
36 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
37 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
38 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
41 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
43 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
44 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
45 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
46 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
47 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
48 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
49 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
50 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
51 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
76 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
77 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
78 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
79 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
80 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
81 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
82 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
83 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
84 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
85 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
86 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
87 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
88 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
89 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
90 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
91 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
92 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
93 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
94 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
95 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
96 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
97 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
98 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
99 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
100 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
101 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
102 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
103 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
104 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
105 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
106 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
107 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
108 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
109 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
110 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
111 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
112 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
113 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
114 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
115 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
116 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
117 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
118 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
119 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
120 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
121 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
122 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
123 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
124 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
125 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
126 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
127 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
128 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
129 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
130 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
131 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
132 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
146 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
147 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
148 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
149 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
150 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
151 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
152 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
153 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
154 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
155 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
156 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
157 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
158 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
161 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
162 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
163 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
164 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
165 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
166 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
167 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
168 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
169 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
170 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
171 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
172 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.53
Nodule 0
Rhizoplane 7.63
Rhizosphere 89.31
Stem 0
Stem Tuber 0
Unclassified 17.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081538_10165005 3300005981 Bacteria 977
2 Ga0070658_10785689 3300005327 Bacteria 827
3 Ga0070683_100264347 3300005329 Bacteria 1637
4 Ga0070683_100869440 3300005329 Bacteria 865
5 Ga0070680_100275799 3300005336 Unclassified 1424
6 Ga0070680_100806559 3300005336 Bacteria 809
7 Ga0070680_101487425 3300005336 Bacteria 587
8 Ga0070660_100004555 3300005339 Bacteria 9580
9 Ga0070660_101414694 3300005339 Bacteria 591
10 Ga0070668_101060083 3300005347 Bacteria 730
11 Ga0070675_101599518 3300005354 Unclassified 601
12 Ga0070659_100020081 3300005366 Bacteria 5073
13 Ga0070659_101237469 3300005366 Bacteria 661
14 Ga0070714_100043074 3300005435 Bacteria 3816
15 Ga0070708_100009239 3300005445 Bacteria 7949
16 Ga0070663_100929650 3300005455 Bacteria 753
17 Ga0070662_100214511 3300005457 Bacteria 1533
18 Ga0070662_101197894 3300005457 Bacteria 653
19 Ga0070681_10003725 3300005458 Bacteria 14308
20 Ga0070681_11000527 3300005458 Bacteria 756
21 Ga0070681_11930658 3300005458 Unclassified 518
22 Ga0070707_100851359 3300005468 Bacteria 876
23 Ga0070698_100285880 3300005471 Bacteria 1580
24 Ga0070699_101047637 3300005518 Unclassified 748
25 Ga0070679_100015933 3300005530 Bacteria 7237
26 Ga0070679_100021864 3300005530 Bacteria 6248
27 Ga0070679_102074469 3300005530 Unclassified 518
28 Ga0070684_100310598 3300005535 Bacteria 1448
29 Ga0070684_101340532 3300005535 Bacteria 674
30 Ga0070672_100625342 3300005543 Bacteria 939
31 Ga0070695_100778576 3300005545 Unclassified 765
32 Ga0070696_100019876 3300005546 Bacteria 4553
33 Ga0070696_100113421 3300005546 Bacteria 1954
34 Ga0070693_101088097 3300005547 Unclassified 609
35 Ga0070704_102258684 3300005549 Bacteria 506
36 Ga0068855_100061879 3300005563 Bacteria 4372
37 Ga0068856_102071003 3300005614 Unclassified 579
38 Ga0068859_101048342 3300005617 Unclassified 896
39 Ga0068861_102507550 3300005719 Bacteria 519
40 Ga0081455_10062418 3300005937 Bacteria 3132
41 Ga0081455_10141135 3300005937 Bacteria 1871
42 Ga0081538_10170594 3300005981 Bacteria 950
43 Ga0070717_10052452 3300006028 Bacteria 3360
44 Ga0075365_10005157 3300006038 Bacteria 7021
45 Ga0075364_10230070 3300006051 Unclassified 1259
46 Ga0068871_101513212 3300006358 Bacteria 634
47 Ga0075428_100392336 3300006844 Bacteria 1488
48 Ga0075428_101373297 3300006844 Unclassified 742
49 Ga0075430_100000901 3300006846 Bacteria 23300
50 Ga0075430_100157431 3300006846 Bacteria 1891
51 Ga0075430_100679105 3300006846 Bacteria 849
52 Ga0075431_100034621 3300006847 Bacteria 5203
53 Ga0075429_100003962 3300006880 Bacteria 12662
54 Ga0075429_100236239 3300006880 Bacteria 1601
55 Ga0068865_101329136 3300006881 Bacteria 640
56 Ga0068865_101854985 3300006881 Bacteria 545
57 Ga0097620_101048467 3300006931 Unclassified 896
58 Ga0111539_10019732 3300009094 Bacteria 8314
59 Ga0111539_10163223 3300009094 Bacteria 2606
60 Ga0105245_10262229 3300009098 Bacteria 1682
61 Ga0114129_10023150 3300009147 Bacteria 8811
62 Ga0114129_10038766 3300009147 Bacteria 6718
63 Ga0114129_10387314 3300009147 Bacteria 1845
64 Ga0105239_10264370 3300010375 Bacteria 1934
65 Ga0157341_1045880 3300012494 Unclassified 520
66 Ga0157373_10144905 3300013100 Bacteria 1670
67 Ga0157373_10676713 3300013100 Unclassified 755
68 Ga0157369_11349887 3300013105 Unclassified 726
69 Ga0157369_12045844 3300013105 Bacteria 581
70 Ga0157374_10025813 3300013296 Bacteria 5281
71 Ga0157372_10396579 3300013307 Bacteria 1608
72 Ga0157375_10092451 3300013308 Bacteria 3089
73 Ga0157380_11324076 3300014326 Unclassified 768
74 Ga0213874_10016940 3300021377 Bacteria 1948
75 Ga0207699_10246511 3300025906 Bacteria 1229
76 Ga0207707_10027636 3300025912 Bacteria 4960
77 Ga0207693_10652005 3300025915 Bacteria 818
78 Ga0207663_11685770 3300025916 Bacteria 510
79 Ga0207660_11286062 3300025917 Unclassified 594
80 Ga0207657_10008184 3300025919 Bacteria 10654
81 Ga0207657_10324510 3300025919 Bacteria 1217
82 Ga0207652_10125280 3300025921 Bacteria 2288
83 Ga0207652_10345040 3300025921 Unclassified 1344
84 Ga0207652_11670814 3300025921 Unclassified 541
85 Ga0207659_11174894 3300025926 Unclassified 660
86 Ga0207687_10714684 3300025927 Bacteria 851
87 Ga0207664_10016766 3300025929 Bacteria 5352
88 Ga0207690_10013932 3300025932 Bacteria 4845
89 Ga0207706_10053795 3300025933 Bacteria 3553
90 Ga0207686_11267877 3300025934 Unclassified 604
91 Ga0207709_10686052 3300025935 Bacteria 818
92 Ga0207704_11880193 3300025938 Bacteria 515
93 Ga0207665_10903340 3300025939 Bacteria 701
94 Ga0207691_11099839 3300025940 Unclassified 661
95 Ga0207661_10062414 3300025944 Bacteria 3015
96 Ga0207661_10215980 3300025944 Bacteria 1693
97 Ga0207667_10053930 3300025949 Bacteria 4229
98 Ga0207668_11142319 3300025972 Bacteria 699
99 Ga0207639_11383981 3300026041 Bacteria 660
100 Ga0207678_10279887 3300026067 Bacteria 1432
101 Ga0207702_12001768 3300026078 Bacteria 570
102 Ga0207675_101767467 3300026118 Bacteria 638
103 Ga0307405_10029988 3300031731 Bacteria 3185
104 Ga0307410_11867852 3300031852 Unclassified 534
105 Ga0307406_10512891 3300031901 Unclassified 974
106 Ga0307409_100474546 3300031995 Bacteria 1212
107 Ga0307416_100043263 3300032002 Bacteria 3525
108 Ga0307415_100001641 3300032126 Bacteria 10833
109 Ga0373957_0094053 3300035120 Unclassified 1194
110 Ga0373955_0186313 3300035172 Bacteria 1233
111 Ga0373933_0066857 3300035724 Bacteria 2179
112 Ga0373937_0100169 3300036401 Bacteria 2688
113 Ga0395898_0054694 3300037466 Bacteria 3894
114 Ga0395898_1452551 3300037466 Bacteria 613
115 Ga0436364_0409665 3300037853 Bacteria 38199
116 Ga0395901_1800063 3300038443 Unclassified 562
117 Ga0436365_1481009 3300039437 Bacteria 10435
118 Ga0436363_1222598 3300039450 Bacteria 8059
119 Ga0436362_1251813 3300039453 Unclassified 1605
120 Ga0466972_0144106 3300044658 Bacteria 1121
121 Ga0466966_0042989 3300044684 Bacteria 2898
122 Ga0466963_0069396 3300044694 Bacteria 2369
123 Ga0466964_0106964 3300044706 Bacteria 1242
124 Ga0466964_0115409 3300044706 Bacteria 1203
125 Ga0466968_0044248 3300044735 Bacteria 1887
126 Ga0466957_0968363 3300044842 Unclassified 610
127 Ga0466960_0148567 3300044901 Bacteria 1250
128 Ga0466960_0560467 3300044901 Bacteria 675
129 Ga0466959_0069199 3300045049 Bacteria 2558
130 Ga0466959_0901517 3300045049 Bacteria 590
131 Ga0466958_0037722 3300045836 Bacteria 2896
132 Ga0466967_0333161 3300045976 Bacteria 1466
133 Ga0466967_0478070 3300045976 Bacteria 1220
134 Ga0466967_1627262 3300045976 Bacteria 643
135 Ga0495603_0102133 3300046455 Bacteria 1674
136 Ga0495629_0384888 3300046459 Bacteria 954
137 Ga0495651_0437330 3300046462 Unclassified 847
138 Ga0495653_0018210 3300046463 Bacteria 5707
139 Ga0495618_0226300 3300046514 Unclassified 1179
140 Ga0495618_0663479 3300046514 Bacteria 616
141 Ga0495628_0606971 3300046516 Bacteria 781
142 Ga0495667_0008077 3300046559 Bacteria 7142
143 Ga0495634_0118011 3300046642 Bacteria 1701
144 Ga0495634_0179462 3300046642 Unclassified 1326
145 Ga0495635_0098024 3300046663 Bacteria 2004
146 Ga0495657_0015073 3300046675 Bacteria 5666
147 Ga0495623_0684822 3300046679 Unclassified 526
148 Ga0495646_0709273 3300046680 Unclassified 505
149 Ga0495624_0000007 3300046690 Bacteria 146202
150 Ga0495600_0062395 3300046809 Bacteria 2435
151 Ga0495604_0130843 3300047317 Bacteria 1804
152 Ga0495674_0019352 3300047319 Bacteria 6318
153 Ga0495680_0007510 3300047322 Bacteria 9985
154 Ga0495680_0019716 3300047322 Bacteria 5689
155 Ga0495684_0005954 3300047471 Bacteria 9473
156 Ga0496100_0754419 3300048903 Bacteria 761
157 Ga0496100_1230078 3300048903 Unclassified 591
158 Ga0496101_0010656 3300048904 Bacteria 6075
159 Ga0496101_0846035 3300048904 Bacteria 721
160 Ga0496103_1063276 3300048906 Bacteria 502
161 Ga0496104_0584624 3300048907 Bacteria 1027
162 Ga0496105_0270271 3300048908 Bacteria 1373
163 Ga0496107_0351795 3300048910 Bacteria 1096
164 Ga0496108_0144621 3300048911 Bacteria 2049
165 Ga0496109_0000044 3300048912 Bacteria 133779
166 Ga0496109_0074517 3300048912 Bacteria 3120
167 Ga0496109_0832813 3300048912 Bacteria 861
168 Ga0496110_0043186 3300048913 Bacteria 3936
169 Ga0496110_0381837 3300048913 Bacteria 1284
170 Ga0496111_0789908 3300048914 Bacteria 687
171 Ga0496113_0325119 3300048916 Bacteria 1233
172 Ga0496113_1403147 3300048916 Bacteria 541
173 Ga0496114_0057872 3300048917 Bacteria 3236
174 Ga0496114_0939029 3300048917 Bacteria 747
175 Ga0496115_0136760 3300048918 Bacteria 2020
176 Ga0501031_0147043 3300049568 Unclassified 1540
177 Ga0501031_0682461 3300049568 Bacteria 660
178 Ga0501032_1068346 3300049569 Bacteria 506
179 Ga0501033_0347875 3300049570 Unclassified 1039
180 Ga0501036_0031261 3300049572 Bacteria 4499
181 Ga0501036_0218671 3300049572 Bacteria 1600
182 Ga0501037_0761364 3300049573 Bacteria 641
183 Ga0501038_0356156 3300049574 Bacteria 1139
184 Ga0501039_0078077 3300049575 Bacteria 2575
185 Ga0501040_0165513 3300049576 Bacteria 1564
186 Ga0501040_0186323 3300049576 Bacteria 1472
187 Ga0501040_1169891 3300049576 Bacteria 558
188 Ga0501040_1171757 3300049576 Unclassified 558
189 Ga0501041_0332951 3300049577 Bacteria 958
190 Ga0501042_0140318 3300049578 Bacteria 1742
191 Ga0501043_1229102 3300049579 Bacteria 525
192 Ga0501043_1307241 3300049579 Bacteria 506
193 Ga0501046_0422481 3300049580 Bacteria 961
194 Ga0501048_0654830 3300049582 Unclassified 754
195 Ga0501048_1015196 3300049582 Bacteria 597
196 Ga0501067_0090971 3300049583 Bacteria 1694
197 Ga0501068_0257996 3300049584 Bacteria 1112
198 Ga0501070_0403592 3300049586 Bacteria 1105
199 Ga0501071_0006988 3300049587 Bacteria 7371
200 Ga0501071_0190841 3300049587 Bacteria 1537
201 Ga0501071_0338835 3300049587 Bacteria 1143
202 Ga0501071_0341393 3300049587 Bacteria 1139
203 Ga0501071_0615631 3300049587 Unclassified 835
204 Ga0501071_1162609 3300049587 Unclassified 596
205 Ga0501072_0006336 3300049588 Bacteria 9013
206 Ga0501072_0195999 3300049588 Bacteria 1611
207 Ga0501072_0471897 3300049588 Bacteria 993
208 Ga0501072_1181509 3300049588 Bacteria 594
209 Ga0501073_1235632 3300049589 Unclassified 513
210 Ga0501074_0427780 3300049590 Bacteria 939
211 Ga0501074_0745161 3300049590 Bacteria 691
212 Ga0501074_0891876 3300049590 Bacteria 626
213 Ga0501074_1049682 3300049590 Bacteria 573
214 Ga0501074_1136661 3300049590 Bacteria 548
215 Ga0501075_0074794 3300049591 Bacteria 2562
216 Ga0501075_0184190 3300049591 Bacteria 1593
217 Ga0501076_0205065 3300049592 Bacteria 1610
218 Ga0501076_0423526 3300049592 Bacteria 1095
219 Ga0501077_0196665 3300049593 Bacteria 1281
220 Ga0501079_0016003 3300049741 Bacteria 5731
221 Ga0501079_0125731 3300049741 Bacteria 1995
222 Ga0501079_0931226 3300049741 Bacteria 684
223 Ga0501080_0382005 3300049742 Unclassified 1269
224 Ga0501080_1296150 3300049742 Unclassified 624
225 Ga0501080_1517572 3300049742 Bacteria 569
226 Ga0501081_0077181 3300049743 Bacteria 2327
227 Ga0501081_0617682 3300049743 Bacteria 812
228 Ga0501081_0750200 3300049743 Bacteria 733
229 Ga0501081_0851543 3300049743 Bacteria 687
230 Ga0501035_0260317 3300049822 Bacteria 1471
231 Ga0501035_1308205 3300049822 Bacteria 559
232 Ga0501044_1533247 3300049823 Bacteria 531
233 Ga0501045_0087374 3300049824 Bacteria 2302
234 Ga0501045_0464165 3300049824 Bacteria 941
235 Ga0501045_0838189 3300049824 Bacteria 676
236 nmdc:mga00v17_335690_c1 3300050491 Bacteria 982
237 nmdc:mga0yw44_227767_c1 3300050492 Bacteria 1237
238 nmdc:mga05p37_108145_c1 3300050507 Bacteria 3421
239 nmdc:mga05p37_227920_c1 3300050507 Bacteria 2246
240 nmdc:mga05p37_592873_c1 3300050507 Bacteria 1252
241 nmdc:mga09592_2886_c1 3300050508 Bacteria 13929
242 nmdc:mga09592_441182_c1 3300050508 Unclassified 1123
243 nmdc:mga0qj67_45029_c1 3300050509 Bacteria 3481
244 nmdc:mga0qj67_540524_c1 3300050509 Bacteria 935
245 nmdc:mga0qj67_73285_c1 3300050509 Bacteria 2735
246 nmdc:mga06r32_1336731_c1 3300050510 Bacteria 660
247 nmdc:mga06r32_1966932_c1 3300050510 Bacteria 519
248 nmdc:mga06r32_224241_c1 3300050510 Bacteria 1868
249 nmdc:mga08y16_13376_c1 3300050511 Bacteria 8632
250 Ga0495595_0022705 3300053084 Bacteria 2756
251 Ga0495619_0045917 3300053085 Bacteria 2871
252 Ga0501084_0056686 3300054114 Bacteria 3278
253 Ga0501084_0214475 3300054114 Bacteria 1624
254 Ga0501084_1476147 3300054114 Unclassified 569
255 Ga0501084_1722197 3300054114 Bacteria 524
256 Ga0501082_0018104 3300060353 Bacteria 6067
257 Ga0501082_0243834 3300060353 Bacteria 1564
258 Ga0530510_0009765 3300061734 Bacteria 6735
259 Ga0530510_0050964 3300061734 Bacteria 2990
260 Ga0530510_0108829 3300061734 Bacteria 2029
261 Ga0530510_0358248 3300061734 Bacteria 1096
262 Ga0530510_0940652 3300061734 Bacteria 661
263 Ga0081538_10165005
264 Ga0070658_10785689
265 Ga0070683_100264347
266 Ga0070683_100869440
267 Ga0070680_100275799
268 Ga0070680_100806559
269 Ga0070680_101487425
270 Ga0070660_100004555
271 Ga0070660_101414694
272 Ga0070668_101060083
273 Ga0070675_101599518
274 Ga0070659_100020081
275 Ga0070659_101237469
276 Ga0070714_100043074
277 Ga0070708_100009239
278 Ga0070663_100929650
279 Ga0070662_100214511
280 Ga0070662_101197894
281 Ga0070681_10003725
282 Ga0070681_11000527
283 Ga0070681_11930658
284 Ga0070707_100851359
285 Ga0070698_100285880
286 Ga0070699_101047637
287 Ga0070679_100015933
288 Ga0070679_100021864
289 Ga0070679_102074469
290 Ga0070684_100310598
291 Ga0070684_101340532
292 Ga0070672_100625342
293 Ga0070695_100778576
294 Ga0070696_100019876
295 Ga0070696_100113421
296 Ga0070693_101088097
297 Ga0070704_102258684
298 Ga0068855_100061879
299 Ga0068856_102071003
300 Ga0068859_101048342
301 Ga0068861_102507550
302 Ga0081455_10062418
303 Ga0081455_10141135
304 Ga0081538_10170594
305 Ga0070717_10052452
306 Ga0075365_10005157
307 Ga0075364_10230070
308 Ga0068871_101513212
309 Ga0075428_100392336
310 Ga0075428_101373297
311 Ga0075430_100000901
312 Ga0075430_100157431
313 Ga0075430_100679105
314 Ga0075431_100034621
315 Ga0075429_100003962
316 Ga0075429_100236239
317 Ga0068865_101329136
318 Ga0068865_101854985
319 Ga0097620_101048467
320 Ga0111539_10019732
321 Ga0111539_10163223
322 Ga0105245_10262229
323 Ga0114129_10023150
324 Ga0114129_10038766
325 Ga0114129_10387314
326 Ga0105239_10264370
327 Ga0157341_1045880
328 Ga0157373_10144905
329 Ga0157373_10676713
330 Ga0157369_11349887
331 Ga0157369_12045844
332 Ga0157374_10025813
333 Ga0157372_10396579
334 Ga0157375_10092451
335 Ga0157380_11324076
336 Ga0213874_10016940
337 Ga0207699_10246511
338 Ga0207707_10027636
339 Ga0207693_10652005
340 Ga0207663_11685770
341 Ga0207660_11286062
342 Ga0207657_10008184
343 Ga0207657_10324510
344 Ga0207652_10125280
345 Ga0207652_10345040
346 Ga0207652_11670814
347 Ga0207659_11174894
348 Ga0207687_10714684
349 Ga0207664_10016766
350 Ga0207690_10013932
351 Ga0207706_10053795
352 Ga0207686_11267877
353 Ga0207709_10686052
354 Ga0207704_11880193
355 Ga0207665_10903340
356 Ga0207691_11099839
357 Ga0207661_10062414
358 Ga0207661_10215980
359 Ga0207667_10053930
360 Ga0207668_11142319
361 Ga0207639_11383981
362 Ga0207678_10279887
363 Ga0207702_12001768
364 Ga0207675_101767467
365 Ga0307405_10029988
366 Ga0307410_11867852
367 Ga0307406_10512891
368 Ga0307409_100474546
369 Ga0307416_100043263
370 Ga0307415_100001641
371 Ga0373957_0094053
372 Ga0373955_0186313
373 Ga0373933_0066857
374 Ga0373937_0100169
375 Ga0395898_0054694
376 Ga0395898_1452551
377 Ga0436364_0409665
378 Ga0395901_1800063
379 Ga0436365_1481009
380 Ga0436363_1222598
381 Ga0436362_1251813
382 Ga0466972_0144106
383 Ga0466966_0042989
384 Ga0466963_0069396
385 Ga0466964_0106964
386 Ga0466964_0115409
387 Ga0466968_0044248
388 Ga0466957_0968363
389 Ga0466960_0148567
390 Ga0466960_0560467
391 Ga0466959_0069199
392 Ga0466959_0901517
393 Ga0466958_0037722
394 Ga0466967_0333161
395 Ga0466967_0478070
396 Ga0466967_1627262
397 Ga0495603_0102133
398 Ga0495629_0384888
399 Ga0495651_0437330
400 Ga0495653_0018210
401 Ga0495618_0226300
402 Ga0495618_0663479
403 Ga0495628_0606971
404 Ga0495667_0008077
405 Ga0495634_0118011
406 Ga0495634_0179462
407 Ga0495635_0098024
408 Ga0495657_0015073
409 Ga0495623_0684822
410 Ga0495646_0709273
411 Ga0495624_0000007
412 Ga0495600_0062395
413 Ga0495604_0130843
414 Ga0495674_0019352
415 Ga0495680_0007510
416 Ga0495680_0019716
417 Ga0495684_0005954
418 Ga0496100_0754419
419 Ga0496100_1230078
420 Ga0496101_0010656
421 Ga0496101_0846035
422 Ga0496103_1063276
423 Ga0496104_0584624
424 Ga0496105_0270271
425 Ga0496107_0351795
426 Ga0496108_0144621
427 Ga0496109_0000044
428 Ga0496109_0074517
429 Ga0496109_0832813
430 Ga0496110_0043186
431 Ga0496110_0381837
432 Ga0496111_0789908
433 Ga0496113_0325119
434 Ga0496113_1403147
435 Ga0496114_0057872
436 Ga0496114_0939029
437 Ga0496115_0136760
438 Ga0501031_0147043
439 Ga0501031_0682461
440 Ga0501032_1068346
441 Ga0501033_0347875
442 Ga0501036_0031261
443 Ga0501036_0218671
444 Ga0501037_0761364
445 Ga0501038_0356156
446 Ga0501039_0078077
447 Ga0501040_0165513
448 Ga0501040_0186323
449 Ga0501040_1169891
450 Ga0501040_1171757
451 Ga0501041_0332951
452 Ga0501042_0140318
453 Ga0501043_1229102
454 Ga0501043_1307241
455 Ga0501046_0422481
456 Ga0501048_0654830
457 Ga0501048_1015196
458 Ga0501067_0090971
459 Ga0501068_0257996
460 Ga0501070_0403592
461 Ga0501071_0006988
462 Ga0501071_0190841
463 Ga0501071_0338835
464 Ga0501071_0341393
465 Ga0501071_0615631
466 Ga0501071_1162609
467 Ga0501072_0006336
468 Ga0501072_0195999
469 Ga0501072_0471897
470 Ga0501072_1181509
471 Ga0501073_1235632
472 Ga0501074_0427780
473 Ga0501074_0745161
474 Ga0501074_0891876
475 Ga0501074_1049682
476 Ga0501074_1136661
477 Ga0501075_0074794
478 Ga0501075_0184190
479 Ga0501076_0205065
480 Ga0501076_0423526
481 Ga0501077_0196665
482 Ga0501079_0016003
483 Ga0501079_0125731
484 Ga0501079_0931226
485 Ga0501080_0382005
486 Ga0501080_1296150
487 Ga0501080_1517572
488 Ga0501081_0077181
489 Ga0501081_0617682
490 Ga0501081_0750200
491 Ga0501081_0851543
492 Ga0501035_0260317
493 Ga0501035_1308205
494 Ga0501044_1533247
495 Ga0501045_0087374
496 Ga0501045_0464165
497 Ga0501045_0838189
498 nmdc:mga00v17_335690_c1
499 nmdc:mga0yw44_227767_c1
500 nmdc:mga05p37_108145_c1
501 nmdc:mga05p37_227920_c1
502 nmdc:mga05p37_592873_c1
503 nmdc:mga09592_2886_c1
504 nmdc:mga09592_441182_c1
505 nmdc:mga0qj67_45029_c1
506 nmdc:mga0qj67_540524_c1
507 nmdc:mga0qj67_73285_c1
508 nmdc:mga06r32_1336731_c1
509 nmdc:mga06r32_1966932_c1
510 nmdc:mga06r32_224241_c1
511 nmdc:mga08y16_13376_c1
512 Ga0495595_0022705
513 Ga0495619_0045917
514 Ga0501084_0056686
515 Ga0501084_0214475
516 Ga0501084_1476147
517 Ga0501084_1722197
518 Ga0501082_0018104
519 Ga0501082_0243834
520 Ga0530510_0009765
521 Ga0530510_0050964
522 Ga0530510_0108829
523 Ga0530510_0358248
524 Ga0530510_0940652

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
5wuq-assembly2.cif.gz_D crystal structure of sigw in complex with its anti-sigma rsiw, a zinc binding form 0.5891 23 72
5wuq-assembly2.cif.gz_D crystal structure of sigw in complex with its anti-sigma rsiw, a zinc binding form 0.4603 23 72
ID Description Score Start End Superfamily
2z2sD01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Anti-sigma factor, zinc-finger domain 0.6322 26 72 1.10.10.1320
2z2sB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Anti-sigma factor, zinc-finger domain 0.6174 26 71 1.10.10.1320
af_Q8I406_342_483_1.25.40.70 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Phosphatidylinositol 3-kinase, accessory domain (PIK) 0.5293 4 71 1.25.40.70
af_Q8I406_342_483_1.25.40.70 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Phosphatidylinositol 3-kinase, accessory domain (PIK) 0.5017 4 71 1.25.40.70
2z2sD01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Anti-sigma factor, zinc-finger domain 0.4537 26 72 1.10.10.1320
ID Description Score Start End GO Terms
AF-A0A538CRS3-F1-model_v4 Zf-HC2 domain-containing protein 0.9521 12 70
AF-A0A7W1YN45-F1-model_v4 Zinc-finger domain-containing protein 0.9356 19 71
AF-A0A661W3Z6-F1-model_v4 Zinc-finger domain-containing protein 0.9169 13 66
AF-A0A6P2C7M5-F1-model_v4 Zf-HC2 domain-containing protein 0.9136 15 65
AF-A0A2D6LCD1-F1-model_v4 Zf-HC2 domain-containing protein 0.8999 11 66

Map