F370737

General Info

Members Datasets Scaffolds Average Seq Length
261 195 522 299

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2954673503|2954679759
Length 340
Sequence PLGFNGLLVDRGEVSDARRTDVVLLLVAIVWGSSYLSAQTATSALPVLLVLLARYALSALACLGVLVSGRGPRRWTREELRAGVPLGLTQAAVLVVETYGVAHTSAANAGLIISLTIVLTPLLDRTGHRGGLPPAFYAAAGVCVLAVGLLMAGNGFHAPRLGDLLMLGAAVVRAGHVALVGRLTTGRAIRPMHLTAVQTLVGTALFLPLSAHELPTLAHAGTATWAQLLYLALFCSVFAFLAQTWAVQRTSASRASLLLGTEPIWAAAVGLALGGEHFTALTGLGAVLMVTGTYWGQSVERAHRGAAPPRAEAHAHLTDEEPPKPDDARDTTTPATPTAV

Samples

Sample ID Description Type Environment
1 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
11 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
12 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
13 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
14 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
15 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
16 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
17 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
18 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
19 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
20 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
21 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
22 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
23 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
24 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
25 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
26 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
27 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
28 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
29 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
43 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
44 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
45 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
46 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
47 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
48 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
49 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
50 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
51 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
52 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
53 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
54 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
55 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
56 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
57 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
58 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
59 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
60 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
61 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
62 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
63 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
64 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
65 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
66 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
67 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
68 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
69 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
70 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
71 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
72 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
73 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
74 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
75 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
76 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
77 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
78 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
79 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
80 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
81 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
82 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
83 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
84 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
85 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
86 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
87 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
88 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
89 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
90 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
91 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
92 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
93 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
94 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
95 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
96 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
97 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
98 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
99 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
100 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
101 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
102 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
103 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
104 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
105 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
106 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
107 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
108 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
109 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
110 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
111 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
112 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
113 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
114 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
115 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
116 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
117 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
118 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
119 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
120 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
121 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
122 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
123 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
124 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
125 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
126 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
127 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
128 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
129 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
130 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
131 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
132 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
133 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
134 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
145 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
147 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
148 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
149 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
150 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
151 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
152 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
153 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
154 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
155 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
156 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
157 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
158 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
159 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
160 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
161 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
162 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
163 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
164 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
165 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
166 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
167 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
168 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
169 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
170 2643221647 Streptomyces sp. Root369 Isolate Unclassified
171 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
172 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
173 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
174 2808606700 Arthrobacter agilis UMCV2 Isolate Rhizosphere
175 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
176 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
177 2867428634 Streptomyces sp. RP5T Isolate Unclassified
178 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
179 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
180 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
181 2946003308 Arthrobacter agilis W3I6 Isolate Rhizosphere
182 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
183 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
184 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
185 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
186 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
187 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
188 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
189 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
190 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
191 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
192 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
193 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
194 8004021418 Arthrobacter sp. SDTb3-6 Isolate Rhizosphere
195 8004025490 Arthrobacter wenxiniae AETb3-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.89
Metatranscriptomes 0
Isolates 11.11

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.2
Nodule 0.38
Rhizoplane 1.15
Rhizosphere 78.16
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10029444 3300001989 Bacteria 1909
2 JGI24737J22298_10011134 3300001990 Bacteria 2951
3 JGI24735J21928_10057252 3300002067 Bacteria 1122
4 rootH2_10015303 3300003320 Bacteria 5810
5 rootH2_10143127 3300003320 Bacteria 2522
6 rootH1_10096381 3300003323 Bacteria 1615
7 Ga0070683_100171720 3300005329 Bacteria 2058
8 Ga0068869_100453676 3300005334 Bacteria 1063
9 Ga0070668_100000254 3300005347 Bacteria 35369
10 Ga0070668_100076407 3300005347 Bacteria 2616
11 Ga0070667_100142407 3300005367 Bacteria 2101
12 Ga0068853_100122170 3300005539 Bacteria 2324
13 Ga0070665_100090279 3300005548 Bacteria 3069
14 Ga0068855_100014250 3300005563 Bacteria 9577
15 Ga0068857_100116227 3300005577 Bacteria 2406
16 Ga0068856_100055719 3300005614 Bacteria 3902
17 Ga0068861_100144833 3300005719 Bacteria 1943
18 Ga0068851_10106441 3300005834 Bacteria 1493
19 Ga0068858_100311270 3300005842 Bacteria 1504
20 Ga0068862_100021698 3300005844 Bacteria 5371
21 Ga0075368_10009566 3300006042 Bacteria 3486
22 Ga0075367_10037126 3300006178 Bacteria 2829
23 Ga0075370_10089738 3300006353 Bacteria 1772
24 Ga0099826_10100580 3300006948 Bacteria 1745
25 Ga0105241_10008948 3300009174 Bacteria 7360
26 Ga0105238_10018007 3300009551 Bacteria 7182
27 Ga0157370_10013157 3300013104 Bacteria 8533
28 Ga0157370_10471491 3300013104 Bacteria 1154
29 Ga0157374_10022776 3300013296 Bacteria 5594
30 Ga0157372_10020290 3300013307 Bacteria 7168
31 Ga0157372_10308985 3300013307 Bacteria 1840
32 Ga0182008_10022135 3300014497 Bacteria 3256
33 Ga0207647_10013387 3300025904 Bacteria 5689
34 Ga0207654_10027325 3300025911 Bacteria 3101
35 Ga0207695_10039459 3300025913 Bacteria 5076
36 Ga0207671_10001446 3300025914 Bacteria 27434
37 Ga0207694_10001754 3300025924 Bacteria 18188
38 Ga0207667_10199463 3300025949 Bacteria 2053
39 Ga0207668_10000442 3300025972 Bacteria 26181
40 Ga0207668_10050713 3300025972 Bacteria 2862
41 Ga0207640_10032212 3300025981 Bacteria 3248
42 Ga0207658_10055563 3300025986 Bacteria 2935
43 Ga0207658_10060495 3300025986 Bacteria 2827
44 Ga0207639_10063198 3300026041 Bacteria 2865
45 Ga0207702_10051788 3300026078 Bacteria 3471
46 Ga0207674_10134750 3300026116 Bacteria 2432
47 Ga0268265_10006664 3300028380 Bacteria 7816
48 Ga0307517_10002151 3300028786 Bacteria 32012
49 Ga0307515_10004662 3300028794 Bacteria 28143
50 Ga0307515_10105140 3300028794 Bacteria 3364
51 Ga0307512_10007756 3300030522 Bacteria 10563
52 Ga0307512_10020139 3300030522 Bacteria 6049
53 Ga0307513_10045757 3300031456 Bacteria 4779
54 Ga0307513_10056938 3300031456 Bacteria 4170
55 Ga0307509_10291320 3300031507 Bacteria 1387
56 Ga0307508_10006649 3300031616 Bacteria 10860
57 Ga0307508_10008028 3300031616 Bacteria 9782
58 Ga0307508_10057464 3300031616 Bacteria 3442
59 Ga0307514_10042075 3300031649 Bacteria 3595
60 Ga0307516_10023090 3300031730 Bacteria 6382
61 Ga0307516_10038226 3300031730 Bacteria 4791
62 Ga0307516_10262488 3300031730 Bacteria 1417
63 Ga0307516_10297097 3300031730 Bacteria 1292
64 Ga0307409_100010357 3300031995 Bacteria 5793
65 Ga0307507_10208577 3300033179 Bacteria 1337
66 Ga0373939_0091684 3300035114 Bacteria 1028
67 Ga0373942_0001804 3300035207 Bacteria 5419
68 Ga0373962_0001774 3300035242 Bacteria 5137
69 Ga0395898_0003312 3300037466 Bacteria 18085
70 Ga0395901_0152055 3300038443 Bacteria 2432
71 Ga0451853_2520117 3300041512 Bacteria 10439
72 Ga0439448_0003001 3300042005 Bacteria 4634
73 Ga0439449_0046493 3300042007 Bacteria 1608
74 Ga0439458_0001428 3300042157 Bacteria 6018
75 Ga0466966_0107789 3300044684 Bacteria 1719
76 Ga0466961_0055367 3300044693 Bacteria 2529
77 Ga0466961_0180139 3300044693 Bacteria 1312
78 Ga0466963_0017846 3300044694 Bacteria 4428
79 Ga0466960_0006197 3300044901 Bacteria 4790
80 Ga0466967_0033952 3300045976 Bacteria 4324
81 Ga0466967_0556727 3300045976 Bacteria 1129
82 Ga0495617_004341 3300046452 Bacteria 5169
83 Ga0495627_033209 3300046453 Bacteria 1619
84 Ga0495603_0013188 3300046455 Bacteria 4996
85 Ga0495603_0049992 3300046455 Bacteria 2487
86 Ga0495629_0013345 3300046459 Bacteria 5927
87 Ga0495629_0014434 3300046459 Bacteria 5683
88 Ga0495629_0016117 3300046459 Bacteria 5366
89 Ga0495638_0063524 3300046460 Bacteria 2276
90 Ga0495651_0006287 3300046462 Bacteria 9085
91 Ga0495651_0027488 3300046462 Bacteria 4431
92 Ga0495651_0068434 3300046462 Bacteria 2706
93 Ga0495653_0004776 3300046463 Bacteria 10980
94 Ga0495580_0002130 3300046472 Bacteria 17360
95 Ga0495580_0231927 3300046472 Bacteria 1267
96 Ga0495582_0006964 3300046473 Bacteria 6288
97 Ga0495605_0000809 3300046474 Bacteria 22331
98 Ga0495639_0005331 3300046475 Bacteria 5537
99 Ga0495662_0008528 3300046476 Bacteria 5037
100 Ga0495594_0014336 3300046499 Bacteria 4150
101 Ga0495594_0019598 3300046499 Bacteria 3596
102 Ga0495594_0048959 3300046499 Bacteria 2322
103 Ga0495594_0049972 3300046499 Bacteria 2299
104 Ga0495607_0042155 3300046501 Bacteria 2707
105 Ga0495583_0003800 3300046506 Bacteria 11210
106 Ga0495583_0010522 3300046506 Bacteria 5389
107 Ga0495606_0005826 3300046507 Bacteria 11623
108 Ga0495616_0006041 3300046513 Bacteria 7378
109 Ga0495618_0118636 3300046514 Bacteria 1694
110 Ga0495620_0001504 3300046515 Bacteria 13877
111 Ga0495620_0005100 3300046515 Bacteria 7354
112 Ga0495628_0086711 3300046516 Bacteria 2427
113 Ga0495630_0059105 3300046517 Bacteria 2875
114 Ga0495631_0044895 3300046518 Bacteria 1946
115 Ga0495632_0023145 3300046519 Bacteria 3321
116 Ga0495632_0043691 3300046519 Bacteria 2239
117 Ga0495632_0081829 3300046519 Bacteria 1539
118 Ga0495637_0047475 3300046520 Bacteria 1812
119 Ga0495637_0076532 3300046520 Bacteria 1341
120 Ga0495643_0001461 3300046522 Bacteria 21642
121 Ga0495643_0004486 3300046522 Bacteria 9745
122 Ga0495666_0017497 3300046526 Bacteria 3569
123 Ga0495666_0048820 3300046526 Bacteria 2037
124 Ga0495652_0018568 3300046529 Bacteria 6198
125 Ga0495652_0072451 3300046529 Bacteria 2871
126 Ga0495652_0162811 3300046529 Bacteria 1730
127 Ga0495640_0041414 3300046533 Bacteria 3218
128 Ga0495587_0043893 3300046536 Bacteria 2660
129 Ga0495645_0059543 3300046543 Bacteria 2769
130 Ga0495645_0179840 3300046543 Bacteria 1450
131 Ga0495622_0003155 3300046557 Bacteria 7800
132 Ga0495667_0003449 3300046559 Bacteria 10597
133 Ga0495634_0029893 3300046642 Bacteria 3767
134 Ga0495634_0040668 3300046642 Bacteria 3160
135 Ga0495611_0031715 3300046648 Bacteria 2327
136 Ga0495625_0041337 3300046660 Bacteria 3356
137 Ga0495625_0058458 3300046660 Bacteria 2740
138 Ga0495635_0034822 3300046663 Bacteria 3492
139 Ga0495635_0070808 3300046663 Bacteria 2390
140 Ga0495661_0044052 3300046665 Bacteria 2738
141 Ga0495588_0000642 3300046674 Bacteria 16256
142 Ga0495657_0001305 3300046675 Bacteria 21708
143 Ga0495657_0005734 3300046675 Bacteria 9779
144 Ga0495599_0055413 3300046678 Bacteria 2483
145 Ga0495623_0041499 3300046679 Bacteria 2933
146 Ga0495646_0044733 3300046680 Bacteria 2706
147 Ga0495613_0005759 3300046689 Bacteria 9277
148 Ga0495613_0017804 3300046689 Bacteria 5294
149 Ga0495613_0035180 3300046689 Bacteria 3718
150 Ga0495613_0095721 3300046689 Bacteria 2147
151 Ga0495670_0007913 3300046691 Bacteria 5225
152 Ga0495649_0046009 3300046694 Bacteria 2377
153 Ga0495589_0040883 3300046794 Bacteria 2314
154 Ga0495600_0009275 3300046809 Bacteria 6072
155 Ga0495600_0163368 3300046809 Bacteria 1439
156 Ga0495660_0008660 3300046810 Bacteria 5953
157 Ga0495581_0036234 3300047315 Bacteria 2854
158 Ga0495581_0099538 3300047315 Bacteria 1689
159 Ga0495581_0117538 3300047315 Bacteria 1546
160 Ga0495604_0005714 3300047317 Bacteria 9866
161 Ga0495604_0067951 3300047317 Bacteria 2706
162 Ga0495604_0129185 3300047317 Bacteria 1818
163 Ga0495636_0019305 3300047318 Bacteria 2739
164 Ga0495674_0056120 3300047319 Bacteria 3452
165 Ga0495674_0086205 3300047319 Bacteria 2689
166 Ga0495676_0004978 3300047321 Bacteria 12180
167 Ga0495680_0292496 3300047322 Bacteria 1145
168 Ga0495683_0052533 3300047323 Bacteria 2034
169 Ga0495687_007005 3300047443 Bacteria 6763
170 Ga0495687_067558 3300047443 Bacteria 1446
171 Ga0495675_0003213 3300047444 Bacteria 9825
172 Ga0495675_0052410 3300047444 Bacteria 2590
173 Ga0495675_0064551 3300047444 Bacteria 2316
174 Ga0495675_0223009 3300047444 Bacteria 1140
175 Ga0495679_025468 3300047446 Bacteria 1977
176 Ga0495685_002296 3300047447 Bacteria 5962
177 Ga0495685_002687 3300047447 Bacteria 5604
178 Ga0495685_005020 3300047447 Bacteria 4305
179 Ga0495681_0002864 3300047470 Bacteria 12190
180 Ga0495681_0074665 3300047470 Bacteria 1528
181 Ga0495684_0069458 3300047471 Bacteria 2678
182 Ga0495686_0010494 3300047472 Bacteria 6584
183 Ga0495686_0033473 3300047472 Bacteria 3318
184 Ga0495593_0091867 3300047673 Bacteria 1562
185 Ga0495602_0031374 3300048088 Bacteria 5024
186 Ga0495614_0084512 3300048089 Bacteria 1377
187 Ga0496109_0020031 3300048912 Bacteria 5907
188 Ga0496110_0160933 3300048913 Bacteria 2035
189 Ga0496112_0172679 3300048915 Bacteria 2127
190 Ga0501031_0015037 3300049568 Bacteria 5027
191 Ga0501033_0054463 3300049570 Bacteria 2959
192 Ga0501034_0016731 3300049571 Bacteria 7519
193 Ga0501037_0040209 3300049573 Bacteria 3441
194 Ga0501038_0004361 3300049574 Bacteria 13162
195 Ga0501039_0050296 3300049575 Bacteria 3224
196 Ga0501039_0087032 3300049575 Bacteria 2434
197 Ga0501042_0033159 3300049578 Bacteria 3660
198 Ga0501042_0220036 3300049578 Bacteria 1369
199 Ga0501043_0069526 3300049579 Bacteria 2765
200 Ga0501047_0000438 3300049581 Bacteria 46139
201 Ga0501047_0049743 3300049581 Bacteria 4047
202 Ga0501047_0079107 3300049581 Bacteria 3161
203 Ga0501047_0080769 3300049581 Bacteria 3125
204 Ga0501047_0098323 3300049581 Bacteria 2805
205 Ga0501048_0076848 3300049582 Bacteria 2356
206 Ga0501073_0266370 3300049589 Bacteria 1182
207 Ga0501035_0416655 3300049822 Bacteria 1115
208 Ga0501044_0036420 3300049823 Bacteria 5148
209 Ga0501044_0148175 3300049823 Bacteria 2330
210 Ga0501044_0193188 3300049823 Bacteria 1997
211 nmdc:mga06z11_14997_c1 3300050494 Bacteria 3449
212 Ga0495612_0097330 3300053078 Bacteria 1251
213 Ga0500578_0061068 3300053086 Bacteria 2406
214 Ga0500644_0006532 3300053088 Bacteria 2994
215 Ga0500651_0164404 3300053093 Bacteria 1325
216 Ga0500641_0035278 3300053096 Bacteria 1995
217 Ga0500650_0057313 3300053098 Bacteria 1816
218 Ga0500556_0048111 3300053104 Bacteria 1533
219 Ga0500560_004529 3300053107 Bacteria 2969
220 Ga0500569_002489 3300053109 Bacteria 3639
221 Ga0500628_002310 3300053129 Bacteria 3165
222 Ga0500652_001901 3300053131 Bacteria 6282
223 Ga0500652_011769 3300053131 Bacteria 3044
224 Ga0500658_0006173 3300053134 Bacteria 4456
225 Ga0500561_0000621 3300053137 Bacteria 5665
226 Ga0500573_0019771 3300053140 Bacteria 3854
227 Ga0500573_0102104 3300053140 Bacteria 1613
228 Ga0500600_0013287 3300053149 Bacteria 5000
229 Ga0500616_0038350 3300053153 Bacteria 2588
230 Ga0500633_0013272 3300053160 Bacteria 2303
231 Ga0500634_0005502 3300053161 Bacteria 6022
232 Ga0500656_000233 3300053732 Bacteria 3696
233 2954679759 2954673503 Bacteria 9685905
234 2585307224 2582581313 Bacteria 10042643
235 2616702908 2616644814 Bacteria 11555299
236 2644264756 2643221647 Bacteria 10741251
237 2785372318 2784746768 Bacteria 10036182
238 2786673454 2786546132 Bacteria 10419719
239 2808914331 2808606375 Bacteria 9466072
240 2810365311 2808606700 Bacteria 3482157
241 2811849090 2808606982 Bacteria 7791042
242 2855389618 2855386786 Bacteria 4752232
243 2867432161 2867428634 Bacteria 9590268
244 2877678333 2877676314 Bacteria 9512378
245 2912716840 2912715099 Bacteria 9460473
246 2912725647 2912723979 Bacteria 8557534
247 2946004770 2946003308 Bacteria 3857229
248 2947226107 2947224130 Bacteria 9938529
249 2954010269 2954002825 Bacteria 9173742
250 2954383247 2954380949 Bacteria 10050426
251 2954684394 2954682443 Bacteria 9862841
252 2954693957 2954691527 Bacteria 10720516
253 2954709063 2954701450 Bacteria 10834262
254 2954713580 2954711539 Bacteria 10867210
255 2954723544 2954721474 Bacteria 10456478
256 2954738287 2954731030 Bacteria 10243860
257 2954742449 2954740390 Bacteria 10229294
258 2954757148 2954749733 Bacteria 10366972
259 2954761417 2954759201 Bacteria 9358192
260 8004022994 8004021418 Bacteria 4313954
261 8004027203 8004025490 Bacteria 4327753
262 JGI24739J22299_10029444
263 JGI24737J22298_10011134
264 JGI24735J21928_10057252
265 rootH2_10015303
266 rootH2_10143127
267 rootH1_10096381
268 Ga0070683_100171720
269 Ga0068869_100453676
270 Ga0070668_100000254
271 Ga0070668_100076407
272 Ga0070667_100142407
273 Ga0068853_100122170
274 Ga0070665_100090279
275 Ga0068855_100014250
276 Ga0068857_100116227
277 Ga0068856_100055719
278 Ga0068861_100144833
279 Ga0068851_10106441
280 Ga0068858_100311270
281 Ga0068862_100021698
282 Ga0075368_10009566
283 Ga0075367_10037126
284 Ga0075370_10089738
285 Ga0099826_10100580
286 Ga0105241_10008948
287 Ga0105238_10018007
288 Ga0157370_10013157
289 Ga0157370_10471491
290 Ga0157374_10022776
291 Ga0157372_10020290
292 Ga0157372_10308985
293 Ga0182008_10022135
294 Ga0207647_10013387
295 Ga0207654_10027325
296 Ga0207695_10039459
297 Ga0207671_10001446
298 Ga0207694_10001754
299 Ga0207667_10199463
300 Ga0207668_10000442
301 Ga0207668_10050713
302 Ga0207640_10032212
303 Ga0207658_10055563
304 Ga0207658_10060495
305 Ga0207639_10063198
306 Ga0207702_10051788
307 Ga0207674_10134750
308 Ga0268265_10006664
309 Ga0307517_10002151
310 Ga0307515_10004662
311 Ga0307515_10105140
312 Ga0307512_10007756
313 Ga0307512_10020139
314 Ga0307513_10045757
315 Ga0307513_10056938
316 Ga0307509_10291320
317 Ga0307508_10006649
318 Ga0307508_10008028
319 Ga0307508_10057464
320 Ga0307514_10042075
321 Ga0307516_10023090
322 Ga0307516_10038226
323 Ga0307516_10262488
324 Ga0307516_10297097
325 Ga0307409_100010357
326 Ga0307507_10208577
327 Ga0373939_0091684
328 Ga0373942_0001804
329 Ga0373962_0001774
330 Ga0395898_0003312
331 Ga0395901_0152055
332 Ga0451853_2520117
333 Ga0439448_0003001
334 Ga0439449_0046493
335 Ga0439458_0001428
336 Ga0466966_0107789
337 Ga0466961_0055367
338 Ga0466961_0180139
339 Ga0466963_0017846
340 Ga0466960_0006197
341 Ga0466967_0033952
342 Ga0466967_0556727
343 Ga0495617_004341
344 Ga0495627_033209
345 Ga0495603_0013188
346 Ga0495603_0049992
347 Ga0495629_0013345
348 Ga0495629_0014434
349 Ga0495629_0016117
350 Ga0495638_0063524
351 Ga0495651_0006287
352 Ga0495651_0027488
353 Ga0495651_0068434
354 Ga0495653_0004776
355 Ga0495580_0002130
356 Ga0495580_0231927
357 Ga0495582_0006964
358 Ga0495605_0000809
359 Ga0495639_0005331
360 Ga0495662_0008528
361 Ga0495594_0014336
362 Ga0495594_0019598
363 Ga0495594_0048959
364 Ga0495594_0049972
365 Ga0495607_0042155
366 Ga0495583_0003800
367 Ga0495583_0010522
368 Ga0495606_0005826
369 Ga0495616_0006041
370 Ga0495618_0118636
371 Ga0495620_0001504
372 Ga0495620_0005100
373 Ga0495628_0086711
374 Ga0495630_0059105
375 Ga0495631_0044895
376 Ga0495632_0023145
377 Ga0495632_0043691
378 Ga0495632_0081829
379 Ga0495637_0047475
380 Ga0495637_0076532
381 Ga0495643_0001461
382 Ga0495643_0004486
383 Ga0495666_0017497
384 Ga0495666_0048820
385 Ga0495652_0018568
386 Ga0495652_0072451
387 Ga0495652_0162811
388 Ga0495640_0041414
389 Ga0495587_0043893
390 Ga0495645_0059543
391 Ga0495645_0179840
392 Ga0495622_0003155
393 Ga0495667_0003449
394 Ga0495634_0029893
395 Ga0495634_0040668
396 Ga0495611_0031715
397 Ga0495625_0041337
398 Ga0495625_0058458
399 Ga0495635_0034822
400 Ga0495635_0070808
401 Ga0495661_0044052
402 Ga0495588_0000642
403 Ga0495657_0001305
404 Ga0495657_0005734
405 Ga0495599_0055413
406 Ga0495623_0041499
407 Ga0495646_0044733
408 Ga0495613_0005759
409 Ga0495613_0017804
410 Ga0495613_0035180
411 Ga0495613_0095721
412 Ga0495670_0007913
413 Ga0495649_0046009
414 Ga0495589_0040883
415 Ga0495600_0009275
416 Ga0495600_0163368
417 Ga0495660_0008660
418 Ga0495581_0036234
419 Ga0495581_0099538
420 Ga0495581_0117538
421 Ga0495604_0005714
422 Ga0495604_0067951
423 Ga0495604_0129185
424 Ga0495636_0019305
425 Ga0495674_0056120
426 Ga0495674_0086205
427 Ga0495676_0004978
428 Ga0495680_0292496
429 Ga0495683_0052533
430 Ga0495687_007005
431 Ga0495687_067558
432 Ga0495675_0003213
433 Ga0495675_0052410
434 Ga0495675_0064551
435 Ga0495675_0223009
436 Ga0495679_025468
437 Ga0495685_002296
438 Ga0495685_002687
439 Ga0495685_005020
440 Ga0495681_0002864
441 Ga0495681_0074665
442 Ga0495684_0069458
443 Ga0495686_0010494
444 Ga0495686_0033473
445 Ga0495593_0091867
446 Ga0495602_0031374
447 Ga0495614_0084512
448 Ga0496109_0020031
449 Ga0496110_0160933
450 Ga0496112_0172679
451 Ga0501031_0015037
452 Ga0501033_0054463
453 Ga0501034_0016731
454 Ga0501037_0040209
455 Ga0501038_0004361
456 Ga0501039_0050296
457 Ga0501039_0087032
458 Ga0501042_0033159
459 Ga0501042_0220036
460 Ga0501043_0069526
461 Ga0501047_0000438
462 Ga0501047_0049743
463 Ga0501047_0079107
464 Ga0501047_0080769
465 Ga0501047_0098323
466 Ga0501048_0076848
467 Ga0501073_0266370
468 Ga0501035_0416655
469 Ga0501044_0036420
470 Ga0501044_0148175
471 Ga0501044_0193188
472 nmdc:mga06z11_14997_c1
473 Ga0495612_0097330
474 Ga0500578_0061068
475 Ga0500644_0006532
476 Ga0500651_0164404
477 Ga0500641_0035278
478 Ga0500650_0057313
479 Ga0500556_0048111
480 Ga0500560_004529
481 Ga0500569_002489
482 Ga0500628_002310
483 Ga0500652_001901
484 Ga0500652_011769
485 Ga0500658_0006173
486 Ga0500561_0000621
487 Ga0500573_0019771
488 Ga0500573_0102104
489 Ga0500600_0013287
490 Ga0500616_0038350
491 Ga0500633_0013272
492 Ga0500634_0005502
493 Ga0500656_000233
494 2954679759
495 2585307224
496 2616702908
497 2644264756
498 2785372318
499 2786673454
500 2808914331
501 2810365311
502 2811849090
503 2855389618
504 2867432161
505 2877678333
506 2912716840
507 2912725647
508 2946004770
509 2947226107
510 2954010269
511 2954383247
512 2954684394
513 2954693957
514 2954709063
515 2954713580
516 2954723544
517 2954738287
518 2954742449
519 2954757148
520 2954761417
521 8004022994
522 8004027203

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00892

EamA

EamA-like transporter family

160

295

0.93

PF00892

EamA

EamA-like transporter family

18

152

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
5y79-assembly1.cif.gz_B crystal structure of the triose-phosphate/phosphate translocator in complex with 3-phosphoglycerate 0.8326 4 275
5y79-assembly1.cif.gz_B crystal structure of the triose-phosphate/phosphate translocator in complex with 3-phosphoglycerate 0.7904 4 275
7b0k-assembly1.cif.gz_A membrane protein structure 0.7727 8 270
7b0k-assembly1.cif.gz_A membrane protein structure 0.7646 8 270
5i20-assembly2.cif.gz_B crystal structure of protein 0.7552 6 274
ID Description Score Start End Superfamily
af_A0A0P0WMA8_96_409_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.7881 11 269 1.20.1740.10
af_Q8RY83_36_351_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.764 7 278 1.20.1740.10
af_Q20583_6_327_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.7579 7 272 1.20.1740.10
af_Q8RY83_36_351_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.7261 7 278 1.20.1740.10
af_A0A0P0WMA8_96_409_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.7167 11 269 1.20.1740.10
ID Description Score Start End GO Terms
AF-A0A359IU38-F1-model_v4 deleted 0.9544 12 278
AF-A0A060JF70-F1-model_v4 EamA-like transporter family 0.935 1 270 GO:0005886
AF-A0A7T7MA17-F1-model_v4 DMT family transporter 0.9315 7 278 GO:0005886
AF-A0A7V2JD70-F1-model_v4 DMT family transporter 0.9289 5 269 GO:0005886
AF-A0A1Q7FGC0-F1-model_v4 EamA domain-containing protein 0.9266 7 278 GO:0005886

Map