F370385

General Info

Members Datasets Scaffolds Average Seq Length
261 151 520 303

Family's Representative Sequence

Representative Sequence 3300025915|Ga0207693_10022748|Ga0207693_100227482
Length 346
Sequence MTEPVNLKFTTVSSETEPDVHSPRMSSRVTRGICFCFWRAAISCLAVVFVSGLFHYAVSAATDPPRPRILGIAGVTIAAPSDTEGFYTKKLGIAGGLNECMGICLSHLDLSSFQQLEILDRKQFDGLAQKPAGSNLVQITFETSDLQALHTYLASLGIRCSEISKAGMGGANSLFWVVDPELHQIGFLQSKAPNHYVPSGSQVSANLIHAGFVVRDRTAMEHFYKDILGFRPYWHGGMKDGQTDWISLQVPDGTDWVEFMVNVPLNADKGLLGVMNHIALGVPDIHAAAKQLLTNGMTLTEEPKIGRDGKWQLNLYDPDQTRVELMEFTPVEKPCCSDYTGPHPKP

Samples

Sample ID Description Type Environment
1 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
8 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
25 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
39 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
40 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
43 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
44 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
45 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
48 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
49 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
97 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
100 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
101 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
102 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
103 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
104 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
105 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
106 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
107 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
108 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
109 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
110 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
111 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
112 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
113 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
114 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
115 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
116 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
117 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
118 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
119 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
120 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
121 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
122 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
123 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
124 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
125 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
126 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
127 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
128 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
129 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
130 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
131 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
132 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
133 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
134 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
135 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
136 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
137 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
138 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
139 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
140 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
141 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
145 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
146 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
147 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
148 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
149 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
150 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
151 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.47
Metatranscriptomes 1.53
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.38
Nodule 0
Rhizoplane 3.07
Rhizosphere 94.64
Stem 0
Stem Tuber 0
Unclassified 14.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207693_10022748 3300025915 Bacteria 4977
2 rootH1_10193666 3300003323 Bacteria 1264
3 Ga0070658_10000017 3300005327 Bacteria 223560
4 Ga0070658_10082597 3300005327 Bacteria 2640
5 Ga0068868_100038777 3300005338 Bacteria 3698
6 Ga0070660_100246348 3300005339 Bacteria 1456
7 Ga0070691_10048387 3300005341 Bacteria 2023
8 Ga0070659_100023940 3300005366 Bacteria 4677
9 Ga0070703_10002782 3300005406 Bacteria 5011
10 Ga0070709_10085372 3300005434 Bacteria 2070
11 Ga0070714_100012978 3300005435 Bacteria 6663
12 Ga0070714_100098906 3300005435 Bacteria 2567
13 Ga0070713_100006390 3300005436 Bacteria 8165
14 Ga0070711_100072324 3300005439 Bacteria 2433
15 Ga0070711_100225386 3300005439 Unclassified 1459
16 Ga0070711_100289086 3300005439 Bacteria 1300
17 Ga0070705_100011127 3300005440 Bacteria 4527
18 Ga0070705_100091749 3300005440 Bacteria 1894
19 Ga0070694_100102064 3300005444 Bacteria 2031
20 Ga0070694_100177837 3300005444 Unclassified 1572
21 Ga0070708_100012873 3300005445 Bacteria 6836
22 Ga0070708_100023803 3300005445 Bacteria 5211
23 Ga0070708_100097507 3300005445 Bacteria 2687
24 Ga0070708_100351651 3300005445 Bacteria 1389
25 Ga0070663_100034128 3300005455 Bacteria 3521
26 Ga0070663_100214397 3300005455 Unclassified 1509
27 Ga0070681_10009977 3300005458 Bacteria 9364
28 Ga0070681_10025873 3300005458 Bacteria 5899
29 Ga0070681_10111242 3300005458 Bacteria 2678
30 Ga0070706_100025742 3300005467 Bacteria 5414
31 Ga0070706_100056767 3300005467 Bacteria 3612
32 Ga0070707_100037353 3300005468 Bacteria 4635
33 Ga0070707_100129359 3300005468 Bacteria 2454
34 Ga0070698_100089819 3300005471 Bacteria 3056
35 Ga0070699_100106975 3300005518 Bacteria 2454
36 Ga0070679_100069387 3300005530 Bacteria 3516
37 Ga0070679_100128000 3300005530 Bacteria 2521
38 Ga0070679_100128829 3300005530 Bacteria 2512
39 Ga0070684_100143577 3300005535 Bacteria 2160
40 Ga0070697_100000507 3300005536 Bacteria 29432
41 Ga0070697_100007670 3300005536 Bacteria 8402
42 Ga0070697_100007738 3300005536 Bacteria 8367
43 Ga0070697_100115892 3300005536 Bacteria 2237
44 Ga0070697_100137250 3300005536 Bacteria 2054
45 Ga0070695_100003804 3300005545 Bacteria 8800
46 Ga0070695_100036512 3300005545 Unclassified 3093
47 Ga0070695_100054157 3300005545 Bacteria 2581
48 Ga0070696_100001707 3300005546 Bacteria 14397
49 Ga0070693_100005279 3300005547 Bacteria 6190
50 Ga0070693_100009117 3300005547 Bacteria 4925
51 Ga0070693_100202714 3300005547 Bacteria 1289
52 Ga0070665_100000976 3300005548 Bacteria 36221
53 Ga0070704_100000426 3300005549 Bacteria 19631
54 Ga0070704_100100276 3300005549 Bacteria 2180
55 Ga0068855_100083564 3300005563 Unclassified 3698
56 Ga0070664_100265305 3300005564 Bacteria 1545
57 Ga0068854_100048714 3300005578 Unclassified 3024
58 Ga0068859_100353047 3300005617 Bacteria 1565
59 Ga0068866_10045412 3300005718 Bacteria 2203
60 Ga0068863_100073734 3300005841 Bacteria 3229
61 Ga0068858_100069945 3300005842 Bacteria 3253
62 Ga0068860_100007064 3300005843 Bacteria 11239
63 Ga0070716_100003102 3300006173 Bacteria 7758
64 Ga0070716_100007748 3300006173 Bacteria 5301
65 Ga0070716_100343299 3300006173 Unclassified 1054
66 Ga0070712_100055598 3300006175 Bacteria 2772
67 Ga0097621_100001371 3300006237 Bacteria 16761
68 Ga0068871_100001827 3300006358 Bacteria 14366
69 Ga0075433_10096276 3300006852 Unclassified 2620
70 Ga0075433_10167355 3300006852 Bacteria 1956
71 Ga0075433_10170584 3300006852 Bacteria 1936
72 Ga0075434_100038354 3300006871 Bacteria 4745
73 Ga0075434_100045266 3300006871 Bacteria 4366
74 Ga0075434_100202240 3300006871 Bacteria 2006
75 Ga0068865_100185111 3300006881 Bacteria 1606
76 Ga0075436_100001210 3300006914 Bacteria 17530
77 Ga0075436_100002500 3300006914 Bacteria 12647
78 Ga0075436_100043167 3300006914 Bacteria 3109
79 Ga0075436_100082770 3300006914 Unclassified 2226
80 Ga0075436_100174780 3300006914 Bacteria 1516
81 Ga0097620_100353061 3300006931 Bacteria 1565
82 Ga0075435_100015387 3300007076 Bacteria 5750
83 Ga0075435_100015990 3300007076 Bacteria 5650
84 Ga0075435_100135608 3300007076 Bacteria 2062
85 Ga0075435_100260345 3300007076 Unclassified 1478
86 Ga0099794_10003596 3300007265 Bacteria 5944
87 Ga0099794_10003872 3300007265 Bacteria 5791
88 Ga0099794_10017528 3300007265 Bacteria 3194
89 Ga0099794_10058072 3300007265 Bacteria 1875
90 Ga0099794_10079314 3300007265 Bacteria 1617
91 Ga0099794_10092227 3300007265 Bacteria 1504
92 Ga0099794_10109731 3300007265 Bacteria 1382
93 Ga0099794_10111779 3300007265 Bacteria 1369
94 Ga0099794_10164818 3300007265 Unclassified 1128
95 Ga0099794_10175691 3300007265 Bacteria 1092
96 Ga0099795_10004692 3300007788 Bacteria 3555
97 Ga0105240_10102592 3300009093 Bacteria 3476
98 Ga0105240_10385764 3300009093 Bacteria 1581
99 Ga0105245_10018171 3300009098 Bacteria 6148
100 Ga0114129_10240528 3300009147 Unclassified 2434
101 Ga0105242_10042944 3300009176 Bacteria 3654
102 Ga0105242_10209065 3300009176 Bacteria 1738
103 Ga0105242_10661233 3300009176 Bacteria 1017
104 Ga0105248_10000003 3300009177 Bacteria 1019601
105 Ga0105248_10048161 3300009177 Bacteria 4781
106 Ga0105248_10115248 3300009177 Bacteria 3031
107 Ga0105248_10173326 3300009177 Bacteria 2432
108 Ga0105248_10240405 3300009177 Bacteria 2038
109 Ga0105237_10060567 3300009545 Unclassified 3786
110 Ga0105237_10094170 3300009545 Unclassified 2984
111 Ga0105237_10136727 3300009545 Bacteria 2445
112 Ga0105238_10043227 3300009551 Bacteria 4559
113 Ga0099796_10003595 3300010159 Bacteria 3623
114 Ga0099796_10031930 3300010159 Bacteria 1722
115 Ga0105239_10059867 3300010375 Bacteria 4179
116 Ga0105239_10246589 3300010375 Bacteria 2006
117 Ga0157370_10019100 3300013104 Bacteria 6890
118 Ga0157370_10029325 3300013104 Bacteria 5402
119 Ga0157370_10080492 3300013104 Bacteria 3066
120 Ga0157369_10009895 3300013105 Bacteria 10896
121 Ga0157369_10098273 3300013105 Bacteria 3122
122 Ga0157369_10144466 3300013105 Bacteria 2516
123 Ga0157369_10292346 3300013105 Bacteria 1696
124 Ga0157374_10325377 3300013296 Bacteria 1524
125 Ga0157374_10535109 3300013296 Unclassified 1178
126 Ga0157378_10000041 3300013297 Bacteria 112069
127 Ga0157378_10000697 3300013297 Bacteria 31510
128 Ga0157378_10001468 3300013297 Bacteria 21295
129 Ga0163162_10038848 3300013306 Bacteria 4752
130 Ga0157372_10123681 3300013307 Bacteria 2974
131 Ga0157372_10396784 3300013307 Bacteria 1608
132 Ga0157372_10635357 3300013307 Unclassified 1243
133 Ga0157375_10861830 3300013308 Unclassified 1052
134 Ga0163163_10007478 3300014325 Bacteria 9641
135 Ga0157379_10081328 3300014968 Bacteria 2902
136 Ga0157376_10006837 3300014969 Bacteria 8077
137 Ga0207653_10003733 3300025885 Bacteria 4789
138 Ga0207647_10027818 3300025904 Bacteria 3682
139 Ga0207699_10011348 3300025906 Bacteria 4497
140 Ga0207699_10126435 3300025906 Bacteria 1661
141 Ga0207699_10154490 3300025906 Bacteria 1522
142 Ga0207699_10250950 3300025906 Unclassified 1219
143 Ga0207705_10000020 3300025909 Bacteria 311745
144 Ga0207705_10035664 3300025909 Bacteria 3558
145 Ga0207705_10225526 3300025909 Bacteria 1424
146 Ga0207684_10048645 3300025910 Bacteria 3596
147 Ga0207684_10060827 3300025910 Bacteria 3208
148 Ga0207707_10250414 3300025912 Bacteria 1539
149 Ga0207707_10303592 3300025912 Bacteria 1380
150 Ga0207671_10061646 3300025914 Bacteria 2783
151 Ga0207671_10307977 3300025914 Bacteria 1252
152 Ga0207693_10006940 3300025915 Bacteria 9356
153 Ga0207663_10012402 3300025916 Bacteria 4608
154 Ga0207663_10057825 3300025916 Unclassified 2445
155 Ga0207663_10117400 3300025916 Bacteria 1816
156 Ga0207657_10006470 3300025919 Bacteria 12140
157 Ga0207652_10043703 3300025921 Bacteria 3815
158 Ga0207652_10310283 3300025921 Bacteria 1424
159 Ga0207646_10003888 3300025922 Bacteria 16576
160 Ga0207646_10468908 3300025922 Unclassified 1136
161 Ga0207687_10010199 3300025927 Bacteria 6139
162 Ga0207664_10085699 3300025929 Bacteria 2572
163 Ga0207686_10113117 3300025934 Bacteria 1834
164 Ga0207686_10420675 3300025934 Bacteria 1022
165 Ga0207665_10004160 3300025939 Bacteria 9627
166 Ga0207665_10141805 3300025939 Bacteria 1714
167 Ga0207665_10251391 3300025939 Unclassified 1306
168 Ga0207711_10000012 3300025941 Bacteria 515147
169 Ga0207711_10075185 3300025941 Bacteria 2939
170 Ga0207711_10085227 3300025941 Bacteria 2768
171 Ga0207711_10154817 3300025941 Bacteria 2071
172 Ga0207689_10218827 3300025942 Bacteria 1573
173 Ga0207661_10044675 3300025944 Bacteria 3503
174 Ga0207667_10114062 3300025949 Unclassified 2786
175 Ga0207640_10296925 3300025981 Bacteria 1276
176 Ga0207703_10305020 3300026035 Bacteria 1453
177 Ga0207678_10054381 3300026067 Bacteria 3448
178 Ga0207678_10059959 3300026067 Bacteria 3273
179 Ga0207702_10481175 3300026078 Bacteria 1208
180 Ga0207674_10007923 3300026116 Bacteria 12336
181 Ga0207698_10095365 3300026142 Bacteria 2449
182 Ga0209179_1009490 3300027512 Unclassified 1671
183 Ga0209588_1000769 3300027671 Bacteria 8148
184 Ga0209588_1001270 3300027671 Bacteria 6536
185 Ga0209588_1004272 3300027671 Bacteria 4022
186 Ga0209588_1033773 3300027671 Bacteria 1641
187 Ga0209588_1036725 3300027671 Bacteria 1577
188 Ga0209588_1039981 3300027671 Bacteria 1513
189 Ga0265354_1000099 3300028016 Bacteria 14928
190 Ga0268266_10000707 3300028379 Bacteria 45087
191 Ga0268264_10102830 3300028381 Bacteria 2487
192 Ga0265338_10220347 3300028800 Unclassified 1418
193 Ga0265770_1001062 3300030878 Unclassified 3811
194 Ga0265770_1001643 3300030878 Unclassified 3062
195 Ga0265765_1000535 3300030879 Bacteria 3034
196 Ga0265760_10008212 3300031090 Unclassified 2983
197 Ga0316212_1001479 3300033547 Unclassified 3204
198 Ga0373953_0020563 3300035117 Bacteria 2466
199 Ga0373954_0003286 3300035118 Bacteria 6827
200 Ga0373956_0015347 3300035119 Bacteria 3206
201 Ga0373955_0000814 3300035172 Bacteria 13339
202 Ga0373933_0000840 3300035724 Bacteria 18786
203 Ga0373937_0000506 3300036401 Bacteria 35587
204 Ga0373937_0110896 3300036401 Bacteria 2552
205 Ga0373925_0104656 3300037068 Bacteria 2180
206 Ga0436360_0495139 3300039438 Bacteria 2290
207 Ga0436363_1451988 3300039450 Bacteria 1362
208 Ga0436362_0475335 3300039453 Unclassified 1200
209 Ga0466959_0097865 3300045049 Bacteria 2102
210 Ga0466967_0157204 3300045976 Bacteria 2131
211 Ga0466967_0343961 3300045976 Unclassified 1443
212 Ga0495651_0064305 3300046462 Bacteria 2804
213 Ga0495651_0074559 3300046462 Bacteria 2574
214 Ga0495580_0002162 3300046472 Bacteria 17219
215 Ga0495580_0039003 3300046472 Bacteria 3399
216 Ga0495580_0183864 3300046472 Bacteria 1443
217 Ga0495639_0021529 3300046475 Bacteria 2823
218 Ga0495662_0011472 3300046476 Bacteria 4330
219 Ga0495594_0010451 3300046499 Bacteria 4815
220 Ga0495640_0007638 3300046533 Bacteria 8501
221 Ga0495587_0045806 3300046536 Bacteria 2598
222 Ga0495645_0002761 3300046543 Bacteria 11927
223 Ga0495635_0246329 3300046663 Bacteria 1205
224 Ga0495647_0006820 3300046681 Bacteria 3803
225 Ga0495658_0016933 3300046683 Bacteria 3757
226 Ga0495669_0147958 3300046684 Bacteria 1111
227 Ga0495624_0079499 3300046690 Bacteria 2033
228 Ga0495600_0259887 3300046809 Bacteria 1103
229 Ga0495581_0173381 3300047315 Unclassified 1261
230 Ga0495604_0120444 3300047317 Bacteria 1901
231 Ga0495676_0024961 3300047321 Bacteria 5165
232 Ga0495680_0038133 3300047322 Unclassified 3843
233 Ga0495684_0029190 3300047471 Bacteria 4234
234 Ga0495602_0006641 3300048088 Bacteria 12128
235 Ga0496102_0007278 3300048905 Bacteria 9448
236 Ga0496102_0437758 3300048905 Unclassified 1227
237 Ga0496105_0480028 3300048908 Bacteria 978
238 Ga0496106_0110124 3300048909 Bacteria 2143
239 Ga0496115_0135246 3300048918 Bacteria 2032
240 Ga0496115_0141408 3300048918 Bacteria 1985
241 Ga0496115_0226887 3300048918 Bacteria 1541
242 Ga0496115_0359944 3300048918 Bacteria 1186
243 Ga0496126_0000018 3300048929 Bacteria 581170
244 Ga0496126_0000029 3300048929 Bacteria 389370
245 Ga0501033_0130897 3300049570 Bacteria 1817
246 Ga0501037_0048545 3300049573 Bacteria 3110
247 Ga0501047_0097328 3300049581 Bacteria 2821
248 Ga0501073_0047342 3300049589 Bacteria 3022
249 Ga0501080_0219760 3300049742 Bacteria 1739
250 nmdc:mga06r32_319384_c1 3300050510 Bacteria 1538
251 nmdc:mga0n895_181705_c1 3300050512 Unclassified 2135
252 nmdc:mga0rr50_123183_c1 3300050513 Bacteria 2066
253 nmdc:mga0rr50_217856_c1 3300050513 Unclassified 1575
254 nmdc:mga0rr50_231173_c1 3300050513 Unclassified 1530
255 nmdc:mga08x19_52581_c1 3300050514 Bacteria 2620
256 nmdc:mga08x19_682_c1 3300050514 Bacteria 21769
257 nmdc:mga08x19_71325_c1 3300050514 Unclassified 2265
258 nmdc:mga08x19_788_c1 3300050514 Bacteria 20243
259 nmdc:mga0a205_115544_c1 3300050515 Bacteria 2582
260 Ga0500595_008587 3300053119 Bacteria 4168
261 Ga0207693_10022748
262 rootH1_10193666
263 Ga0070658_10000017
264 Ga0070658_10082597
265 Ga0068868_100038777
266 Ga0070660_100246348
267 Ga0070691_10048387
268 Ga0070659_100023940
269 Ga0070703_10002782
270 Ga0070709_10085372
271 Ga0070714_100012978
272 Ga0070714_100098906
273 Ga0070713_100006390
274 Ga0070711_100072324
275 Ga0070711_100225386
276 Ga0070711_100289086
277 Ga0070705_100011127
278 Ga0070705_100091749
279 Ga0070694_100102064
280 Ga0070694_100177837
281 Ga0070708_100012873
282 Ga0070708_100023803
283 Ga0070708_100097507
284 Ga0070708_100351651
285 Ga0070663_100034128
286 Ga0070663_100214397
287 Ga0070681_10009977
288 Ga0070681_10025873
289 Ga0070681_10111242
290 Ga0070706_100025742
291 Ga0070706_100056767
292 Ga0070707_100037353
293 Ga0070707_100129359
294 Ga0070698_100089819
295 Ga0070699_100106975
296 Ga0070679_100069387
297 Ga0070679_100128000
298 Ga0070679_100128829
299 Ga0070684_100143577
300 Ga0070697_100000507
301 Ga0070697_100007670
302 Ga0070697_100007738
303 Ga0070697_100115892
304 Ga0070697_100137250
305 Ga0070695_100003804
306 Ga0070695_100036512
307 Ga0070695_100054157
308 Ga0070696_100001707
309 Ga0070693_100005279
310 Ga0070693_100009117
311 Ga0070693_100202714
312 Ga0070665_100000976
313 Ga0070704_100000426
314 Ga0070704_100100276
315 Ga0068855_100083564
316 Ga0070664_100265305
317 Ga0068854_100048714
318 Ga0068859_100353047
319 Ga0068866_10045412
320 Ga0068863_100073734
321 Ga0068858_100069945
322 Ga0068860_100007064
323 Ga0070716_100003102
324 Ga0070716_100007748
325 Ga0070716_100343299
326 Ga0070712_100055598
327 Ga0097621_100001371
328 Ga0068871_100001827
329 Ga0075433_10096276
330 Ga0075433_10167355
331 Ga0075433_10170584
332 Ga0075434_100038354
333 Ga0075434_100045266
334 Ga0075434_100202240
335 Ga0068865_100185111
336 Ga0075436_100001210
337 Ga0075436_100002500
338 Ga0075436_100043167
339 Ga0075436_100082770
340 Ga0075436_100174780
341 Ga0097620_100353061
342 Ga0075435_100015387
343 Ga0075435_100015990
344 Ga0075435_100135608
345 Ga0075435_100260345
346 Ga0099794_10003596
347 Ga0099794_10003872
348 Ga0099794_10017528
349 Ga0099794_10058072
350 Ga0099794_10079314
351 Ga0099794_10092227
352 Ga0099794_10109731
353 Ga0099794_10111779
354 Ga0099794_10164818
355 Ga0099794_10175691
356 Ga0099795_10004692
357 Ga0105240_10102592
358 Ga0105240_10385764
359 Ga0105245_10018171
360 Ga0114129_10240528
361 Ga0105242_10042944
362 Ga0105242_10209065
363 Ga0105242_10661233
364 Ga0105248_10000003
365 Ga0105248_10048161
366 Ga0105248_10115248
367 Ga0105248_10173326
368 Ga0105248_10240405
369 Ga0105237_10060567
370 Ga0105237_10094170
371 Ga0105237_10136727
372 Ga0105238_10043227
373 Ga0099796_10003595
374 Ga0099796_10031930
375 Ga0105239_10059867
376 Ga0105239_10246589
377 Ga0157370_10019100
378 Ga0157370_10029325
379 Ga0157370_10080492
380 Ga0157369_10009895
381 Ga0157369_10098273
382 Ga0157369_10144466
383 Ga0157369_10292346
384 Ga0157374_10325377
385 Ga0157374_10535109
386 Ga0157378_10000041
387 Ga0157378_10000697
388 Ga0157378_10001468
389 Ga0163162_10038848
390 Ga0157372_10123681
391 Ga0157372_10396784
392 Ga0157372_10635357
393 Ga0157375_10861830
394 Ga0163163_10007478
395 Ga0157379_10081328
396 Ga0157376_10006837
397 Ga0207653_10003733
398 Ga0207647_10027818
399 Ga0207699_10011348
400 Ga0207699_10126435
401 Ga0207699_10154490
402 Ga0207699_10250950
403 Ga0207705_10000020
404 Ga0207705_10035664
405 Ga0207705_10225526
406 Ga0207684_10048645
407 Ga0207684_10060827
408 Ga0207707_10250414
409 Ga0207707_10303592
410 Ga0207671_10061646
411 Ga0207671_10307977
412 Ga0207693_10006940
413 Ga0207663_10012402
414 Ga0207663_10057825
415 Ga0207663_10117400
416 Ga0207657_10006470
417 Ga0207652_10043703
418 Ga0207652_10310283
419 Ga0207646_10003888
420 Ga0207646_10468908
421 Ga0207687_10010199
422 Ga0207664_10085699
423 Ga0207686_10113117
424 Ga0207686_10420675
425 Ga0207665_10004160
426 Ga0207665_10141805
427 Ga0207665_10251391
428 Ga0207711_10000012
429 Ga0207711_10075185
430 Ga0207711_10085227
431 Ga0207711_10154817
432 Ga0207689_10218827
433 Ga0207661_10044675
434 Ga0207667_10114062
435 Ga0207640_10296925
436 Ga0207703_10305020
437 Ga0207678_10054381
438 Ga0207678_10059959
439 Ga0207702_10481175
440 Ga0207674_10007923
441 Ga0207698_10095365
442 Ga0209179_1009490
443 Ga0209588_1000769
444 Ga0209588_1001270
445 Ga0209588_1004272
446 Ga0209588_1033773
447 Ga0209588_1036725
448 Ga0209588_1039981
449 Ga0265354_1000099
450 Ga0268266_10000707
451 Ga0268264_10102830
452 Ga0265338_10220347
453 Ga0265770_1001062
454 Ga0265770_1001643
455 Ga0265765_1000535
456 Ga0265760_10008212
457 Ga0316212_1001479
458 Ga0373953_0020563
459 Ga0373954_0003286
460 Ga0373956_0015347
461 Ga0373955_0000814
462 Ga0373933_0000840
463 Ga0373937_0000506
464 Ga0373937_0110896
465 Ga0373925_0104656
466 Ga0436360_0495139
467 Ga0436363_1451988
468 Ga0436362_0475335
469 Ga0466959_0097865
470 Ga0466967_0157204
471 Ga0466967_0343961
472 Ga0495651_0064305
473 Ga0495651_0074559
474 Ga0495580_0002162
475 Ga0495580_0039003
476 Ga0495580_0183864
477 Ga0495639_0021529
478 Ga0495662_0011472
479 Ga0495594_0010451
480 Ga0495640_0007638
481 Ga0495587_0045806
482 Ga0495645_0002761
483 Ga0495635_0246329
484 Ga0495647_0006820
485 Ga0495658_0016933
486 Ga0495669_0147958
487 Ga0495624_0079499
488 Ga0495600_0259887
489 Ga0495581_0173381
490 Ga0495604_0120444
491 Ga0495676_0024961
492 Ga0495680_0038133
493 Ga0495684_0029190
494 Ga0495602_0006641
495 Ga0496102_0007278
496 Ga0496102_0437758
497 Ga0496105_0480028
498 Ga0496106_0110124
499 Ga0496115_0135246
500 Ga0496115_0141408
501 Ga0496115_0226887
502 Ga0496115_0359944
503 Ga0496126_0000018
504 Ga0496126_0000029
505 Ga0501033_0130897
506 Ga0501037_0048545
507 Ga0501047_0097328
508 Ga0501073_0047342
509 Ga0501080_0219760
510 nmdc:mga06r32_319384_c1
511 nmdc:mga0n895_181705_c1
512 nmdc:mga0rr50_123183_c1
513 nmdc:mga0rr50_217856_c1
514 nmdc:mga0rr50_231173_c1
515 nmdc:mga08x19_52581_c1
516 nmdc:mga08x19_682_c1
517 nmdc:mga08x19_71325_c1
518 nmdc:mga08x19_788_c1
519 nmdc:mga0a205_115544_c1
520 Ga0500595_008587

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

206

325

0.94

PF13669

Glyoxalase_4

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

208

314

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
6xbs-assembly1.cif.gz_A-2 streptomyces coelicolor methylmalonyl-coa epimerase (e43q) in complex with 2-nitronate-propionyl-coa 0.756 29 137
5v0f-assembly1.cif.gz_A crystal structure of c-as lyase with mutation k105a and substrate roxarsone 0.7387 35 137
6xck-assembly3.cif.gz_A crystal structure of c-as lyase with mutation k105e 0.7356 30 137
5hcw-assembly5.cif.gz_A crystal structure of c-as lyase with mutations y100h and v102f (monoclinic form) 0.7302 30 137
5hcw-assembly6.cif.gz_C crystal structure of c-as lyase with mutations y100h and v102f (monoclinic form) 0.7302 30 136
ID Description Score Start End Superfamily
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9367 91 135 3.30.720.110
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8853 95 137 3.30.720.110
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.833 91 135 3.30.720.110
1zswA01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8087 30 137 3.10.180.10
af_P9WKQ3_98_165_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8076 91 137 3.30.720.110
ID Description Score Start End GO Terms
AF-A0A4Q0T0R2-F1-model_v4 VOC domain-containing protein 0.9746 18 303
AF-A0A1I6L2G8-F1-model_v4 Catechol 2,3-dioxygenase 0.9731 18 303 GO:0051213
AF-A0A2V9BBK0-F1-model_v4 VOC domain-containing protein 0.9582 158 298
AF-E8WWU7-F1-model_v4 Glyoxalase/bleomycin resistance protein/dioxygenase 0.9519 21 298 GO:0051213
AF-A0A2V9BBK0-F1-model_v4 VOC domain-containing protein 0.9384 158 298

Map