F370736

General Info

Members Datasets Scaffolds Average Seq Length
261 161 522 256

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2945956166|2945956608
Length 283
Sequence LPYFSAPGPGPGPHPGPAAGPGLGGPGSARPVAMAHRGFSLAGLENSLAAFRAAVELGYSHLETDVHTTSDGELLLFHDSTLDRVTDGHGNIHELTAAEVRRARIGGTEPVPTFDELVAAFPDARLNLDVKDWHSVPSVVAAIERHQVHDRVLIASFSDRRRRAVLQQLSRRTASSAGTRANALFLVLGPLLSVRALASPVRAVLRWALRDVDALQVPVRYRAVPVVTPGFVRRAHELGLYVHVWTINDPAEMHRLLDLGVDGIVSDRADLLKEVLQARGQWG

Samples

Sample ID Description Type Environment
1 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
2 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
11 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
12 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
13 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
14 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
15 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
16 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
17 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
18 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
19 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
20 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
21 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
22 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
23 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
24 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
25 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
26 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
27 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
28 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
29 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
30 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
31 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
32 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
33 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
43 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
45 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
46 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
47 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
48 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
49 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
50 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
51 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
52 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
53 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
54 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
55 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
56 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
57 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
58 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
59 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
60 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
61 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
62 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
63 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
64 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
65 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
66 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
67 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
68 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
69 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
70 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
71 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
72 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
73 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
74 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
75 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
76 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
77 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
78 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
79 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
80 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
81 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
82 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
83 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
84 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
85 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
86 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
87 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
88 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
89 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
90 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
91 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
92 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
93 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
94 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
95 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
96 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
97 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
98 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
99 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
100 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
101 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
102 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
103 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
104 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
105 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
106 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
107 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
108 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
109 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
110 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
111 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
112 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
113 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
114 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
115 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
116 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
117 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
118 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
119 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
120 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
121 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
122 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
127 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
129 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
130 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
131 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
133 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
134 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
135 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
136 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
137 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
138 2945956166 Arthrobacter globiformus W2I3 Isolate Rhizosphere
139 2537561592 Arthrobacter crystallopoietes BAB-32 Isolate Rhizosphere
140 2775506735 Arthrobacter sp. S95 1704 Isolate Unclassified
141 2808606357 Arthrobacter sp. SLBN-122 Isolate Unclassified
142 2808606360 Arthrobacter sp. SLBN-112 Isolate Unclassified
143 2808606366 Arthrobacter sp. SLBN-83 Isolate Unclassified
144 2808606370 Arthrobacter sp. SLBN-100 Isolate Unclassified
145 2808606371 Arthrobacter sp. SLBN-53 Isolate Unclassified
146 2808606700 Arthrobacter agilis UMCV2 Isolate Rhizosphere
147 2811994871 Arthrobacter sp. SLBN-179 Isolate Unclassified
148 2844849076 Arthrobacter cupressi DSM 24664 Isolate Rhizosphere
149 2905926851 Arthrobacter sedimenti MIC A30 Isolate Rhizosphere
150 2919051321 Sinomonas atrocyanea 1003 Isolate Rhizosphere
151 2919391150 Arthrobacter ipis 2973 Isolate Unclassified
152 2939598168 Arthrobacter sp. 754 Isolate Rhizosphere
153 2945916053 Arthrobacter ulcerisalmonis W1I2 Isolate Rhizosphere
154 2945920336 Pseudarthrobacter siccitolerans W1I3 Isolate Rhizosphere
155 2945941187 Arthrobacter pascens W1I14 Isolate Rhizosphere
156 2946003308 Arthrobacter agilis W3I6 Isolate Rhizosphere
157 2946037020 Arthrobacter sp. W4I7 Isolate Rhizosphere
158 2946059875 Arthrobacter sp. SLBN-112 Isolate Rhizosphere
159 2953998280 Pseudarthrobacter sp. W1I19 Isolate Rhizosphere
160 2974302888 Pseudarthrobacter sp. SORGH_AS 212 Isolate Unclassified
161 8054107350 Arthrobacter rhizosphaerae CCNWLXL 1-35 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.42
Metatranscriptomes 0.38
Isolates 9.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.36
Nodule 0
Rhizoplane 6.51
Rhizosphere 82.38
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1000221 3300000549 Bacteria 10408
2 LJQas_1007206 3300000549 Bacteria 1369
3 JGI25152J39213_1000271 3300002773 Bacteria 34638
4 rootH1_10058396 3300003316 Bacteria 2949
5 rootH2_10148353 3300003320 Bacteria 3885
6 rootL2_10097237 3300003322 Bacteria 3245
7 Ga0065714_10074811 3300005288 Bacteria 2988
8 Ga0065714_10215337 3300005288 Bacteria 855
9 Ga0070676_10210041 3300005328 Bacteria 1280
10 Ga0070670_100057494 3300005331 Bacteria 3339
11 Ga0070670_100282088 3300005331 Bacteria 1450
12 Ga0070677_10001901 3300005333 Bacteria 6603
13 Ga0070665_100043170 3300005548 Bacteria 4532
14 Ga0081455_10033281 3300005937 Bacteria 4634
15 Ga0075363_100000714 3300006048 Bacteria 11275
16 Ga0075364_10002389 3300006051 Bacteria 10528
17 Ga0075432_10000889 3300006058 Bacteria 9403
18 Ga0075367_10200781 3300006178 Bacteria 1246
19 Ga0075370_10001456 3300006353 Bacteria 10278
20 Ga0105251_10040859 3300009011 Bacteria 2260
21 Ga0105244_10032497 3300009036 Bacteria 2762
22 Ga0105244_10035233 3300009036 Bacteria 2630
23 Ga0105245_10014811 3300009098 Bacteria 6793
24 Ga0105243_10003444 3300009148 Bacteria 12802
25 Ga0105242_10200756 3300009176 Bacteria 1771
26 Ga0105248_10064013 3300009177 Bacteria 4128
27 Ga0105249_10741144 3300009553 Bacteria 1044
28 Ga0105246_10002200 3300011119 Bacteria 11766
29 Ga0105246_10013868 3300011119 Bacteria 5058
30 Ga0105246_10203958 3300011119 Bacteria 1539
31 Ga0105246_10494991 3300011119 Bacteria 1037
32 Ga0157373_10016976 3300013100 Bacteria 5303
33 Ga0157369_10034955 3300013105 Bacteria 5511
34 Ga0157375_10364072 3300013308 Bacteria 1612
35 Ga0157375_10439277 3300013308 Bacteria 1471
36 Ga0157380_10795402 3300014326 Bacteria 962
37 Ga0209148_1003023 3300025254 Bacteria 5014
38 Ga0209148_1018168 3300025254 Bacteria 1184
39 Ga0209129_1000052 3300025258 Bacteria 265251
40 Ga0209025_1000570 3300025294 Bacteria 67028
41 Ga0209051_1015930 3300025303 Bacteria 3435
42 Ga0207697_10001607 3300025315 Bacteria 12205
43 Ga0207655_1014342 3300025728 Bacteria 4484
44 Ga0207655_1082334 3300025728 Bacteria 1157
45 Ga0207682_10001534 3300025893 Bacteria 10615
46 Ga0207645_10005922 3300025907 Bacteria 8810
47 Ga0207659_10248980 3300025926 Bacteria 1441
48 Ga0207709_10039006 3300025935 Bacteria 2834
49 Ga0207691_10016391 3300025940 Bacteria 7035
50 Ga0207711_10055220 3300025941 Bacteria 3410
51 Ga0207683_10015111 3300026121 Bacteria 6569
52 Ga0207428_10063028 3300027907 Bacteria 2930
53 Ga0268266_10235245 3300028379 Bacteria 1689
54 Ga0307408_100011424 3300031548 Bacteria 5868
55 Ga0307408_100030200 3300031548 Bacteria 3762
56 Ga0307408_100058780 3300031548 Bacteria 2796
57 Ga0307408_100078696 3300031548 Bacteria 2458
58 Ga0307408_100446887 3300031548 Bacteria 1120
59 Ga0307405_10000458 3300031731 Bacteria 15367
60 Ga0307405_10030271 3300031731 Bacteria 3173
61 Ga0307405_10042681 3300031731 Bacteria 2762
62 Ga0307405_10047418 3300031731 Bacteria 2645
63 Ga0307405_10062748 3300031731 Bacteria 2354
64 Ga0307405_10097694 3300031731 Bacteria 1961
65 Ga0307413_10000873 3300031824 Bacteria 10661
66 Ga0307413_10045488 3300031824 Bacteria 2603
67 Ga0307413_10087284 3300031824 Bacteria 2020
68 Ga0307413_10108811 3300031824 Bacteria 1851
69 Ga0307410_10000390 3300031852 Bacteria 17305
70 Ga0307410_10018257 3300031852 Bacteria 4235
71 Ga0307410_10217256 3300031852 Bacteria 1468
72 Ga0307410_10228845 3300031852 Bacteria 1434
73 Ga0307406_10220353 3300031901 Bacteria 1410
74 Ga0307406_10227186 3300031901 Bacteria 1391
75 Ga0307406_10256343 3300031901 Bacteria 1321
76 Ga0307407_10003689 3300031903 Bacteria 6342
77 Ga0307407_10021446 3300031903 Bacteria 3331
78 Ga0307407_10180285 3300031903 Bacteria 1399
79 Ga0307407_10234943 3300031903 Bacteria 1247
80 Ga0307407_10260596 3300031903 Bacteria 1192
81 Ga0307412_10011174 3300031911 Bacteria 5195
82 Ga0307412_10011915 3300031911 Bacteria 5049
83 Ga0307412_10030103 3300031911 Bacteria 3413
84 Ga0307412_10066827 3300031911 Bacteria 2438
85 Ga0307412_10066834 3300031911 Bacteria 2438
86 Ga0307412_10212363 3300031911 Bacteria 1477
87 Ga0307412_10251861 3300031911 Bacteria 1371
88 Ga0307412_10312568 3300031911 Bacteria 1246
89 Ga0307409_100000425 3300031995 Bacteria 17952
90 Ga0307409_100011565 3300031995 Bacteria 5575
91 Ga0307409_100110016 3300031995 Bacteria 2308
92 Ga0307409_100153933 3300031995 Bacteria 2000
93 Ga0307409_100186858 3300031995 Bacteria 1840
94 Ga0307416_100001032 3300032002 Bacteria 14789
95 Ga0307416_100004549 3300032002 Bacteria 8379
96 Ga0307416_100091089 3300032002 Bacteria 2617
97 Ga0307416_100094633 3300032002 Bacteria 2577
98 Ga0307416_100126961 3300032002 Bacteria 2286
99 Ga0307416_100153949 3300032002 Bacteria 2113
100 Ga0307416_100316410 3300032002 Bacteria 1560
101 Ga0307416_100435880 3300032002 Bacteria 1359
102 Ga0307416_100957502 3300032002 Bacteria 958
103 Ga0307414_10040728 3300032004 Bacteria 3140
104 Ga0307411_10029371 3300032005 Bacteria 3356
105 Ga0307411_10546447 3300032005 Bacteria 987
106 Ga0307415_100018689 3300032126 Bacteria 4192
107 Ga0316584_0103628 3300036712 Bacteria 2130
108 Ga0395899_0014781 3300037312 Bacteria 5958
109 Ga0395899_0016172 3300037312 Bacteria 5686
110 Ga0395899_0103604 3300037312 Bacteria 2052
111 Ga0395900_0040327 3300037418 Bacteria 4812
112 Ga0395900_0049052 3300037418 Bacteria 4349
113 Ga0395900_0085404 3300037418 Bacteria 3243
114 Ga0395900_0105821 3300037418 Bacteria 2890
115 Ga0395898_0002950 3300037466 Bacteria 19342
116 Ga0395898_0010092 3300037466 Bacteria 9884
117 Ga0395898_0059361 3300037466 Bacteria 3721
118 Ga0395898_0101649 3300037466 Bacteria 2760
119 Ga0395898_0202385 3300037466 Bacteria 1895
120 Ga0395905_0043744 3300037471 Bacteria 4201
121 Ga0395901_0027441 3300038443 Bacteria 5850
122 Ga0395901_0030963 3300038443 Bacteria 5515
123 Ga0395901_0063304 3300038443 Bacteria 3849
124 Ga0395901_0133640 3300038443 Bacteria 2607
125 Ga0395901_0173865 3300038443 Bacteria 2259
126 Ga0395901_0174178 3300038443 Bacteria 2257
127 Ga0395901_0298608 3300038443 Bacteria 1670
128 Ga0439436_0001112 3300041404 Bacteria 7596
129 Ga0439436_0006747 3300041404 Bacteria 3527
130 Ga0439438_003101 3300041405 Bacteria 6836
131 Ga0439438_010500 3300041405 Bacteria 2926
132 Ga0439439_0000739 3300041406 Bacteria 5874
133 Ga0439447_034577 3300041407 Bacteria 1256
134 Ga0439461_0025429 3300041410 Bacteria 1202
135 Ga0439466_0076761 3300041411 Bacteria 1057
136 Ga0439433_0000125 3300041999 Bacteria 11194
137 Ga0439433_0000266 3300041999 Bacteria 8844
138 Ga0439433_0015217 3300041999 Bacteria 1698
139 Ga0439442_000061 3300042002 Bacteria 25736
140 Ga0439442_002513 3300042002 Bacteria 3600
141 Ga0439442_010930 3300042002 Bacteria 1844
142 Ga0439432_001313 3300042006 Bacteria 9413
143 Ga0439449_0001186 3300042007 Bacteria 10223
144 Ga0439449_0001773 3300042007 Bacteria 8481
145 Ga0439449_0034284 3300042007 Bacteria 1890
146 Ga0439449_0147793 3300042007 Bacteria 876
147 Ga0439452_002200 3300042010 Bacteria 7346
148 Ga0439457_002695 3300042014 Bacteria 5002
149 Ga0439457_021729 3300042014 Bacteria 1422
150 Ga0439462_0013655 3300042015 Bacteria 2083
151 Ga0450919_006453 3300042121 Bacteria 1387
152 Ga0450920_000066 3300042122 Bacteria 13378
153 Ga0450920_020364 3300042122 Bacteria 1278
154 Ga0450906_024661 3300042145 Bacteria 1069
155 Ga0450907_000159 3300042146 Bacteria 25260
156 Ga0450908_013196 3300042184 Bacteria 1491
157 Ga0450909_002507 3300042185 Bacteria 2601
158 Ga0439434_0001775 3300042435 Bacteria 6272
159 Ga0439434_0003537 3300042435 Bacteria 4564
160 Ga0450918_001620 3300042531 Bacteria 4426
161 Ga0466972_0198863 3300044658 Bacteria 939
162 Ga0466961_0080259 3300044693 Bacteria 2065
163 Ga0466959_0142630 3300045049 Bacteria 1692
164 Ga0495629_0037734 3300046459 Bacteria 3405
165 Ga0495629_0071159 3300046459 Bacteria 2427
166 Ga0495651_0303592 3300046462 Bacteria 1070
167 Ga0495653_0007125 3300046463 Bacteria 9163
168 Ga0495582_0013528 3300046473 Bacteria 4494
169 Ga0495639_0004207 3300046475 Bacteria 6175
170 Ga0495662_0008174 3300046476 Bacteria 5157
171 Ga0495664_0031452 3300046477 Bacteria 3111
172 Ga0495594_0325005 3300046499 Bacteria 876
173 Ga0495631_0208918 3300046518 Bacteria 834
174 Ga0495665_0002303 3300046531 Bacteria 10322
175 Ga0495586_0006787 3300046535 Bacteria 6107
176 Ga0495586_0009322 3300046535 Bacteria 5221
177 Ga0495586_0060386 3300046535 Bacteria 2061
178 Ga0495587_0002009 3300046536 Bacteria 13568
179 Ga0495645_0001673 3300046543 Bacteria 15053
180 Ga0495667_0003241 3300046559 Bacteria 10908
181 Ga0495656_0021572 3300046615 Bacteria 2509
182 Ga0495588_0001463 3300046674 Bacteria 10138
183 Ga0495588_0007729 3300046674 Bacteria 4910
184 Ga0495588_0014529 3300046674 Bacteria 3770
185 Ga0495670_0010620 3300046691 Bacteria 4524
186 Ga0495670_0025756 3300046691 Bacteria 2910
187 Ga0495600_0005638 3300046809 Bacteria 7561
188 Ga0495600_0036583 3300046809 Bacteria 3191
189 Ga0495581_0003408 3300047315 Bacteria 9133
190 Ga0495581_0024083 3300047315 Bacteria 3527
191 Ga0495636_0015334 3300047318 Bacteria 3054
192 Ga0495675_0008279 3300047444 Bacteria 6434
193 Ga0495684_0044457 3300047471 Bacteria 3401
194 Ga0495593_0026242 3300047673 Bacteria 3219
195 Ga0496101_0185068 3300048904 Bacteria 1605
196 Ga0496102_0071070 3300048905 Bacteria 3195
197 Ga0496102_0173261 3300048905 Bacteria 2031
198 Ga0496102_0197190 3300048905 Bacteria 1897
199 Ga0496102_0233768 3300048905 Bacteria 1733
200 Ga0496103_0082949 3300048906 Bacteria 2018
201 Ga0496103_0095407 3300048906 Bacteria 1879
202 Ga0496104_0046890 3300048907 Bacteria 4071
203 Ga0496107_0135492 3300048910 Bacteria 1819
204 Ga0496108_0141720 3300048911 Bacteria 2071
205 Ga0496109_0007228 3300048912 Bacteria 9389
206 Ga0496110_0003162 3300048913 Bacteria 12530
207 Ga0496111_0002657 3300048914 Bacteria 10840
208 Ga0496112_0107188 3300048915 Bacteria 2764
209 Ga0496112_0204069 3300048915 Bacteria 1935
210 Ga0496112_0583488 3300048915 Bacteria 1050
211 Ga0496113_0305458 3300048916 Bacteria 1274
212 Ga0496125_0108741 3300048928 Bacteria 2016
213 Ga0496126_0002448 3300048929 Bacteria 25056
214 Ga0496126_0060747 3300048929 Bacteria 3398
215 Ga0501032_0001189 3300049569 Bacteria 20858
216 Ga0501033_0261121 3300049570 Bacteria 1226
217 Ga0501037_0021821 3300049573 Bacteria 4738
218 Ga0501038_0046835 3300049574 Bacteria 3747
219 Ga0501038_0063403 3300049574 Bacteria 3154
220 Ga0501038_0087017 3300049574 Bacteria 2624
221 Ga0501038_0267605 3300049574 Bacteria 1348
222 Ga0501038_0278361 3300049574 Bacteria 1318
223 Ga0501039_0000778 3300049575 Bacteria 22919
224 Ga0501039_0001447 3300049575 Bacteria 17463
225 Ga0501039_0193722 3300049575 Bacteria 1598
226 Ga0501043_0006949 3300049579 Bacteria 9019
227 Ga0501043_0149564 3300049579 Bacteria 1827
228 Ga0501068_0278477 3300049584 Bacteria 1069
229 Ga0501070_0181545 3300049586 Bacteria 1732
230 Ga0501073_0089800 3300049589 Bacteria 2136
231 Ga0501035_0136905 3300049822 Bacteria 2132
232 Ga0501044_0432095 3300049823 Bacteria 1226
233 nmdc:mga03n38_272_c1 3300050490 Bacteria 12265
234 nmdc:mga00v17_1358_c1 3300050491 Bacteria 12808
235 nmdc:mga0yw44_116911_c1 3300050492 Bacteria 1714
236 nmdc:mga06z11_98715_c1 3300050494 Bacteria 1598
237 Ga0587072_003102 3300059643 Bacteria 2305
238 2945956608 2945956166 Bacteria 5110334
239 2537901394 2537561592 Bacteria 4348607
240 2775656934 2775506735 Bacteria 4556596
241 2808829401 2808606357 Bacteria 4466944
242 2808850556 2808606360 Bacteria 4404006
243 2808876880 2808606366 Bacteria 4415912
244 2808893723 2808606370 Bacteria 4942454
245 2808898378 2808606371 Bacteria 4251511
246 2810362753 2808606700 Bacteria 3482157
247 2812318907 2811994871 Bacteria 4497550
248 2844850978 2844849076 Bacteria 4091819
249 2905930405 2905926851 Bacteria 4423176
250 2919053066 2919051321 Bacteria 4210889
251 2919394517 2919391150 Bacteria 4884741
252 2939601105 2939598168 Bacteria 4687164
253 2945916670 2945916053 Bacteria 4555517
254 2945923264 2945920336 Bacteria 4501603
255 2945945074 2945941187 Bacteria 4682474
256 2946006548 2946003308 Bacteria 3857229
257 2946041019 2946037020 Bacteria 4900426
258 2946060440 2946059875 Bacteria 4386623
259 2954002254 2953998280 Bacteria 4812144
260 2974304646 2974302888 Bacteria 4369871
261 8054110438 8054107350 Bacteria 5022511
262 LJQas_1000221
263 LJQas_1007206
264 JGI25152J39213_1000271
265 rootH1_10058396
266 rootH2_10148353
267 rootL2_10097237
268 Ga0065714_10074811
269 Ga0065714_10215337
270 Ga0070676_10210041
271 Ga0070670_100057494
272 Ga0070670_100282088
273 Ga0070677_10001901
274 Ga0070665_100043170
275 Ga0081455_10033281
276 Ga0075363_100000714
277 Ga0075364_10002389
278 Ga0075432_10000889
279 Ga0075367_10200781
280 Ga0075370_10001456
281 Ga0105251_10040859
282 Ga0105244_10032497
283 Ga0105244_10035233
284 Ga0105245_10014811
285 Ga0105243_10003444
286 Ga0105242_10200756
287 Ga0105248_10064013
288 Ga0105249_10741144
289 Ga0105246_10002200
290 Ga0105246_10013868
291 Ga0105246_10203958
292 Ga0105246_10494991
293 Ga0157373_10016976
294 Ga0157369_10034955
295 Ga0157375_10364072
296 Ga0157375_10439277
297 Ga0157380_10795402
298 Ga0209148_1003023
299 Ga0209148_1018168
300 Ga0209129_1000052
301 Ga0209025_1000570
302 Ga0209051_1015930
303 Ga0207697_10001607
304 Ga0207655_1014342
305 Ga0207655_1082334
306 Ga0207682_10001534
307 Ga0207645_10005922
308 Ga0207659_10248980
309 Ga0207709_10039006
310 Ga0207691_10016391
311 Ga0207711_10055220
312 Ga0207683_10015111
313 Ga0207428_10063028
314 Ga0268266_10235245
315 Ga0307408_100011424
316 Ga0307408_100030200
317 Ga0307408_100058780
318 Ga0307408_100078696
319 Ga0307408_100446887
320 Ga0307405_10000458
321 Ga0307405_10030271
322 Ga0307405_10042681
323 Ga0307405_10047418
324 Ga0307405_10062748
325 Ga0307405_10097694
326 Ga0307413_10000873
327 Ga0307413_10045488
328 Ga0307413_10087284
329 Ga0307413_10108811
330 Ga0307410_10000390
331 Ga0307410_10018257
332 Ga0307410_10217256
333 Ga0307410_10228845
334 Ga0307406_10220353
335 Ga0307406_10227186
336 Ga0307406_10256343
337 Ga0307407_10003689
338 Ga0307407_10021446
339 Ga0307407_10180285
340 Ga0307407_10234943
341 Ga0307407_10260596
342 Ga0307412_10011174
343 Ga0307412_10011915
344 Ga0307412_10030103
345 Ga0307412_10066827
346 Ga0307412_10066834
347 Ga0307412_10212363
348 Ga0307412_10251861
349 Ga0307412_10312568
350 Ga0307409_100000425
351 Ga0307409_100011565
352 Ga0307409_100110016
353 Ga0307409_100153933
354 Ga0307409_100186858
355 Ga0307416_100001032
356 Ga0307416_100004549
357 Ga0307416_100091089
358 Ga0307416_100094633
359 Ga0307416_100126961
360 Ga0307416_100153949
361 Ga0307416_100316410
362 Ga0307416_100435880
363 Ga0307416_100957502
364 Ga0307414_10040728
365 Ga0307411_10029371
366 Ga0307411_10546447
367 Ga0307415_100018689
368 Ga0316584_0103628
369 Ga0395899_0014781
370 Ga0395899_0016172
371 Ga0395899_0103604
372 Ga0395900_0040327
373 Ga0395900_0049052
374 Ga0395900_0085404
375 Ga0395900_0105821
376 Ga0395898_0002950
377 Ga0395898_0010092
378 Ga0395898_0059361
379 Ga0395898_0101649
380 Ga0395898_0202385
381 Ga0395905_0043744
382 Ga0395901_0027441
383 Ga0395901_0030963
384 Ga0395901_0063304
385 Ga0395901_0133640
386 Ga0395901_0173865
387 Ga0395901_0174178
388 Ga0395901_0298608
389 Ga0439436_0001112
390 Ga0439436_0006747
391 Ga0439438_003101
392 Ga0439438_010500
393 Ga0439439_0000739
394 Ga0439447_034577
395 Ga0439461_0025429
396 Ga0439466_0076761
397 Ga0439433_0000125
398 Ga0439433_0000266
399 Ga0439433_0015217
400 Ga0439442_000061
401 Ga0439442_002513
402 Ga0439442_010930
403 Ga0439432_001313
404 Ga0439449_0001186
405 Ga0439449_0001773
406 Ga0439449_0034284
407 Ga0439449_0147793
408 Ga0439452_002200
409 Ga0439457_002695
410 Ga0439457_021729
411 Ga0439462_0013655
412 Ga0450919_006453
413 Ga0450920_000066
414 Ga0450920_020364
415 Ga0450906_024661
416 Ga0450907_000159
417 Ga0450908_013196
418 Ga0450909_002507
419 Ga0439434_0001775
420 Ga0439434_0003537
421 Ga0450918_001620
422 Ga0466972_0198863
423 Ga0466961_0080259
424 Ga0466959_0142630
425 Ga0495629_0037734
426 Ga0495629_0071159
427 Ga0495651_0303592
428 Ga0495653_0007125
429 Ga0495582_0013528
430 Ga0495639_0004207
431 Ga0495662_0008174
432 Ga0495664_0031452
433 Ga0495594_0325005
434 Ga0495631_0208918
435 Ga0495665_0002303
436 Ga0495586_0006787
437 Ga0495586_0009322
438 Ga0495586_0060386
439 Ga0495587_0002009
440 Ga0495645_0001673
441 Ga0495667_0003241
442 Ga0495656_0021572
443 Ga0495588_0001463
444 Ga0495588_0007729
445 Ga0495588_0014529
446 Ga0495670_0010620
447 Ga0495670_0025756
448 Ga0495600_0005638
449 Ga0495600_0036583
450 Ga0495581_0003408
451 Ga0495581_0024083
452 Ga0495636_0015334
453 Ga0495675_0008279
454 Ga0495684_0044457
455 Ga0495593_0026242
456 Ga0496101_0185068
457 Ga0496102_0071070
458 Ga0496102_0173261
459 Ga0496102_0197190
460 Ga0496102_0233768
461 Ga0496103_0082949
462 Ga0496103_0095407
463 Ga0496104_0046890
464 Ga0496107_0135492
465 Ga0496108_0141720
466 Ga0496109_0007228
467 Ga0496110_0003162
468 Ga0496111_0002657
469 Ga0496112_0107188
470 Ga0496112_0204069
471 Ga0496112_0583488
472 Ga0496113_0305458
473 Ga0496125_0108741
474 Ga0496126_0002448
475 Ga0496126_0060747
476 Ga0501032_0001189
477 Ga0501033_0261121
478 Ga0501037_0021821
479 Ga0501038_0046835
480 Ga0501038_0063403
481 Ga0501038_0087017
482 Ga0501038_0267605
483 Ga0501038_0278361
484 Ga0501039_0000778
485 Ga0501039_0001447
486 Ga0501039_0193722
487 Ga0501043_0006949
488 Ga0501043_0149564
489 Ga0501068_0278477
490 Ga0501070_0181545
491 Ga0501073_0089800
492 Ga0501035_0136905
493 Ga0501044_0432095
494 nmdc:mga03n38_272_c1
495 nmdc:mga00v17_1358_c1
496 nmdc:mga0yw44_116911_c1
497 nmdc:mga06z11_98715_c1
498 Ga0587072_003102
499 2945956608
500 2537901394
501 2775656934
502 2808829401
503 2808850556
504 2808876880
505 2808893723
506 2808898378
507 2810362753
508 2812318907
509 2844850978
510 2905930405
511 2919053066
512 2919394517
513 2939601105
514 2945916670
515 2945923264
516 2945945074
517 2946006548
518 2946041019
519 2946060440
520 2954002254
521 2974304646
522 8054110438

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03009

GDPD

Glycerophosphoryl diester phosphodiesterase family

36

271

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ymq-assembly1.cif.gz_A crystal structure of lysoplasmalogen specific phopholipase d, f211l mutant 0.8837 1 242
7ymp-assembly1.cif.gz_A crystal structure of lysoplasmalogen specific phospholipase d 0.8689 1 250
7ymp-assembly1.cif.gz_A crystal structure of lysoplasmalogen specific phospholipase d 0.8655 1 250
7ymq-assembly1.cif.gz_A crystal structure of lysoplasmalogen specific phopholipase d, f211l mutant 0.8529 1 242
1zcc-assembly1.cif.gz_C crystal structure of glycerophosphodiester phosphodiesterase from agrobacterium tumefaciens str.c58 0.8335 2 239
ID Description Score Start End Superfamily
af_O07244_11_250_3.20.20.190 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphatidylinositol (PI) phosphodiesterase 0.9548 1 241 3.20.20.190
af_O07244_11_250_3.20.20.190 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphatidylinositol (PI) phosphodiesterase 0.9471 1 241 3.20.20.190
af_Q55BE9_41_333_3.20.20.190 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphatidylinositol (PI) phosphodiesterase 0.9029 1 242 3.20.20.190
af_Q55BE9_41_333_3.20.20.190 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphatidylinositol (PI) phosphodiesterase 0.8718 1 242 3.20.20.190
af_Q2FZF9_25_304_3.20.20.190 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphatidylinositol (PI) phosphodiesterase 0.8465 1 239 3.20.20.190
ID Description Score Start End GO Terms
AF-A0A7V9PEB8-F1-model_v4 Glycerophosphodiester phosphodiesterase 0.9992 174 245 GO:0006629
GO:0008081
AF-A0A0Q7KEN6-F1-model_v4 GP-PDE domain-containing protein 0.9989 176 245 GO:0006629
GO:0008081
AF-A0A1I7DTJ2-F1-model_v4 Glycerophosphoryl diester phosphodiesterase 0.9968 2 244 GO:0006629
GO:0008081
AF-A0A359F437-F1-model_v4 Glycerophosphodiester phosphodiesterase 0.9937 175 244 GO:0006629
GO:0008081
AF-A0A6B2XQW7-F1-model_v4 Glycerophosphodiester phosphodiesterase 0.9936 176 245 GO:0006629
GO:0008081

Map