F370857

General Info

Members Datasets Scaffolds Average Seq Length
262 167 524 221

Family's Representative Sequence

Representative Sequence 3300005347|Ga0070668_101044041|Ga0070668_1010440411
Length 221
Sequence MTDARYKVNFLVFEGSLRKDSLNARLASLASRVIESNGGNVDRANLIDFDCPSYDGDVEAGEGIPAGAQTFRQRLIAADAFVLSSPEYNASMPGVVKNLIDWTSRFVPQPFKGKQALLMSASPSMAGGNRGLWAVRVPLEHLGTRVYPDMFSLAQAHQAFDANGRIANAKLQEWFEANIKCFMDLVEAAKHFPQIKTQWVEFLGEHPDRLTERVETQDVAA

Samples

Sample ID Description Type Environment
1 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
43 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
44 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
45 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
52 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
53 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
54 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
59 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
60 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
61 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
96 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
99 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
100 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
101 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
102 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
103 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
104 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
105 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
106 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
107 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
108 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
109 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
110 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
111 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
112 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
113 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
114 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
115 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
116 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
117 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
118 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
119 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
120 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
121 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
122 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
123 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
124 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
125 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
126 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
127 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
128 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
129 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
130 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
131 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
132 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
133 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
134 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
135 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
136 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
137 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
138 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
139 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
140 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
146 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
147 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
148 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
149 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
150 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
151 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
152 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
153 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
154 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
155 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
156 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
157 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
158 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
159 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
160 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
161 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
162 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
163 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
164 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
165 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
166 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
167 8056054917 Glycomyces luteolus NEAU-A15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.62
Metatranscriptomes 0
Isolates 0.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.87
Rhizosphere 91.6
Stem 0
Stem Tuber 0
Unclassified 8.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070668_101044041 3300005347 Bacteria 736
2 rootH1_10154786 3300003323 Bacteria 2491
3 Ga0065712_10095673 3300005290 Bacteria 2211
4 Ga0070676_10002744 3300005328 Bacteria 9089
5 Ga0070683_100027869 3300005329 Bacteria 5099
6 Ga0070683_100351738 3300005329 Bacteria 1403
7 Ga0070690_100039088 3300005330 Bacteria 2997
8 Ga0070670_100130939 3300005331 Bacteria 2166
9 Ga0070670_100179900 3300005331 Bacteria 1836
10 Ga0070682_100009241 3300005337 Bacteria 5576
11 Ga0070682_100060049 3300005337 Unclassified 2404
12 Ga0070689_100000211 3300005340 Bacteria 35192
13 Ga0070689_100005131 3300005340 Bacteria 8905
14 Ga0070689_100085208 3300005340 Bacteria 2484
15 Ga0070687_100015801 3300005343 Bacteria 3422
16 Ga0070687_100046949 3300005343 Bacteria 2213
17 Ga0070687_100088154 3300005343 Bacteria 1710
18 Ga0070661_100049806 3300005344 Bacteria 3066
19 Ga0070661_100142137 3300005344 Bacteria 1809
20 Ga0070668_100012485 3300005347 Bacteria 6328
21 Ga0070669_100004490 3300005353 Bacteria 10062
22 Ga0070675_100001279 3300005354 Bacteria 18376
23 Ga0070675_100049046 3300005354 Bacteria 3464
24 Ga0070675_100323334 3300005354 Bacteria 1363
25 Ga0070675_100710070 3300005354 Bacteria 916
26 Ga0070674_100001961 3300005356 Bacteria 11248
27 Ga0070673_100135350 3300005364 Bacteria 2073
28 Ga0070673_100904971 3300005364 Unclassified 818
29 Ga0070688_100000296 3300005365 Bacteria 25505
30 Ga0070688_100000437 3300005365 Bacteria 21038
31 Ga0070688_100018102 3300005365 Bacteria 4058
32 Ga0070688_100042465 3300005365 Unclassified 2797
33 Ga0070659_100045130 3300005366 Unclassified 3452
34 Ga0070667_100255751 3300005367 Bacteria 1567
35 Ga0070701_10108115 3300005438 Bacteria 1550
36 Ga0070705_100034537 3300005440 Bacteria 2828
37 Ga0070700_100003601 3300005441 Bacteria 8011
38 Ga0070694_100432721 3300005444 Unclassified 1036
39 Ga0070663_100002203 3300005455 Bacteria 10898
40 Ga0070662_100163268 3300005457 Bacteria 1744
41 Ga0070681_10157144 3300005458 Bacteria 2198
42 Ga0068867_100098598 3300005459 Bacteria 2228
43 Ga0070685_10018961 3300005466 Bacteria 3707
44 Ga0070685_10019566 3300005466 Bacteria 3654
45 Ga0070698_100093638 3300005471 Bacteria 2984
46 Ga0070679_100052625 3300005530 Bacteria 4054
47 Ga0070684_100048552 3300005535 Bacteria 3682
48 Ga0070684_100269209 3300005535 Bacteria 1559
49 Ga0070684_100571718 3300005535 Bacteria 1050
50 Ga0070672_100080151 3300005543 Bacteria 2615
51 Ga0070672_100315666 3300005543 Bacteria 1327
52 Ga0070672_100777957 3300005543 Bacteria 841
53 Ga0070686_100001089 3300005544 Bacteria 15649
54 Ga0070686_100112782 3300005544 Bacteria 1855
55 Ga0070664_100005217 3300005564 Bacteria 10417
56 Ga0068857_100140727 3300005577 Bacteria 2181
57 Ga0068859_100038278 3300005617 Bacteria 4812
58 Ga0068859_100058416 3300005617 Bacteria 3886
59 Ga0068859_100088453 3300005617 Bacteria 3147
60 Ga0068859_100091234 3300005617 Bacteria 3097
61 Ga0068864_100273705 3300005618 Bacteria 1574
62 Ga0068863_100001604 3300005841 Bacteria 22351
63 Ga0068858_100247212 3300005842 Bacteria 1694
64 Ga0068858_100261102 3300005842 Bacteria 1646
65 Ga0068858_100298320 3300005842 Unclassified 1537
66 Ga0068860_100002996 3300005843 Bacteria 17446
67 Ga0068860_100133871 3300005843 Bacteria 2380
68 Ga0068862_100817728 3300005844 Bacteria 911
69 Ga0097621_100307714 3300006237 Bacteria 1401
70 Ga0097621_100737877 3300006237 Unclassified 909
71 Ga0068871_100172482 3300006358 Bacteria 1855
72 Ga0068871_100495325 3300006358 Bacteria 1101
73 Ga0068871_100496931 3300006358 Bacteria 1099
74 Ga0075428_100110735 3300006844 Unclassified 2991
75 Ga0075428_101434070 3300006844 Bacteria 724
76 Ga0075433_10603895 3300006852 Unclassified 963
77 Ga0075429_100005585 3300006880 Bacteria 10840
78 Ga0097620_100038275 3300006931 Bacteria 4812
79 Ga0097620_100058413 3300006931 Bacteria 3886
80 Ga0097620_100088450 3300006931 Bacteria 3147
81 Ga0097620_100091228 3300006931 Bacteria 3097
82 Ga0111539_10003683 3300009094 Bacteria 20174
83 Ga0111539_10561551 3300009094 Bacteria 1329
84 Ga0111539_10776314 3300009094 Bacteria 1115
85 Ga0114129_10059841 3300009147 Bacteria 5326
86 Ga0105243_10510949 3300009148 Bacteria 1141
87 Ga0105248_10001479 3300009177 Bacteria 26141
88 Ga0105248_10465153 3300009177 Bacteria 1426
89 Ga0105248_10476985 3300009177 Bacteria 1406
90 Ga0105249_10346637 3300009553 Bacteria 1503
91 Ga0105246_10445251 3300011119 Bacteria 1087
92 Ga0157374_10043631 3300013296 Bacteria 4144
93 Ga0157378_10031144 3300013297 Bacteria 4711
94 Ga0163162_10007705 3300013306 Bacteria 10490
95 Ga0163162_10037472 3300013306 Bacteria 4839
96 Ga0157375_10001838 3300013308 Bacteria 18246
97 Ga0157375_10788311 3300013308 Bacteria 1100
98 Ga0163163_10009824 3300014325 Bacteria 8575
99 Ga0163163_10013871 3300014325 Bacteria 7391
100 Ga0163163_10170128 3300014325 Bacteria 2225
101 Ga0157379_10000593 3300014968 Bacteria 29279
102 Ga0157376_10121589 3300014969 Bacteria 2315
103 Ga0163161_10063198 3300017792 Bacteria 2698
104 Ga0207666_1012228 3300025271 Bacteria 1194
105 Ga0207697_10028132 3300025315 Bacteria 2299
106 Ga0207680_10021483 3300025903 Bacteria 3493
107 Ga0207680_10090666 3300025903 Bacteria 1943
108 Ga0207645_10005477 3300025907 Bacteria 9190
109 Ga0207662_10002718 3300025918 Bacteria 8926
110 Ga0207662_10392102 3300025918 Bacteria 940
111 Ga0207657_10198129 3300025919 Bacteria 1617
112 Ga0207649_10056592 3300025920 Bacteria 2449
113 Ga0207649_10398926 3300025920 Bacteria 1029
114 Ga0207652_10772510 3300025921 Bacteria 854
115 Ga0207646_10836972 3300025922 Unclassified 818
116 Ga0207681_10000468 3300025923 Bacteria 28329
117 Ga0207650_10094954 3300025925 Bacteria 2285
118 Ga0207650_10103639 3300025925 Bacteria 2193
119 Ga0207659_10004390 3300025926 Bacteria 8524
120 Ga0207659_10068882 3300025926 Bacteria 2575
121 Ga0207659_10255528 3300025926 Bacteria 1423
122 Ga0207700_10547774 3300025928 Bacteria 1027
123 Ga0207690_10027963 3300025932 Unclassified 3569
124 Ga0207690_10413397 3300025932 Bacteria 1078
125 Ga0207706_10460599 3300025933 Bacteria 1099
126 Ga0207706_10479728 3300025933 Bacteria 1074
127 Ga0207670_10000116 3300025936 Bacteria 54285
128 Ga0207670_10002120 3300025936 Bacteria 10366
129 Ga0207670_10057726 3300025936 Bacteria 2633
130 Ga0207670_10323951 3300025936 Bacteria 1213
131 Ga0207691_10006012 3300025940 Bacteria 11719
132 Ga0207691_10189605 3300025940 Bacteria 1794
133 Ga0207691_10239721 3300025940 Bacteria 1568
134 Ga0207711_10013973 3300025941 Bacteria 6669
135 Ga0207711_10429717 3300025941 Bacteria 1229
136 Ga0207689_10124084 3300025942 Bacteria 2124
137 Ga0207661_10026708 3300025944 Bacteria 4403
138 Ga0207661_10345699 3300025944 Bacteria 1341
139 Ga0207679_10042984 3300025945 Bacteria 3250
140 Ga0207651_10106525 3300025960 Bacteria 2093
141 Ga0207668_10027388 3300025972 Bacteria 3711
142 Ga0207658_10031074 3300025986 Bacteria 3789
143 Ga0207658_10032525 3300025986 Bacteria 3713
144 Ga0207677_10080328 3300026023 Bacteria 2336
145 Ga0207703_10563640 3300026035 Bacteria 1075
146 Ga0207703_10833281 3300026035 Bacteria 882
147 Ga0207678_10020927 3300026067 Bacteria 5734
148 Ga0207708_10000989 3300026075 Bacteria 21244
149 Ga0207641_10004189 3300026088 Bacteria 12565
150 Ga0207641_10223031 3300026088 Unclassified 1749
151 Ga0207648_10071638 3300026089 Bacteria 3020
152 Ga0207676_10225717 3300026095 Bacteria 1671
153 Ga0207674_10042830 3300026116 Bacteria 4672
154 Ga0207674_10195920 3300026116 Bacteria 1970
155 Ga0207675_100049315 3300026118 Bacteria 3930
156 Ga0207683_10301796 3300026121 Bacteria 1465
157 Ga0207428_10033830 3300027907 Bacteria 4192
158 Ga0268265_10225317 3300028380 Bacteria 1644
159 Ga0268264_10105391 3300028381 Bacteria 2459
160 Ga0268264_10120639 3300028381 Bacteria 2310
161 Ga0268264_10251463 3300028381 Bacteria 1642
162 Ga0307408_100000812 3300031548 Bacteria 24917
163 Ga0307516_10008624 3300031730 Bacteria 11501
164 Ga0307405_10292584 3300031731 Bacteria 1232
165 Ga0307406_10000521 3300031901 Bacteria 22113
166 Ga0307406_10142453 3300031901 Bacteria 1699
167 Ga0307416_100266249 3300032002 Bacteria 1679
168 Ga0373945_0201874 3300035116 Bacteria 826
169 Ga0373943_0118262 3300035170 Bacteria 1406
170 Ga0451791_0768866 3300041451 Bacteria 2711
171 Ga0451798_0735089 3300041458 Bacteria 1320
172 Ga0451800_0037210 3300041459 Bacteria 1381
173 Ga0451802_0686639 3300041460 Unclassified 3456
174 Ga0451802_1275482 3300041460 Bacteria 738
175 Ga0451807_2117401 3300041486 Unclassified 876
176 Ga0451807_2433003 3300041486 Unclassified 2009
177 Ga0451843_1227691 3300041509 Unclassified 997
178 Ga0451853_0251709 3300041512 Bacteria 914
179 Ga0495603_0196752 3300046455 Bacteria 1165
180 Ga0495603_0415173 3300046455 Unclassified 771
181 Ga0495629_0000013 3300046459 Bacteria 212317
182 Ga0495582_0005231 3300046473 Bacteria 7258
183 Ga0495639_0016888 3300046475 Bacteria 3170
184 Ga0495662_0111551 3300046476 Bacteria 1340
185 Ga0495594_0004967 3300046499 Bacteria 6844
186 Ga0495594_0025365 3300046499 Bacteria 3187
187 Ga0495618_0000470 3300046514 Bacteria 28732
188 Ga0495640_0096401 3300046533 Bacteria 1946
189 Ga0495586_0047906 3300046535 Bacteria 2308
190 Ga0495634_0018283 3300046642 Bacteria 4991
191 Ga0495634_0098469 3300046642 Bacteria 1892
192 Ga0495635_0000317 3300046663 Bacteria 31306
193 Ga0495647_0016528 3300046681 Bacteria 2598
194 Ga0495658_0000092 3300046683 Bacteria 46249
195 Ga0495613_0003173 3300046689 Bacteria 12311
196 Ga0495581_0003004 3300047315 Bacteria 9656
197 Ga0495581_0013394 3300047315 Bacteria 4755
198 Ga0495676_0060057 3300047321 Bacteria 2982
199 Ga0495676_0066814 3300047321 Bacteria 2784
200 Ga0495680_0000316 3300047322 Bacteria 54202
201 Ga0495680_0252733 3300047322 Bacteria 1249
202 Ga0495684_0083478 3300047471 Bacteria 2423
203 Ga0495684_0149646 3300047471 Bacteria 1746
204 Ga0495614_0003106 3300048089 Bacteria 7395
205 Ga0496101_0351079 3300048904 Bacteria 1159
206 Ga0496104_0165576 3300048907 Bacteria 2120
207 Ga0496104_0293486 3300048907 Bacteria 1538
208 Ga0496108_0368377 3300048911 Bacteria 1254
209 Ga0496109_0009452 3300048912 Bacteria 8312
210 Ga0496109_0229127 3300048912 Bacteria 1748
211 Ga0496110_0010083 3300048913 Bacteria 7670
212 Ga0496111_0074816 3300048914 Bacteria 2467
213 Ga0496112_0013810 3300048915 Bacteria 7470
214 Ga0496114_0051188 3300048917 Bacteria 3438
215 Ga0496115_0505598 3300048918 Bacteria 971
216 Ga0501032_0152360 3300049569 Bacteria 1520
217 Ga0501036_0190632 3300049572 Bacteria 1725
218 Ga0501038_0026334 3300049574 Bacteria 5179
219 Ga0501043_0332928 3300049579 Bacteria 1156
220 Ga0501046_0474577 3300049580 Unclassified 898
221 Ga0501068_0000018 3300049584 Bacteria 59872
222 Ga0501068_0036980 3300049584 Bacteria 2922
223 Ga0501069_0031438 3300049585 Bacteria 2919
224 Ga0501070_0000091 3300049586 Bacteria 77270
225 Ga0501070_0066904 3300049586 Bacteria 2976
226 Ga0501070_0177511 3300049586 Bacteria 1753
227 Ga0501071_0582366 3300049587 Bacteria 860
228 Ga0501072_0000083 3300049588 Bacteria 69925
229 Ga0501073_0050199 3300049589 Bacteria 2924
230 Ga0501073_0187885 3300049589 Bacteria 1429
231 Ga0501074_0025751 3300049590 Bacteria 4268
232 Ga0501074_0697529 3300049590 Bacteria 716
233 Ga0501075_0461453 3300049591 Unclassified 969
234 Ga0501076_0504628 3300049592 Bacteria 997
235 Ga0501077_0292040 3300049593 Bacteria 1038
236 Ga0501079_0018581 3300049741 Bacteria 5310
237 Ga0501079_0090073 3300049741 Bacteria 2376
238 Ga0501079_0369859 3300049741 Bacteria 1124
239 Ga0501080_0011917 3300049742 Bacteria 7963
240 Ga0501080_0018362 3300049742 Bacteria 6473
241 Ga0501080_0051896 3300049742 Bacteria 3817
242 Ga0501080_0335909 3300049742 Bacteria 1366
243 Ga0501081_0148081 3300049743 Bacteria 1685
244 Ga0501081_0504423 3300049743 Unclassified 902
245 Ga0501083_0011703 3300049744 Bacteria 6150
246 Ga0501083_0115748 3300049744 Bacteria 1760
247 Ga0501044_0203646 3300049823 Bacteria 1936
248 Ga0501044_0880265 3300049823 Bacteria 771
249 nmdc:mga05p37_42552_c1 3300050507 Bacteria 5582
250 nmdc:mga09592_5434_c1 3300050508 Bacteria 10359
251 nmdc:mga08y16_4337_c1 3300050511 Bacteria 14820
252 nmdc:mga08y16_601625_c1 3300050511 Bacteria 1108
253 nmdc:mga08y16_716230_c1 3300050511 Bacteria 999
254 Ga0495619_0000671 3300053085 Bacteria 22407
255 Ga0501084_0000047 3300054114 Bacteria 96024
256 Ga0501084_0304398 3300054114 Bacteria 1346
257 Ga0501082_0003291 3300060353 Bacteria 14108
258 Ga0501082_0187048 3300060353 Bacteria 1802
259 Ga0501082_0198335 3300060353 Bacteria 1746
260 Ga0501082_0634761 3300060353 Unclassified 935
261 Ga0530510_0118302 3300061734 Bacteria 1944
262 8056055273 8056054917 Bacteria 5736694
263 Ga0070668_101044041
264 rootH1_10154786
265 Ga0065712_10095673
266 Ga0070676_10002744
267 Ga0070683_100027869
268 Ga0070683_100351738
269 Ga0070690_100039088
270 Ga0070670_100130939
271 Ga0070670_100179900
272 Ga0070682_100009241
273 Ga0070682_100060049
274 Ga0070689_100000211
275 Ga0070689_100005131
276 Ga0070689_100085208
277 Ga0070687_100015801
278 Ga0070687_100046949
279 Ga0070687_100088154
280 Ga0070661_100049806
281 Ga0070661_100142137
282 Ga0070668_100012485
283 Ga0070669_100004490
284 Ga0070675_100001279
285 Ga0070675_100049046
286 Ga0070675_100323334
287 Ga0070675_100710070
288 Ga0070674_100001961
289 Ga0070673_100135350
290 Ga0070673_100904971
291 Ga0070688_100000296
292 Ga0070688_100000437
293 Ga0070688_100018102
294 Ga0070688_100042465
295 Ga0070659_100045130
296 Ga0070667_100255751
297 Ga0070701_10108115
298 Ga0070705_100034537
299 Ga0070700_100003601
300 Ga0070694_100432721
301 Ga0070663_100002203
302 Ga0070662_100163268
303 Ga0070681_10157144
304 Ga0068867_100098598
305 Ga0070685_10018961
306 Ga0070685_10019566
307 Ga0070698_100093638
308 Ga0070679_100052625
309 Ga0070684_100048552
310 Ga0070684_100269209
311 Ga0070684_100571718
312 Ga0070672_100080151
313 Ga0070672_100315666
314 Ga0070672_100777957
315 Ga0070686_100001089
316 Ga0070686_100112782
317 Ga0070664_100005217
318 Ga0068857_100140727
319 Ga0068859_100038278
320 Ga0068859_100058416
321 Ga0068859_100088453
322 Ga0068859_100091234
323 Ga0068864_100273705
324 Ga0068863_100001604
325 Ga0068858_100247212
326 Ga0068858_100261102
327 Ga0068858_100298320
328 Ga0068860_100002996
329 Ga0068860_100133871
330 Ga0068862_100817728
331 Ga0097621_100307714
332 Ga0097621_100737877
333 Ga0068871_100172482
334 Ga0068871_100495325
335 Ga0068871_100496931
336 Ga0075428_100110735
337 Ga0075428_101434070
338 Ga0075433_10603895
339 Ga0075429_100005585
340 Ga0097620_100038275
341 Ga0097620_100058413
342 Ga0097620_100088450
343 Ga0097620_100091228
344 Ga0111539_10003683
345 Ga0111539_10561551
346 Ga0111539_10776314
347 Ga0114129_10059841
348 Ga0105243_10510949
349 Ga0105248_10001479
350 Ga0105248_10465153
351 Ga0105248_10476985
352 Ga0105249_10346637
353 Ga0105246_10445251
354 Ga0157374_10043631
355 Ga0157378_10031144
356 Ga0163162_10007705
357 Ga0163162_10037472
358 Ga0157375_10001838
359 Ga0157375_10788311
360 Ga0163163_10009824
361 Ga0163163_10013871
362 Ga0163163_10170128
363 Ga0157379_10000593
364 Ga0157376_10121589
365 Ga0163161_10063198
366 Ga0207666_1012228
367 Ga0207697_10028132
368 Ga0207680_10021483
369 Ga0207680_10090666
370 Ga0207645_10005477
371 Ga0207662_10002718
372 Ga0207662_10392102
373 Ga0207657_10198129
374 Ga0207649_10056592
375 Ga0207649_10398926
376 Ga0207652_10772510
377 Ga0207646_10836972
378 Ga0207681_10000468
379 Ga0207650_10094954
380 Ga0207650_10103639
381 Ga0207659_10004390
382 Ga0207659_10068882
383 Ga0207659_10255528
384 Ga0207700_10547774
385 Ga0207690_10027963
386 Ga0207690_10413397
387 Ga0207706_10460599
388 Ga0207706_10479728
389 Ga0207670_10000116
390 Ga0207670_10002120
391 Ga0207670_10057726
392 Ga0207670_10323951
393 Ga0207691_10006012
394 Ga0207691_10189605
395 Ga0207691_10239721
396 Ga0207711_10013973
397 Ga0207711_10429717
398 Ga0207689_10124084
399 Ga0207661_10026708
400 Ga0207661_10345699
401 Ga0207679_10042984
402 Ga0207651_10106525
403 Ga0207668_10027388
404 Ga0207658_10031074
405 Ga0207658_10032525
406 Ga0207677_10080328
407 Ga0207703_10563640
408 Ga0207703_10833281
409 Ga0207678_10020927
410 Ga0207708_10000989
411 Ga0207641_10004189
412 Ga0207641_10223031
413 Ga0207648_10071638
414 Ga0207676_10225717
415 Ga0207674_10042830
416 Ga0207674_10195920
417 Ga0207675_100049315
418 Ga0207683_10301796
419 Ga0207428_10033830
420 Ga0268265_10225317
421 Ga0268264_10105391
422 Ga0268264_10120639
423 Ga0268264_10251463
424 Ga0307408_100000812
425 Ga0307516_10008624
426 Ga0307405_10292584
427 Ga0307406_10000521
428 Ga0307406_10142453
429 Ga0307416_100266249
430 Ga0373945_0201874
431 Ga0373943_0118262
432 Ga0451791_0768866
433 Ga0451798_0735089
434 Ga0451800_0037210
435 Ga0451802_0686639
436 Ga0451802_1275482
437 Ga0451807_2117401
438 Ga0451807_2433003
439 Ga0451843_1227691
440 Ga0451853_0251709
441 Ga0495603_0196752
442 Ga0495603_0415173
443 Ga0495629_0000013
444 Ga0495582_0005231
445 Ga0495639_0016888
446 Ga0495662_0111551
447 Ga0495594_0004967
448 Ga0495594_0025365
449 Ga0495618_0000470
450 Ga0495640_0096401
451 Ga0495586_0047906
452 Ga0495634_0018283
453 Ga0495634_0098469
454 Ga0495635_0000317
455 Ga0495647_0016528
456 Ga0495658_0000092
457 Ga0495613_0003173
458 Ga0495581_0003004
459 Ga0495581_0013394
460 Ga0495676_0060057
461 Ga0495676_0066814
462 Ga0495680_0000316
463 Ga0495680_0252733
464 Ga0495684_0083478
465 Ga0495684_0149646
466 Ga0495614_0003106
467 Ga0496101_0351079
468 Ga0496104_0165576
469 Ga0496104_0293486
470 Ga0496108_0368377
471 Ga0496109_0009452
472 Ga0496109_0229127
473 Ga0496110_0010083
474 Ga0496111_0074816
475 Ga0496112_0013810
476 Ga0496114_0051188
477 Ga0496115_0505598
478 Ga0501032_0152360
479 Ga0501036_0190632
480 Ga0501038_0026334
481 Ga0501043_0332928
482 Ga0501046_0474577
483 Ga0501068_0000018
484 Ga0501068_0036980
485 Ga0501069_0031438
486 Ga0501070_0000091
487 Ga0501070_0066904
488 Ga0501070_0177511
489 Ga0501071_0582366
490 Ga0501072_0000083
491 Ga0501073_0050199
492 Ga0501073_0187885
493 Ga0501074_0025751
494 Ga0501074_0697529
495 Ga0501075_0461453
496 Ga0501076_0504628
497 Ga0501077_0292040
498 Ga0501079_0018581
499 Ga0501079_0090073
500 Ga0501079_0369859
501 Ga0501080_0011917
502 Ga0501080_0018362
503 Ga0501080_0051896
504 Ga0501080_0335909
505 Ga0501081_0148081
506 Ga0501081_0504423
507 Ga0501083_0011703
508 Ga0501083_0115748
509 Ga0501044_0203646
510 Ga0501044_0880265
511 nmdc:mga05p37_42552_c1
512 nmdc:mga09592_5434_c1
513 nmdc:mga08y16_4337_c1
514 nmdc:mga08y16_601625_c1
515 nmdc:mga08y16_716230_c1
516 Ga0495619_0000671
517 Ga0501084_0000047
518 Ga0501084_0304398
519 Ga0501082_0003291
520 Ga0501082_0187048
521 Ga0501082_0198335
522 Ga0501082_0634761
523 Ga0530510_0118302
524 8056055273

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03358

FMN_red

NADPH-dependent FMN reductase

8

158

0.97

PF02525

Flavodoxin_2

Flavodoxin-like fold

8

175

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
3svl-assembly1.cif.gz_B structural basis of the improvement of chrr - a multi-purpose enzyme 0.8551 10 188
1x77-assembly1.cif.gz_B crystal structure of a nad(p)h-dependent fmn reductase complexed with fmn 0.8493 10 183
3s2y-assembly1.cif.gz_A crystal structure of a chromate/uranium reductase from gluconacetobacter hansenii 0.8471 8 189
4hs4-assembly1.cif.gz_G-1 crystal structure of a putative chromate reductase from gluconacetobacter hansenii, gh-chrr, containing a y129n substitution. 0.8455 8 189
4h6p-assembly1.cif.gz_A crystal structure of a putative chromate reductase from gluconacetobacter hansenii, gh-chrr, containing a r101a substitution. 0.8424 8 189
ID Description Score Start End Superfamily
3svlA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8627 10 187 3.40.50.360
1x77B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8493 10 183 3.40.50.360
3svlA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8452 10 187 3.40.50.360
1x77B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8359 10 183 3.40.50.360
2fzvC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8201 5 193 3.40.50.360
ID Description Score Start End GO Terms
AF-A0A136NYM3-F1-model_v4 deleted 0.9582 10 118
AF-A0A531KYT4-F1-model_v4 deleted 0.9513 10 91
AF-A0A2D8HY78-F1-model_v4 Flavoprotein 0.9461 10 123 GO:0005829
GO:0010181
GO:0016491
AF-A0A521U5U3-F1-model_v4 NADPH-dependent oxidoreductase 0.9457 9 94 GO:0005829
GO:0010181
GO:0016491
AF-A0A136NYM3-F1-model_v4 deleted 0.9415 10 118

Map