F370824

General Info

Members Datasets Scaffolds Average Seq Length
262 140 260 382

Family's Representative Sequence

Representative Sequence 3300005334|Ga0068869_100104613|Ga0068869_1001046131
Length 413
Sequence MYKVLFSMTSILCTILFSCKQKQAPPALPTPVNLYAVSMQPVLYYDRYPSTVQALSQVNIVPEVQGYITGIFFKEGDRVKKGQKLYEIDKRLYSAAVDGAAANVKVAQGNEEQARQDADRYVYLNNYHAVAKQQYDHAVIAYTNAKNQVKAAEEAVRTAKTNLAYTTIYAPFDGTIGFSQVKTGNMVSVGSTILNTISTNDPMAVDFVINEKMLMDFENIQMQKLQPVDSLFTLLLPNNTLYKYTGKISIIDRAVDPQTGSVKIRLVFPNPKNELKAGMSCMVRVHNQESAPQMVVPGKAVVEQMGEYFVFVAKDTAITVSADSARKQRADTAAQKGPKLYVFQRKVQIGQTVGADVIIKSGIKEGDKIVVDGVQSLHDGSRVNPGEKKSNGNGSDNQHALPGEAGKIDSTKN

Samples

Sample ID Description Type Environment
1 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
2 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
3 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
10 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
11 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
31 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
32 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
33 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
34 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
35 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
36 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
37 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
38 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
39 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
40 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
41 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
42 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
43 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
44 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
45 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
46 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
47 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
48 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
49 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
50 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
51 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
52 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
53 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
79 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
80 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
81 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
82 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
83 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
84 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
85 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
86 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
87 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
88 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
89 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
90 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
91 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
92 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
93 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
94 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
95 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
96 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
97 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
98 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
99 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
100 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
101 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
102 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
103 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
104 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
105 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
106 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
107 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
108 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
109 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
110 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
111 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
112 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
113 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
114 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
115 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
116 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
117 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
118 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
119 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
120 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
121 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
122 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
123 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
124 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
125 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
126 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
127 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
128 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
129 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
131 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
132 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
133 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
134 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
135 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
136 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
137 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
138 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
139 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
140 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.47
Metatranscriptomes 0.38
Isolates 1.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.11
Nodule 0
Rhizoplane 0
Rhizosphere 88.17
Stem 0
Stem Tuber 0
Unclassified 5.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10027621 3300001979 Unclassified 1886
2 JGI25157J39369_1008959 3300002741 Bacteria 1366
3 rootH1_10033995 3300003316 Bacteria 11356
4 rootH2_10001891 3300003320 Bacteria 464318
5 rootH2_10024022 3300003320 Bacteria 28042
6 rootH1_10138889 3300003316 Bacteria 1989
7 rootH1_10138889 3300003323 Unclassified 3327
8 rootH1_10221240 3300003323 Bacteria 2851
9 Ga0055531_10000020 3300003794 Bacteria 170186
10 Ga0058863_11811112 3300004799 Unclassified 3846
11 Ga0065714_10003193 3300005288 Bacteria 11484
12 Ga0070658_10000049 3300005327 Bacteria 119985
13 Ga0070658_10049767 3300005327 Unclassified 3396
14 Ga0070676_10002483 3300005328 Bacteria 9460
15 Ga0068869_100104613 3300005334 Bacteria 2146
16 Ga0068868_100013185 3300005338 Bacteria 6055
17 Ga0068868_100021730 3300005338 Bacteria 4835
18 Ga0070673_100004946 3300005364 Bacteria 8490
19 Ga0070662_100000153 3300005457 Bacteria 39715
20 Ga0068867_100000990 3300005459 Bacteria 19370
21 Ga0070679_100004199 3300005530 Bacteria 13287
22 Ga0068853_100004591 3300005539 Bacteria 10713
23 Ga0068853_100022754 3300005539 Bacteria 5238
24 Ga0068853_100204107 3300005539 Bacteria 1799
25 Ga0068853_100214477 3300005539 Bacteria 1756
26 Ga0070686_100050106 3300005544 Bacteria 2652
27 Ga0070665_100000013 3300005548 Bacteria 484927
28 Ga0070665_100000020 3300005548 Bacteria 389687
29 Ga0070665_100058046 3300005548 Bacteria 3880
30 Ga0068855_100000340 3300005563 Bacteria 58104
31 Ga0068855_100043146 3300005563 Bacteria 5344
32 Ga0068855_100050239 3300005563 Bacteria 4916
33 Ga0068855_100058480 3300005563 Bacteria 4514
34 Ga0068857_100073949 3300005577 Unclassified 3037
35 Ga0068854_100089218 3300005578 Bacteria 2291
36 Ga0068856_100000270 3300005614 Bacteria 56564
37 Ga0068856_100004283 3300005614 Bacteria 14237
38 Ga0068856_100024208 3300005614 Bacteria 5907
39 Ga0068856_100161869 3300005614 Unclassified 2248
40 Ga0068852_100000197 3300005616 Bacteria 41267
41 Ga0068852_100001564 3300005616 Bacteria 15545
42 Ga0068860_100003042 3300005843 Bacteria 17317
43 Ga0097621_100001192 3300006237 Bacteria 18004
44 Ga0068871_100000088 3300006358 Bacteria 52878
45 Ga0068871_100011413 3300006358 Bacteria 6516
46 Ga0068865_100001897 3300006881 Bacteria 12289
47 Ga0105240_10000020 3300009093 Bacteria 399699
48 Ga0105240_10000107 3300009093 Bacteria 171629
49 Ga0105240_10000138 3300009093 Bacteria 149330
50 Ga0105240_10000180 3300009093 Bacteria 128683
51 Ga0105240_10000481 3300009093 Bacteria 73663
52 Ga0105240_10001664 3300009093 Bacteria 37743
53 Ga0105240_10005106 3300009093 Bacteria 19653
54 Ga0105240_10020998 3300009093 Bacteria 8692
55 Ga0105240_10040669 3300009093 Bacteria 5942
56 Ga0105240_10043231 3300009093 Bacteria 5734
57 Ga0105240_10048622 3300009093 Bacteria 5359
58 Ga0105240_10388359 3300009093 Bacteria 1575
59 Ga0105240_10465812 3300009093 Bacteria 1411
60 Ga0105241_10002169 3300009174 Bacteria 14783
61 Ga0105241_10007039 3300009174 Bacteria 8277
62 Ga0105241_10009258 3300009174 Bacteria 7242
63 Ga0105241_10133363 3300009174 Bacteria 2013
64 Ga0105242_10255133 3300009176 Unclassified 1582
65 Ga0105237_10000331 3300009545 Bacteria 66733
66 Ga0105237_10000702 3300009545 Bacteria 46425
67 Ga0105237_10000819 3300009545 Bacteria 42544
68 Ga0105237_10001981 3300009545 Bacteria 26059
69 Ga0105237_10002241 3300009545 Bacteria 24097
70 Ga0105237_10003005 3300009545 Bacteria 20354
71 Ga0105237_10004449 3300009545 Bacteria 16224
72 Ga0105237_10006014 3300009545 Bacteria 13577
73 Ga0105237_10016144 3300009545 Bacteria 7767
74 Ga0105237_10018545 3300009545 Bacteria 7199
75 Ga0105238_10020091 3300009551 Bacteria 6798
76 Ga0105238_10040251 3300009551 Bacteria 4737
77 Ga0105238_10043454 3300009551 Unclassified 4547
78 Ga0105238_10106922 3300009551 Bacteria 2779
79 Ga0105238_10147386 3300009551 Bacteria 2330
80 Ga0105239_10000005 3300010375 Bacteria 496066
81 Ga0105239_10000806 3300010375 Bacteria 44388
82 Ga0105239_10004652 3300010375 Bacteria 16316
83 Ga0105239_10006482 3300010375 Bacteria 13572
84 Ga0105239_10008412 3300010375 Bacteria 11746
85 Ga0105239_10017630 3300010375 Bacteria 7899
86 Ga0105239_10063200 3300010375 Bacteria 4064
87 Ga0105239_10077650 3300010375 Bacteria 3654
88 Ga0105239_10098569 3300010375 Unclassified 3231
89 Ga0105239_10135415 3300010375 Unclassified 2742
90 Ga0105239_10242994 3300010375 Bacteria 2021
91 Ga0105239_10404139 3300010375 Bacteria 1546
92 Ga0105239_10563008 3300010375 Bacteria 1298
93 Ga0105246_10115385 3300011119 Bacteria 1980
94 Ga0157373_10049303 3300013100 Bacteria 3001
95 Ga0157371_10003424 3300013102 Bacteria 14409
96 Ga0157369_10000461 3300013105 Bacteria 54029
97 Ga0157369_10034821 3300013105 Bacteria 5523
98 Ga0157374_10008877 3300013296 Bacteria 8608
99 Ga0157374_10019170 3300013296 Bacteria 6052
100 Ga0157374_10304321 3300013296 Unclassified 1577
101 Ga0157378_10016774 3300013297 Bacteria 6418
102 Ga0157378_10039448 3300013297 Bacteria 4188
103 Ga0157378_10090600 3300013297 Bacteria 2779
104 Ga0157378_10106659 3300013297 Bacteria 2563
105 Ga0157378_10297940 3300013297 Bacteria 1560
106 Ga0163162_10000256 3300013306 Bacteria 48230
107 Ga0163162_10002052 3300013306 Bacteria 18913
108 Ga0157372_10000001 3300013307 Bacteria 791349
109 Ga0157372_10025452 3300013307 Bacteria 6434
110 Ga0157372_10122935 3300013307 Bacteria 2983
111 Ga0157376_10013816 3300014969 Bacteria 6036
112 Ga0182005_1000215 3300015265 Bacteria 38214
113 Ga0163161_10002886 3300017792 Bacteria 12165
114 Ga0209436_103141 3300025208 Bacteria 4537
115 Ga0209437_100077 3300025233 Bacteria 286656
116 Ga0209026_1001081 3300025250 Bacteria 13127
117 Ga0207426_1007130 3300025302 Bacteria 4724
118 Ga0209257_1000001 3300025304 Bacteria 2274655
119 Ga0207647_10000273 3300025904 Bacteria 41974
120 Ga0207647_10034269 3300025904 Bacteria 3243
121 Ga0207645_10001268 3300025907 Bacteria 20776
122 Ga0207705_10000079 3300025909 Bacteria 119999
123 Ga0207705_10141510 3300025909 Unclassified 1797
124 Ga0207654_10001398 3300025911 Bacteria 12789
125 Ga0207695_10000020 3300025913 Bacteria 723025
126 Ga0207695_10000058 3300025913 Bacteria 366582
127 Ga0207695_10000064 3300025913 Bacteria 346010
128 Ga0207695_10000077 3300025913 Bacteria 307107
129 Ga0207695_10000139 3300025913 Bacteria 216873
130 Ga0207695_10000574 3300025913 Bacteria 75183
131 Ga0207695_10003090 3300025913 Bacteria 23836
132 Ga0207695_10003229 3300025913 Bacteria 23197
133 Ga0207695_10004186 3300025913 Bacteria 19828
134 Ga0207695_10018059 3300025913 Bacteria 8166
135 Ga0207695_10031472 3300025913 Bacteria 5817
136 Ga0207695_10034720 3300025913 Bacteria 5480
137 Ga0207695_10038128 3300025913 Bacteria 5178
138 Ga0207695_10113058 3300025913 Bacteria 2692
139 Ga0207671_10000499 3300025914 Bacteria 53290
140 Ga0207671_10000588 3300025914 Bacteria 48606
141 Ga0207671_10000709 3300025914 Bacteria 42749
142 Ga0207671_10002382 3300025914 Bacteria 20195
143 Ga0207671_10003441 3300025914 Bacteria 15787
144 Ga0207671_10007746 3300025914 Bacteria 9251
145 Ga0207671_10010405 3300025914 Bacteria 7677
146 Ga0207671_10049073 3300025914 Bacteria 3124
147 Ga0207671_10052389 3300025914 Bacteria 3024
148 Ga0207657_10006927 3300025919 Bacteria 11685
149 Ga0207652_10009797 3300025921 Bacteria 7713
150 Ga0207694_10044769 3300025924 Bacteria 3417
151 Ga0207694_10061297 3300025924 Bacteria 2927
152 Ga0207694_10099581 3300025924 Unclassified 2302
153 Ga0207706_10001455 3300025933 Bacteria 23670
154 Ga0207709_10012234 3300025935 Bacteria 4728
155 Ga0207704_10000192 3300025938 Bacteria 32150
156 Ga0207667_10000375 3300025949 Bacteria 60547
157 Ga0207667_10001830 3300025949 Bacteria 26721
158 Ga0207667_10002439 3300025949 Bacteria 23287
159 Ga0207667_10004143 3300025949 Bacteria 17812
160 Ga0207651_10057973 3300025960 Bacteria 2674
161 Ga0207640_10103790 3300025981 Bacteria 1999
162 Ga0207677_10012947 3300026023 Bacteria 4818
163 Ga0207639_10022674 3300026041 Bacteria 4524
164 Ga0207678_10015685 3300026067 Bacteria 6658
165 Ga0207702_10000389 3300026078 Bacteria 50060
166 Ga0207702_10020125 3300026078 Bacteria 5528
167 Ga0207648_10000287 3300026089 Bacteria 54959
168 Ga0207674_10026342 3300026116 Bacteria 6177
169 Ga0207698_10002009 3300026142 Bacteria 11999
170 Ga0268266_10000018 3300028379 Bacteria 569141
171 Ga0268266_10000024 3300028379 Bacteria 490820
172 Ga0268266_10053861 3300028379 Bacteria 3457
173 Ga0268264_10002061 3300028381 Bacteria 17930
174 Ga0265337_1002229 3300028556 Bacteria 9006
175 Ga0265326_10004527 3300028558 Unclassified 4445
176 Ga0265326_10007400 3300028558 Bacteria 3369
177 Ga0265319_1001785 3300028563 Bacteria 12323
178 Ga0265319_1004819 3300028563 Bacteria 6607
179 Ga0265334_10005970 3300028573 Bacteria 5298
180 Ga0265318_10007561 3300028577 Bacteria 4900
181 Ga0265323_10000769 3300028653 Bacteria 17197
182 Ga0265322_10000129 3300028654 Bacteria 35231
183 Ga0265322_10000147 3300028654 Bacteria 32119
184 Ga0265336_10000804 3300028666 Bacteria 16527
185 Ga0307517_10001574 3300028786 Bacteria 38060
186 Ga0265338_10001893 3300028800 Bacteria 32764
187 Ga0265338_10016714 3300028800 Bacteria 7950
188 Ga0265338_10017003 3300028800 Bacteria 7869
189 Ga0265324_10000570 3300029957 Bacteria 25229
190 Ga0265324_10006222 3300029957 Bacteria 5021
191 Ga0265330_10000280 3300031235 Bacteria 37537
192 Ga0265332_10000413 3300031238 Bacteria 30706
193 Ga0265328_10000877 3300031239 Bacteria 13907
194 Ga0265320_10000576 3300031240 Bacteria 28199
195 Ga0265320_10042484 3300031240 Bacteria 2254
196 Ga0265329_10002425 3300031242 Bacteria 8453
197 Ga0265339_10034854 3300031249 Bacteria 2827
198 Ga0265331_10000825 3300031250 Bacteria 25340
199 Ga0265327_10000172 3300031251 Bacteria 139400
200 Ga0265327_10008173 3300031251 Bacteria 7854
201 Ga0265316_10001677 3300031344 Bacteria 23565
202 Ga0265316_10028871 3300031344 Bacteria 4570
203 Ga0307509_10054225 3300031507 Bacteria 4270
204 Ga0265313_10010884 3300031595 Bacteria 5705
205 Ga0265314_10001074 3300031711 Bacteria 31688
206 Ga0265342_10000187 3300031712 Bacteria 69232
207 Ga0265342_10032734 3300031712 Bacteria 3204
208 Ga0307510_10029715 3300033180 Bacteria 6214
209 Ga0395899_0000121 3300037312 Bacteria 125324
210 Ga0395899_0000844 3300037312 Bacteria 29507
211 Ga0395899_0003500 3300037312 Bacteria 12436
212 Ga0395899_0233835 3300037312 Unclassified 1268
213 Ga0395900_0000517 3300037418 Bacteria 54614
214 Ga0395900_0001762 3300037418 Bacteria 24846
215 Ga0395900_0077821 3300037418 Unclassified 3408
216 Ga0395898_0008761 3300037466 Bacteria 10666
217 Ga0395905_0001173 3300037471 Bacteria 32718
218 Ga0395905_0001720 3300037471 Bacteria 25699
219 Ga0395901_0005919 3300038443 Bacteria 12383
220 Ga0395901_0046719 3300038443 Bacteria 4498
221 Ga0466972_0000068 3300044658 Bacteria 102183
222 Ga0466972_0009714 3300044658 Bacteria 4827
223 Ga0466966_0085283 3300044684 Bacteria 1963
224 Ga0466970_0000344 3300044765 Bacteria 22603
225 Ga0495627_012717 3300046453 Bacteria 2978
226 Ga0495650_0000003 3300046471 Bacteria 900730
227 Ga0495596_0011690 3300046500 Bacteria 3775
228 Ga0495606_0000143 3300046507 Bacteria 123231
229 Ga0495606_0005682 3300046507 Bacteria 11806
230 Ga0495610_0005465 3300046512 Bacteria 9023
231 Ga0495616_0005457 3300046513 Bacteria 7821
232 Ga0495631_0003944 3300046518 Bacteria 8017
233 Ga0495633_0000151 3300046558 Bacteria 91565
234 Ga0495611_0000042 3300046648 Bacteria 94996
235 Ga0495625_0000005 3300046660 Bacteria 596135
236 Ga0495625_0014319 3300046660 Bacteria 6336
237 Ga0495625_0041126 3300046660 Bacteria 3366
238 Ga0495661_0003570 3300046665 Bacteria 11445
239 Ga0495649_0000003 3300046694 Bacteria 880817
240 Ga0495636_0000001 3300047318 Bacteria 149950
241 Ga0495683_0026658 3300047323 Bacteria 2957
242 Ga0495686_0001299 3300047472 Bacteria 28153
243 Ga0495686_0007716 3300047472 Bacteria 8033
244 Ga0495686_0039019 3300047472 Bacteria 3036
245 Ga0496121_0000020 3300048924 Bacteria 498732
246 Ga0496126_0014327 3300048929 Bacteria 8018
247 Ga0495678_013325 3300049459 Bacteria 3864
248 Ga0501047_0008196 3300049581 Bacteria 9873
249 Ga0501044_0068830 3300049823 Bacteria 3605
250 Ga0500646_0022278 3300053090 Bacteria 1694
251 Ga0500583_0002060 3300053092 Bacteria 5951
252 Ga0500651_0012625 3300053093 Bacteria 5124
253 Ga0500608_001331 3300053122 Bacteria 8827
254 Ga0500608_027221 3300053122 Bacteria 2693
255 Ga0500618_000051 3300053125 Bacteria 104272
256 Ga0500658_0004279 3300053134 Bacteria 5350
257 Ga0500577_0004646 3300053142 Bacteria 3649
258 Ga0500616_0002889 3300053153 Bacteria 13770
259 Ga0500622_0007402 3300053156 Bacteria 6239
260 Ga0500624_000883 3300053157 Bacteria 6518

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048929 Ga0496126_0014327 Ga0496126_0014327_3527_4666 308
2 3300003794 Ga0055531_10000020 Ga0055531_1000002084 309
3 3300025304 Ga0209257_1000001 Ga0209257_10000011300 309
4 3300046660 Ga0495625_0041126 Ga0495625_0041126_2322_3353 313
5 3300009093 Ga0105240_10000481 Ga0105240_1000048126 316
6 3300025208 Ga0209436_103141 Ga0209436_1031412 318
7 3300025302 Ga0207426_1007130 Ga0207426_10071303 318
8 3300048924 Ga0496121_0000020 Ga0496121_0000020_334112_335257 318
9 3300031507 Ga0307509_10054225 Ga0307509_100542252 319
10 3300046648 Ga0495611_0000042 Ga0495611_0000042_12451_13575 319
11 3300009174 Ga0105241_10007039 Ga0105241_100070393 322
12 3300009551 Ga0105238_10043454 Ga0105238_100434542 322
13 3300010375 Ga0105239_10098569 Ga0105239_100985692 322
14 3300015265 Ga0182005_1000215 Ga0182005_100021513 322
15 3300025913 Ga0207695_10000574 Ga0207695_1000057432 322
16 3300025914 Ga0207671_10003441 Ga0207671_1000344112 322
17 3300047318 Ga0495636_0000001 Ga0495636_0000001_15339_16412 326
18 3300005548 Ga0070665_100000013 Ga0070665_100000013293 327
19 3300028379 Ga0268266_10000024 Ga0268266_10000024111 327
20 3300013297 Ga0157378_10106659 Ga0157378_101066592 328
21 3300014969 Ga0157376_10013816 Ga0157376_100138162 328
22 3300031251 Ga0265327_10000172 Ga0265327_1000017295 328
23 3300009545 Ga0105237_10004449 Ga0105237_100044495 330
24 3300010375 Ga0105239_10242994 Ga0105239_102429942 330
25 3300037312 Ga0395899_0233835 Ga0395899_0233835_178_1257 330
26 3300013297 Ga0157378_10016774 Ga0157378_100167746 334
27 3300005338 Ga0068868_100021730 Ga0068868_1000217302 335
28 3300005539 Ga0068853_100214477 Ga0068853_1002144771 335
29 3300005563 Ga0068855_100043146 Ga0068855_1000431462 335
30 3300005577 Ga0068857_100073949 Ga0068857_1000739492 335
31 3300005578 Ga0068854_100089218 Ga0068854_1000892182 335
32 3300009093 Ga0105240_10048622 Ga0105240_100486222 335
33 3300009174 Ga0105241_10133363 Ga0105241_101333632 335
34 3300009551 Ga0105238_10040251 Ga0105238_100402514 335
35 3300013100 Ga0157373_10049303 Ga0157373_100493033 335
36 3300013307 Ga0157372_10025452 Ga0157372_100254522 335
37 3300025913 Ga0207695_10031472 Ga0207695_100314724 335
38 3300025924 Ga0207694_10099581 Ga0207694_100995812 335
39 3300025981 Ga0207640_10103790 Ga0207640_101037902 335
40 3300026116 Ga0207674_10026342 Ga0207674_100263422 335
41 3300037418 Ga0395900_0077821 Ga0395900_0077821_400_1494 335
42 3300037471 Ga0395905_0001173 Ga0395905_0001173_21910_23004 335
43 3300038443 Ga0395901_0046719 Ga0395901_0046719_2371_3465 335
44 3300053156 Ga0500622_0007402 Ga0500622_0007402_2767_3864 335
45 3300013297 Ga0157378_10090600 Ga0157378_100906002 336
46 3300009545 Ga0105237_10003005 Ga0105237_100030052 337
47 3300025914 Ga0207671_10002382 Ga0207671_100023822 337
48 3300046507 Ga0495606_0005682 Ga0495606_0005682_504_1757 338
49 3300053090 Ga0500646_0022278 Ga0500646_0022278_456_1595 340
50 3300053092 Ga0500583_0002060 Ga0500583_0002060_4406_5542 340
51 3300053134 Ga0500658_0004279 Ga0500658_0004279_1110_2249 340
52 3300053142 Ga0500577_0004646 Ga0500577_0004646_1264_2403 340
53 3300053153 Ga0500616_0002889 Ga0500616_0002889_11971_13110 340
54 iso_pu_bacteria 2818991442 2819573764 340
55 iso_pu_bacteria 2821136567 2821137099 340
56 iso_pu_bacteria 2904467357 2904468159 340
57 3300005548 Ga0070665_100000020 Ga0070665_10000002062 341
58 3300009176 Ga0105242_10255133 Ga0105242_102551331 341
59 3300013306 Ga0163162_10000256 Ga0163162_1000025630 341
60 3300025935 Ga0207709_10012234 Ga0207709_100122342 341
61 3300028379 Ga0268266_10000018 Ga0268266_10000018146 341
62 3300037312 Ga0395899_0000121 Ga0395899_0000121_9141_10316 341
63 3300037418 Ga0395900_0000517 Ga0395900_0000517_32553_33722 341
64 3300005614 Ga0068856_100000270 Ga0068856_10000027014 342
65 3300026078 Ga0207702_10000389 Ga0207702_1000038929 342
66 3300003323 rootH1_10138889 rootH1_101388892 343
67 3300037312 Ga0395899_0003500 Ga0395899_0003500_6163_7359 343
68 3300037418 Ga0395900_0001762 Ga0395900_0001762_17655_18851 343
69 3300037466 Ga0395898_0008761 Ga0395898_0008761_7621_8817 343
70 3300037471 Ga0395905_0001720 Ga0395905_0001720_17655_18851 343
71 3300038443 Ga0395901_0005919 Ga0395901_0005919_5223_6419 343
72 3300009093 Ga0105240_10040669 Ga0105240_100406692 344
73 3300009093 Ga0105240_10465812 Ga0105240_104658122 344
74 3300010375 Ga0105239_10000005 Ga0105239_10000005198 344
75 3300013297 Ga0157378_10297940 Ga0157378_102979402 344
76 3300025913 Ga0207695_10018059 Ga0207695_100180592 344
77 3300005327 Ga0070658_10000049 Ga0070658_1000004941 345
78 3300005539 Ga0068853_100022754 Ga0068853_1000227544 345
79 3300005616 Ga0068852_100000197 Ga0068852_10000019732 345
80 3300005843 Ga0068860_100003042 Ga0068860_10000304210 345
81 3300009093 Ga0105240_10020998 Ga0105240_100209988 345
82 3300009545 Ga0105237_10016144 Ga0105237_100161442 345
83 3300009545 Ga0105237_10018545 Ga0105237_100185452 345
84 3300010375 Ga0105239_10063200 Ga0105239_100632002 345
85 3300010375 Ga0105239_10404139 Ga0105239_104041391 345
86 3300025909 Ga0207705_10000079 Ga0207705_1000007959 345
87 3300025913 Ga0207695_10038128 Ga0207695_100381286 345
88 3300025913 Ga0207695_10113058 Ga0207695_101130582 345
89 3300025914 Ga0207671_10010405 Ga0207671_100104052 345
90 3300025914 Ga0207671_10052389 Ga0207671_100523892 345
91 3300025919 Ga0207657_10006927 Ga0207657_100069275 345
92 3300025949 Ga0207667_10001830 Ga0207667_100018309 345
93 3300028381 Ga0268264_10002061 Ga0268264_100020614 345
94 3300028556 Ga0265337_1002229 Ga0265337_10022292 346
95 3300028558 Ga0265326_10007400 Ga0265326_100074002 346
96 3300028563 Ga0265319_1004819 Ga0265319_10048192 346
97 3300028573 Ga0265334_10005970 Ga0265334_100059702 346
98 3300028577 Ga0265318_10007561 Ga0265318_100075612 346
99 3300028666 Ga0265336_10000804 Ga0265336_100008042 346
100 3300028800 Ga0265338_10016714 Ga0265338_100167149 346
101 3300031240 Ga0265320_10042484 Ga0265320_100424842 346
102 3300031249 Ga0265339_10034854 Ga0265339_100348542 346
103 3300031595 Ga0265313_10010884 Ga0265313_100108842 346
104 3300031712 Ga0265342_10032734 Ga0265342_100327342 346
105 3300009093 Ga0105240_10000180 Ga0105240_1000018010 347
106 3300025913 Ga0207695_10000077 Ga0207695_10000077101 347
107 3300009093 Ga0105240_10000107 Ga0105240_1000010710 348
108 3300025913 Ga0207695_10000139 Ga0207695_1000013942 348
109 3300005539 Ga0068853_100004591 Ga0068853_1000045913 349
110 3300010375 Ga0105239_10006482 Ga0105239_100064823 349
111 3300025913 Ga0207695_10034720 Ga0207695_100347202 349
112 3300025924 Ga0207694_10061297 Ga0207694_100612972 349
113 3300025949 Ga0207667_10000375 Ga0207667_1000037525 349
114 3300046660 Ga0495625_0014319 Ga0495625_0014319_203_1336 349
115 3300049459 Ga0495678_013325 Ga0495678_013325_2266_3399 349
116 3300053157 Ga0500624_000883 Ga0500624_000883_2181_3347 349
117 3300002741 JGI25157J39369_1008959 JGI25157J39369_10089592 350
118 3300025250 Ga0209026_1001081 Ga0209026_10010816 350
119 3300047472 Ga0495686_0007716 Ga0495686_0007716_5810_6949 350
120 3300028558 Ga0265326_10004527 Ga0265326_100045272 352
121 3300028563 Ga0265319_1001785 Ga0265319_10017854 352
122 3300028653 Ga0265323_10000769 Ga0265323_100007694 352
123 3300028654 Ga0265322_10000147 Ga0265322_100001474 352
124 3300029957 Ga0265324_10000570 Ga0265324_1000057013 352
125 3300031235 Ga0265330_10000280 Ga0265330_1000028017 352
126 3300031238 Ga0265332_10000413 Ga0265332_1000041323 352
127 3300031239 Ga0265328_10000877 Ga0265328_1000087710 352
128 3300031240 Ga0265320_10000576 Ga0265320_1000057613 352
129 3300031242 Ga0265329_10002425 Ga0265329_100024253 352
130 3300031250 Ga0265331_10000825 Ga0265331_100008254 352
131 3300031344 Ga0265316_10001677 Ga0265316_1000167717 352
132 3300031711 Ga0265314_10001074 Ga0265314_1000107423 352
133 3300031712 Ga0265342_10000187 Ga0265342_1000018711 352
134 3300013296 Ga0157374_10304321 Ga0157374_103043212 353
135 3300031251 Ga0265327_10008173 Ga0265327_100081735 353
136 3300046453 Ga0495627_012717 Ga0495627_012717_1285_2454 353
137 3300046558 Ga0495633_0000151 Ga0495633_0000151_63013_64182 353
138 3300049581 Ga0501047_0008196 Ga0501047_0008196_5382_6533 353
139 3300049823 Ga0501044_0068830 Ga0501044_0068830_1837_2988 353
140 3300053093 Ga0500651_0012625 Ga0500651_0012625_115_1284 353
141 3300028654 Ga0265322_10000129 Ga0265322_100001294 354
142 3300031344 Ga0265316_10028871 Ga0265316_100288712 354
143 3300025904 Ga0207647_10034269 Ga0207647_100342692 355
144 3300044658 Ga0466972_0009714 Ga0466972_0009714_3303_4478 355
145 3300005548 Ga0070665_100058046 Ga0070665_1000580462 356
146 3300005614 Ga0068856_100024208 Ga0068856_1000242084 356
147 3300010375 Ga0105239_10135415 Ga0105239_101354152 356
148 3300026078 Ga0207702_10020125 Ga0207702_100201252 356
149 3300028379 Ga0268266_10053861 Ga0268266_100538612 356
150 3300009093 Ga0105240_10000138 Ga0105240_1000013814 357
151 3300009093 Ga0105240_10001664 Ga0105240_1000166418 357
152 3300009545 Ga0105237_10000331 Ga0105237_1000033111 357
153 3300009551 Ga0105238_10106922 Ga0105238_101069222 357
154 3300009551 Ga0105238_10147386 Ga0105238_101473862 357
155 3300010375 Ga0105239_10004652 Ga0105239_100046523 357
156 3300010375 Ga0105239_10017630 Ga0105239_100176302 357
157 3300025913 Ga0207695_10000058 Ga0207695_10000058276 357
158 3300025913 Ga0207695_10000064 Ga0207695_10000064215 357
159 3300025914 Ga0207671_10000709 Ga0207671_1000070933 357
160 3300005544 Ga0070686_100050106 Ga0070686_1000501062 358
161 3300028800 Ga0265338_10001893 Ga0265338_100018932 358
162 3300028800 Ga0265338_10017003 Ga0265338_100170032 358
163 3300029957 Ga0265324_10006222 Ga0265324_100062222 358
164 3300005563 Ga0068855_100000340 Ga0068855_1000003406 359
165 3300025949 Ga0207667_10002439 Ga0207667_1000243912 359
166 3300003320 rootH2_10001891 rootH2_1000189182 361
167 3300005327 Ga0070658_10049767 Ga0070658_100497672 361
168 3300005328 Ga0070676_10002483 Ga0070676_100024833 361
169 3300005338 Ga0068868_100013185 Ga0068868_1000131852 361
170 3300005364 Ga0070673_100004946 Ga0070673_10000494610 361
171 3300005457 Ga0070662_100000153 Ga0070662_10000015320 361
172 3300005459 Ga0068867_100000990 Ga0068867_1000009907 361
173 3300005539 Ga0068853_100204107 Ga0068853_1002041071 361
174 3300005563 Ga0068855_100050239 Ga0068855_1000502395 361
175 3300005614 Ga0068856_100161869 Ga0068856_1001618692 361
176 3300005616 Ga0068852_100001564 Ga0068852_1000015646 361
177 3300006237 Ga0097621_100001192 Ga0097621_1000011926 361
178 3300006358 Ga0068871_100000088 Ga0068871_1000000887 361
179 3300006881 Ga0068865_100001897 Ga0068865_1000018972 361
180 3300009093 Ga0105240_10000020 Ga0105240_10000020386 361
181 3300009093 Ga0105240_10005106 Ga0105240_100051068 361
182 3300009093 Ga0105240_10043231 Ga0105240_100432312 361
183 3300009174 Ga0105241_10002169 Ga0105241_1000216914 361
184 3300009174 Ga0105241_10009258 Ga0105241_100092588 361
185 3300009545 Ga0105237_10000702 Ga0105237_1000070213 361
186 3300009545 Ga0105237_10000819 Ga0105237_1000081922 361
187 3300009545 Ga0105237_10006014 Ga0105237_100060148 361
188 3300009551 Ga0105238_10020091 Ga0105238_100200913 361
189 3300010375 Ga0105239_10008412 Ga0105239_100084123 361
190 3300011119 Ga0105246_10115385 Ga0105246_101153851 361
191 3300013105 Ga0157369_10034821 Ga0157369_100348213 361
192 3300013296 Ga0157374_10008877 Ga0157374_100088778 361
193 3300013297 Ga0157378_10039448 Ga0157378_100394482 361
194 3300013307 Ga0157372_10122935 Ga0157372_101229352 361
195 3300025904 Ga0207647_10000273 Ga0207647_1000027315 361
196 3300025907 Ga0207645_10001268 Ga0207645_1000126813 361
197 3300025909 Ga0207705_10141510 Ga0207705_101415102 361
198 3300025911 Ga0207654_10001398 Ga0207654_1000139811 361
199 3300025913 Ga0207695_10000020 Ga0207695_10000020138 361
200 3300025913 Ga0207695_10003090 Ga0207695_100030908 361
201 3300025913 Ga0207695_10003229 Ga0207695_1000322912 361
202 3300025914 Ga0207671_10000499 Ga0207671_1000049932 361
203 3300025914 Ga0207671_10007746 Ga0207671_100077462 361
204 3300025924 Ga0207694_10044769 Ga0207694_100447692 361
205 3300025933 Ga0207706_10001455 Ga0207706_1000145515 361
206 3300025938 Ga0207704_10000192 Ga0207704_100001922 361
207 3300025949 Ga0207667_10004143 Ga0207667_100041432 361
208 3300025960 Ga0207651_10057973 Ga0207651_100579732 361
209 3300026023 Ga0207677_10012947 Ga0207677_100129472 361
210 3300026041 Ga0207639_10022674 Ga0207639_100226744 361
211 3300026089 Ga0207648_10000287 Ga0207648_1000028723 361
212 3300026142 Ga0207698_10002009 Ga0207698_100020093 361
213 3300028786 Ga0307517_10001574 Ga0307517_1000157415 361
214 3300033180 Ga0307510_10029715 Ga0307510_100297152 361
215 3300046500 Ga0495596_0011690 Ga0495596_0011690_1618_2838 361
216 3300046518 Ga0495631_0003944 Ga0495631_0003944_4824_6044 361
217 3300047323 Ga0495683_0026658 Ga0495683_0026658_624_1844 361
218 3300047472 Ga0495686_0001299 Ga0495686_0001299_5164_6414 361
219 3300053122 Ga0500608_001331 Ga0500608_001331_6202_7422 361
220 3300004799 Ga0058863_11811112 Ga0058863_118111122 362
221 3300005530 Ga0070679_100004199 Ga0070679_1000041998 362
222 3300025921 Ga0207652_10009797 Ga0207652_100097972 362
223 3300003320 rootH2_10024022 rootH2_100240229 363
224 3300013296 Ga0157374_10019170 Ga0157374_100191703 363
225 3300013306 Ga0163162_10002052 Ga0163162_100020522 363
226 3300005614 Ga0068856_100004283 Ga0068856_1000042833 364
227 3300053125 Ga0500618_000051 Ga0500618_000051_23650_24831 364
228 3300003316 rootH1_10033995 rootH1_100339953 365
229 3300003323 rootH1_10221240 rootH1_102212402 365
230 3300005288 Ga0065714_10003193 Ga0065714_100031932 365
231 3300005563 Ga0068855_100058480 Ga0068855_1000584802 365
232 3300009093 Ga0105240_10388359 Ga0105240_103883592 365
233 3300009545 Ga0105237_10001981 Ga0105237_100019813 365
234 3300010375 Ga0105239_10000806 Ga0105239_100008062 365
235 3300010375 Ga0105239_10077650 Ga0105239_100776502 365
236 3300017792 Ga0163161_10002886 Ga0163161_1000288611 365
237 3300025233 Ga0209437_100077 Ga0209437_100077101 365
238 3300025914 Ga0207671_10049073 Ga0207671_100490732 365
239 3300046471 Ga0495650_0000003 Ga0495650_0000003_535889_537073 365
240 3300046507 Ga0495606_0000143 Ga0495606_0000143_19506_20690 365
241 3300046512 Ga0495610_0005465 Ga0495610_0005465_2393_3577 365
242 3300046513 Ga0495616_0005457 Ga0495616_0005457_4383_5567 365
243 3300046660 Ga0495625_0000005 Ga0495625_0000005_471958_473142 365
244 3300046665 Ga0495661_0003570 Ga0495661_0003570_6810_7994 365
245 3300046694 Ga0495649_0000003 Ga0495649_0000003_652716_653900 365
246 3300047472 Ga0495686_0039019 Ga0495686_0039019_646_1830 365
247 3300053122 Ga0500608_027221 Ga0500608_027221_1119_2303 365
248 3300005334 Ga0068869_100104613 Ga0068869_1001046131 366
249 3300006358 Ga0068871_100011413 Ga0068871_1000114132 366
250 3300044658 Ga0466972_0000068 Ga0466972_0000068_66300_67505 366
251 3300044765 Ga0466970_0000344 Ga0466970_0000344_2951_4156 366
252 3300010375 Ga0105239_10563008 Ga0105239_105630081 367
253 3300025913 Ga0207695_10004186 Ga0207695_1000418611 367
254 3300001979 JGI24740J21852_10027621 JGI24740J21852_100276212 368
255 3300009545 Ga0105237_10002241 Ga0105237_1000224119 368
256 3300013102 Ga0157371_10003424 Ga0157371_100034243 368
257 3300013105 Ga0157369_10000461 Ga0157369_1000046135 368
258 3300013307 Ga0157372_10000001 Ga0157372_1000000187 368
259 3300025914 Ga0207671_10000588 Ga0207671_1000058831 368
260 3300026067 Ga0207678_10015685 Ga0207678_100156854 368
261 3300037312 Ga0395899_0000844 Ga0395899_0000844_17667_18857 368
262 3300044684 Ga0466966_0085283 Ga0466966_0085283_637_1827 368

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13533

Biotin_lipoyl_2

Biotin-lipoyl like

53

105

0.96

PF13437

HlyD_3

HlyD family secretion protein

167

279

0.86

PF16576

HlyD_D23

Barrel-sandwich domain of CusB or HlyD membrane-fusion

51

281

0.7

Structural Annotation

Top 5 Hits

ID Description Score Start End
4qsh-assembly1.cif.gz_B crystal structure of l. monocytogenes pyruvate carboxylase in complex with cyclic-di-amp 0.9487 61 172
4qsh-assembly1.cif.gz_A crystal structure of l. monocytogenes pyruvate carboxylase in complex with cyclic-di-amp 0.948 61 172
7wta-assembly1.cif.gz_D cryo-em structure of human pyruvate carboxylase in apo state 0.9457 61 172
3hb9-assembly1.cif.gz_B crystal structure of s. aureus pyruvate carboxylase a610t mutant 0.937 61 172
4qsh-assembly1.cif.gz_C crystal structure of l. monocytogenes pyruvate carboxylase in complex with cyclic-di-amp 0.9355 61 172
ID Description Score Start End Superfamily
af_P71538_589_656_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.96 62 173 2.40.50.100
af_Q9UUE1_1106_1184_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9475 61 172 2.40.50.100
af_P71538_589_656_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9465 62 173 2.40.50.100
3bg5D06 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9369 60 172 2.40.50.100
af_Q4CS16_606_674_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9366 60 171 2.40.50.100
ID Description Score Start End GO Terms
AF-Q1NIC9-F1-model_v4 deleted 0.7548 127 358
AF-A0A7Y8NWP9-F1-model_v4 RND transporter 0.7522 1 351 GO:0015562
GO:1990281
AF-Q1NIC9-F1-model_v4 deleted 0.7394 127 358
AF-A0A7C6EW35-F1-model_v4 HlyD family efflux transporter periplasmic adaptor subunit 0.7377 1 351 GO:0015562
GO:1990281
AF-A0A1Y4DJ57-F1-model_v4 RND efflux pump membrane fusion protein barrel-sandwich domain-containing protein 0.7368 25 352 GO:0015562
GO:1990281

Feature Viewer

pLDDT pTM Quality
75.87 0.6 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map