F370327

General Info

Members Datasets Scaffolds Average Seq Length
261 164 522 307

Family's Representative Sequence

Representative Sequence 3300011119|Ga0105246_10139334|Ga0105246_101393342
Length 341
Sequence MVKIMRLGVLIGVARRTGYIAGLSNSERGDRFMRFRLVVAASLVLVLGTTGSAAGTSLLFVGNSFLFGFGSAVRFYRANTVTDLNDEGIGGVPALFKSFTQQAGLDYDVSLETRGGVGLDFHLANKLGVIDGRAWDKVVMHGYSTLDAGNPRDPVKLIATSKQMTDILRTRNPKVELYLLATWSRADETYSAKGAWAGQPIDAMARDVRVAYDKAAATAAVKTVIPVGEAWTRAIQTGVADPNPYDGIEAGKLNLWAYDNYHASTYGYYLEALVIFGSVTGRDPRSLGDTECSAFELGLSRAQAKALQQIAFDQLAATGAATPAPLESPKTATASRCVAGR

Samples

Sample ID Description Type Environment
1 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
23 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
24 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
35 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
36 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
37 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
38 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
39 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
43 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
44 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
45 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
46 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
59 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
65 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
66 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
67 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
96 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
100 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
101 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
102 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
103 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
104 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
105 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
106 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
107 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
108 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
109 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
110 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
111 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
112 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
113 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
114 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
115 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
116 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
117 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
118 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
119 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
120 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
121 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
122 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
123 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
124 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
125 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
126 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
127 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
128 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
129 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
130 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
131 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
132 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
133 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
134 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
135 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
144 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
145 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
146 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
147 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
148 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
150 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
151 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
152 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
153 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
154 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
155 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
156 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
157 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
158 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
159 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
160 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
161 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
162 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
163 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
164 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.9
Nodule 0
Rhizoplane 4.21
Rhizosphere 88.89
Stem 0
Stem Tuber 0
Unclassified 20.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105246_10139334 3300011119 Bacteria 1822
2 Ga0065712_10006180 3300005290 Unclassified 2880
3 Ga0065712_10068596 3300005290 Bacteria 9726
4 Ga0065712_10071082 3300005290 Bacteria 5480
5 Ga0065712_10083871 3300005290 Bacteria 2800
6 Ga0065712_10099622 3300005290 Bacteria 2086
7 Ga0070658_10000328 3300005327 Bacteria 40677
8 Ga0070683_100008387 3300005329 Bacteria 8775
9 Ga0070683_100465899 3300005329 Bacteria 1206
10 Ga0070690_100208155 3300005330 Bacteria 1364
11 Ga0070670_100016272 3300005331 Bacteria 6387
12 Ga0070670_100192961 3300005331 Bacteria 1769
13 Ga0070670_100240603 3300005331 Bacteria 1576
14 Ga0070666_10074633 3300005335 Unclassified 2312
15 Ga0068868_100050259 3300005338 Unclassified 3273
16 Ga0070660_100002248 3300005339 Bacteria 13255
17 Ga0070689_100276268 3300005340 Bacteria 1392
18 Ga0070675_100194944 3300005354 Bacteria 1757
19 Ga0070673_100078205 3300005364 Bacteria 2676
20 Ga0070673_100104492 3300005364 Bacteria 2339
21 Ga0070688_100199825 3300005365 Bacteria 1398
22 Ga0070688_100219170 3300005365 Unclassified 1340
23 Ga0070688_100316676 3300005365 Unclassified 1132
24 Ga0070713_100007554 3300005436 Bacteria 7640
25 Ga0070701_10042183 3300005438 Bacteria 2328
26 Ga0070700_100010841 3300005441 Bacteria 5038
27 Ga0070694_100160322 3300005444 Bacteria 1650
28 Ga0070678_100025770 3300005456 Bacteria 3963
29 Ga0070678_100119994 3300005456 Bacteria 2072
30 Ga0070678_100277912 3300005456 Unclassified 1415
31 Ga0070662_100134511 3300005457 Bacteria 1910
32 Ga0070681_10197358 3300005458 Bacteria 1931
33 Ga0068867_100025047 3300005459 Bacteria 4279
34 Ga0070672_100135913 3300005543 Unclassified 2025
35 Ga0070672_100137915 3300005543 Bacteria 2010
36 Ga0070696_100135674 3300005546 Unclassified 1794
37 Ga0070693_100036265 3300005547 Bacteria 2740
38 Ga0070693_100062306 3300005547 Bacteria 2170
39 Ga0070665_100000623 3300005548 Bacteria 48311
40 Ga0070665_100007007 3300005548 Bacteria 11455
41 Ga0070665_100172156 3300005548 Bacteria 2166
42 Ga0070665_100205322 3300005548 Unclassified 1971
43 Ga0070704_100015716 3300005549 Bacteria 4764
44 Ga0070704_100416045 3300005549 Bacteria 1150
45 Ga0068855_100041916 3300005563 Bacteria 5425
46 Ga0070664_100116312 3300005564 Bacteria 2338
47 Ga0068859_100160973 3300005617 Bacteria 2324
48 Ga0068859_100339785 3300005617 Unclassified 1596
49 Ga0068859_100445785 3300005617 Unclassified 1391
50 Ga0068864_100011561 3300005618 Bacteria 7289
51 Ga0068864_100131543 3300005618 Unclassified 2248
52 Ga0068861_100001707 3300005719 Bacteria 14112
53 Ga0068861_100442149 3300005719 Bacteria 1163
54 Ga0068863_100044548 3300005841 Bacteria 4212
55 Ga0068863_100219931 3300005841 Unclassified 1830
56 Ga0068858_100028641 3300005842 Bacteria 5172
57 Ga0068858_100069934 3300005842 Bacteria 3253
58 Ga0068858_100111216 3300005842 Unclassified 2558
59 Ga0068862_100013427 3300005844 Bacteria 6779
60 Ga0075368_10078391 3300006042 Bacteria 1342
61 Ga0075364_10012202 3300006051 Bacteria 5249
62 Ga0075367_10001311 3300006178 Bacteria 10541
63 Ga0075367_10017752 3300006178 Unclassified 3912
64 Ga0075366_10005293 3300006195 Bacteria 6989
65 Ga0075366_10126353 3300006195 Bacteria 1542
66 Ga0075366_10145140 3300006195 Unclassified 1436
67 Ga0075366_10160572 3300006195 Bacteria 1362
68 Ga0075366_10226670 3300006195 Bacteria 1138
69 Ga0097621_100008645 3300006237 Bacteria 7347
70 Ga0097621_100009177 3300006237 Bacteria 7169
71 Ga0097621_100013006 3300006237 Bacteria 6186
72 Ga0097621_100223783 3300006237 Bacteria 1640
73 Ga0075370_10009339 3300006353 Bacteria 5088
74 Ga0068871_100009972 3300006358 Bacteria 6903
75 Ga0068871_100021786 3300006358 Bacteria 4932
76 Ga0068871_100060367 3300006358 Bacteria 3093
77 Ga0068871_100136371 3300006358 Bacteria 2084
78 Ga0075428_100004794 3300006844 Bacteria 14993
79 Ga0075428_100017683 3300006844 Bacteria 7878
80 Ga0075430_100023057 3300006846 Bacteria 5294
81 Ga0075430_100084474 3300006846 Unclassified 2659
82 Ga0075430_100097620 3300006846 Bacteria 2455
83 Ga0075431_100015059 3300006847 Bacteria 7831
84 Ga0075431_100069542 3300006847 Bacteria 3632
85 Ga0075433_10188813 3300006852 Bacteria 1833
86 Ga0075433_10379309 3300006852 Bacteria 1248
87 Ga0075429_100040169 3300006880 Bacteria 4072
88 Ga0068865_100030691 3300006881 Bacteria 3577
89 Ga0068865_100116484 3300006881 Bacteria 1979
90 Ga0068865_100131117 3300006881 Unclassified 1878
91 Ga0097620_100160970 3300006931 Bacteria 2324
92 Ga0097620_100339784 3300006931 Unclassified 1596
93 Ga0097620_100445743 3300006931 Unclassified 1391
94 Ga0105240_10281103 3300009093 Unclassified 1912
95 Ga0111539_10012793 3300009094 Bacteria 10500
96 Ga0111539_10027993 3300009094 Bacteria 6883
97 Ga0111539_10041426 3300009094 Bacteria 5537
98 Ga0111539_10571143 3300009094 Unclassified 1317
99 Ga0105245_10545870 3300009098 Bacteria 1181
100 Ga0105247_10001931 3300009101 Bacteria 14446
101 Ga0114129_10027454 3300009147 Bacteria 8058
102 Ga0114129_10342771 3300009147 Bacteria 1981
103 Ga0114129_10442493 3300009147 Bacteria 1706
104 Ga0105242_10021740 3300009176 Bacteria 5041
105 Ga0105242_10054716 3300009176 Unclassified 3262
106 Ga0105242_10425230 3300009176 Bacteria 1246
107 Ga0105248_10003322 3300009177 Bacteria 17856
108 Ga0105248_10058961 3300009177 Bacteria 4312
109 Ga0105248_10115421 3300009177 Bacteria 3028
110 Ga0105248_10252726 3300009177 Bacteria 1984
111 Ga0105248_10310654 3300009177 Bacteria 1775
112 Ga0105248_10488961 3300009177 Bacteria 1387
113 Ga0105238_10039958 3300009551 Bacteria 4755
114 Ga0105238_10264608 3300009551 Bacteria 1699
115 Ga0105249_10660624 3300009553 Bacteria 1103
116 Ga0157370_10157688 3300013104 Bacteria 2111
117 Ga0157374_10013895 3300013296 Bacteria 7035
118 Ga0163162_10065678 3300013306 Bacteria 3676
119 Ga0163162_10135304 3300013306 Bacteria 2575
120 Ga0163162_10141156 3300013306 Unclassified 2522
121 Ga0157372_10084055 3300013307 Bacteria 3606
122 Ga0157375_10049243 3300013308 Bacteria 4127
123 Ga0157375_10346881 3300013308 Bacteria 1650
124 Ga0163163_10043424 3300014325 Bacteria 4407
125 Ga0163163_10069137 3300014325 Bacteria 3515
126 Ga0163163_10098817 3300014325 Bacteria 2940
127 Ga0163163_10693837 3300014325 Unclassified 1082
128 Ga0157380_10000557 3300014326 Bacteria 22909
129 Ga0157380_10150748 3300014326 Bacteria 2010
130 Ga0157379_10011865 3300014968 Bacteria 7612
131 Ga0157379_10161062 3300014968 Unclassified 2025
132 Ga0157376_10026978 3300014969 Unclassified 4547
133 Ga0157376_10192122 3300014969 Bacteria 1873
134 Ga0157376_10467183 3300014969 Bacteria 1234
135 Ga0207697_10012429 3300025315 Bacteria 3569
136 Ga0207682_10035153 3300025893 Bacteria 2023
137 Ga0207688_10120097 3300025901 Unclassified 1533
138 Ga0207680_10288603 3300025903 Unclassified 1141
139 Ga0207645_10168666 3300025907 Bacteria 1434
140 Ga0207705_10000244 3300025909 Bacteria 53451
141 Ga0207654_10147295 3300025911 Bacteria 1508
142 Ga0207657_10013347 3300025919 Bacteria 8060
143 Ga0207650_10014734 3300025925 Bacteria 5434
144 Ga0207650_10155099 3300025925 Bacteria 1810
145 Ga0207659_10181799 3300025926 Bacteria 1666
146 Ga0207687_10066555 3300025927 Bacteria 2561
147 Ga0207700_10089751 3300025928 Bacteria 2424
148 Ga0207644_10063567 3300025931 Bacteria 2680
149 Ga0207706_10091722 3300025933 Bacteria 2671
150 Ga0207686_10035409 3300025934 Unclassified 2996
151 Ga0207686_10272337 3300025934 Bacteria 1246
152 Ga0207704_10151924 3300025938 Bacteria 1635
153 Ga0207704_10360334 3300025938 Unclassified 1135
154 Ga0207691_10098433 3300025940 Bacteria 2612
155 Ga0207711_10019774 3300025941 Bacteria 5611
156 Ga0207711_10176432 3300025941 Bacteria 1941
157 Ga0207711_10201581 3300025941 Bacteria 1816
158 Ga0207689_10024804 3300025942 Bacteria 5028
159 Ga0207689_10277430 3300025942 Bacteria 1388
160 Ga0207651_10100253 3300025960 Bacteria 2147
161 Ga0207651_10218648 3300025960 Bacteria 1539
162 Ga0207677_10034477 3300026023 Unclassified 3278
163 Ga0207703_10031550 3300026035 Bacteria 4191
164 Ga0207703_10050378 3300026035 Bacteria 3370
165 Ga0207703_10240144 3300026035 Unclassified 1628
166 Ga0207703_10292073 3300026035 Bacteria 1484
167 Ga0207708_10158143 3300026075 Bacteria 1788
168 Ga0207641_10366840 3300026088 Unclassified 1376
169 Ga0207648_10181793 3300026089 Bacteria 1861
170 Ga0207676_10081636 3300026095 Bacteria 2627
171 Ga0207675_100002231 3300026118 Bacteria 19254
172 Ga0207683_10146424 3300026121 Bacteria 2130
173 Ga0207683_10160599 3300026121 Bacteria 2031
174 Ga0207683_10293818 3300026121 Bacteria 1486
175 Ga0207428_10020694 3300027907 Bacteria 5582
176 Ga0268266_10009805 3300028379 Bacteria 8423
177 Ga0268266_10226023 3300028379 Unclassified 1722
178 Ga0268266_10439029 3300028379 Bacteria 1239
179 Ga0268265_10051754 3300028380 Bacteria 3101
180 Ga0268264_10058760 3300028381 Bacteria 3221
181 Ga0268264_10244262 3300028381 Unclassified 1664
182 Ga0265331_10143533 3300031250 Bacteria 1085
183 Ga0265314_10132592 3300031711 Bacteria 1552
184 Ga0373955_0147919 3300035172 Bacteria 1381
185 Ga0373924_0051058 3300035410 Bacteria 1714
186 Ga0373933_0017388 3300035724 Bacteria 4036
187 Ga0373937_0004290 3300036401 Bacteria 12083
188 Ga0395898_0032025 3300037466 Bacteria 5248
189 Ga0439464_0019853 3300042439 Unclassified 1837
190 Ga0453684_0001017 3300044712 Bacteria 90379
191 Ga0466967_0338484 3300045976 Bacteria 1454
192 Ga0495592_0024834 3300046454 Bacteria 4554
193 Ga0495603_0113950 3300046455 Bacteria 1577
194 Ga0495608_0042420 3300046511 Bacteria 3043
195 Ga0495652_0085811 3300046529 Bacteria 2586
196 Ga0495586_0017994 3300046535 Bacteria 3758
197 Ga0495587_0027399 3300046536 Bacteria 3470
198 Ga0495645_0004319 3300046543 Bacteria 9712
199 Ga0495667_0021043 3300046559 Bacteria 4400
200 Ga0495635_0031954 3300046663 Bacteria 3653
201 Ga0495657_0070708 3300046675 Unclassified 2280
202 Ga0495599_0012435 3300046678 Bacteria 5247
203 Ga0495623_0012631 3300046679 Bacteria 5466
204 Ga0495658_0019471 3300046683 Bacteria 3544
205 Ga0495649_0171027 3300046694 Bacteria 1137
206 Ga0495600_0028385 3300046809 Bacteria 3620
207 Ga0495604_0102912 3300047317 Bacteria 2096
208 Ga0495684_0295994 3300047471 Bacteria 1163
209 Ga0496102_0114739 3300048905 Bacteria 2513
210 Ga0496104_0069952 3300048907 Bacteria 3336
211 Ga0496106_0256337 3300048909 Bacteria 1399
212 Ga0496107_0191540 3300048910 Bacteria 1519
213 Ga0496108_0045043 3300048911 Bacteria 3684
214 Ga0496108_0127805 3300048911 Unclassified 2183
215 Ga0496109_0349423 3300048912 Unclassified 1397
216 Ga0496112_0003987 3300048915 Bacteria 12370
217 Ga0496113_0149436 3300048916 Bacteria 1842
218 Ga0496114_0076268 3300048917 Unclassified 2825
219 Ga0496114_0099647 3300048917 Bacteria 2478
220 Ga0501033_0091786 3300049570 Unclassified 2221
221 Ga0501034_0011144 3300049571 Bacteria 9329
222 Ga0501034_0131634 3300049571 Bacteria 2484
223 Ga0501034_0283629 3300049571 Bacteria 1595
224 Ga0501036_0218742 3300049572 Bacteria 1599
225 Ga0501037_0273806 3300049573 Unclassified 1177
226 Ga0501038_0053280 3300049574 Unclassified 3483
227 Ga0501043_0001847 3300049579 Bacteria 18150
228 Ga0501046_0193191 3300049580 Unclassified 1517
229 Ga0501047_0001470 3300049581 Bacteria 22987
230 Ga0501068_0295746 3300049584 Bacteria 1036
231 Ga0501073_0034707 3300049589 Bacteria 3588
232 Ga0501073_0375294 3300049589 Bacteria 982
233 Ga0501074_0010375 3300049590 Bacteria 6759
234 Ga0501074_0350628 3300049590 Unclassified 1047
235 Ga0501080_0009718 3300049742 Bacteria 8786
236 Ga0501080_0098185 3300049742 Unclassified 2718
237 Ga0501083_0000467 3300049744 Bacteria 25952
238 Ga0501035_0246730 3300049822 Bacteria 1517
239 Ga0501044_0078946 3300049823 Bacteria 3335
240 nmdc:mga00v17_51121_c1 3300050491 Bacteria 2513
241 nmdc:mga0k408_232736_c1 3300050493 Unclassified 1100
242 nmdc:mga0k408_335_c1 3300050493 Bacteria 25706
243 nmdc:mga0k408_8705_c1 3300050493 Bacteria 5458
244 nmdc:mga06z11_52474_c1 3300050494 Bacteria 2092
245 nmdc:mga04h51_21127_c1 3300050495 Bacteria 1954
246 nmdc:mga04h51_77618_c1 3300050495 Bacteria 1172
247 nmdc:mga05p37_46628_c1 3300050507 Bacteria 5329
248 nmdc:mga09592_11598_c1 3300050508 Bacteria 7167
249 nmdc:mga0qj67_9284_c1 3300050509 Bacteria 7314
250 nmdc:mga06r32_654_c1 3300050510 Bacteria 30275
251 nmdc:mga08y16_11089_c1 3300050511 Bacteria 9463
252 nmdc:mga08y16_450108_c1 3300050511 Unclassified 1313
253 nmdc:mga08y16_9219_c1 3300050511 Bacteria 10355
254 nmdc:mga0a205_517070_c1 3300050515 Unclassified 1050
255 nmdc:mga0a205_85210_c1 3300050515 Unclassified 3052
256 Ga0495601_0038058 3300053077 Bacteria 3007
257 Ga0495595_0037366 3300053084 Unclassified 2207
258 Ga0495595_0057280 3300053084 Bacteria 1818
259 Ga0500646_0004149 3300053090 Unclassified 3678
260 Ga0501084_0012814 3300054114 Bacteria 6946
261 Ga0501082_0089292 3300060353 Bacteria 2661
262 Ga0105246_10139334
263 Ga0065712_10006180
264 Ga0065712_10068596
265 Ga0065712_10071082
266 Ga0065712_10083871
267 Ga0065712_10099622
268 Ga0070658_10000328
269 Ga0070683_100008387
270 Ga0070683_100465899
271 Ga0070690_100208155
272 Ga0070670_100016272
273 Ga0070670_100192961
274 Ga0070670_100240603
275 Ga0070666_10074633
276 Ga0068868_100050259
277 Ga0070660_100002248
278 Ga0070689_100276268
279 Ga0070675_100194944
280 Ga0070673_100078205
281 Ga0070673_100104492
282 Ga0070688_100199825
283 Ga0070688_100219170
284 Ga0070688_100316676
285 Ga0070713_100007554
286 Ga0070701_10042183
287 Ga0070700_100010841
288 Ga0070694_100160322
289 Ga0070678_100025770
290 Ga0070678_100119994
291 Ga0070678_100277912
292 Ga0070662_100134511
293 Ga0070681_10197358
294 Ga0068867_100025047
295 Ga0070672_100135913
296 Ga0070672_100137915
297 Ga0070696_100135674
298 Ga0070693_100036265
299 Ga0070693_100062306
300 Ga0070665_100000623
301 Ga0070665_100007007
302 Ga0070665_100172156
303 Ga0070665_100205322
304 Ga0070704_100015716
305 Ga0070704_100416045
306 Ga0068855_100041916
307 Ga0070664_100116312
308 Ga0068859_100160973
309 Ga0068859_100339785
310 Ga0068859_100445785
311 Ga0068864_100011561
312 Ga0068864_100131543
313 Ga0068861_100001707
314 Ga0068861_100442149
315 Ga0068863_100044548
316 Ga0068863_100219931
317 Ga0068858_100028641
318 Ga0068858_100069934
319 Ga0068858_100111216
320 Ga0068862_100013427
321 Ga0075368_10078391
322 Ga0075364_10012202
323 Ga0075367_10001311
324 Ga0075367_10017752
325 Ga0075366_10005293
326 Ga0075366_10126353
327 Ga0075366_10145140
328 Ga0075366_10160572
329 Ga0075366_10226670
330 Ga0097621_100008645
331 Ga0097621_100009177
332 Ga0097621_100013006
333 Ga0097621_100223783
334 Ga0075370_10009339
335 Ga0068871_100009972
336 Ga0068871_100021786
337 Ga0068871_100060367
338 Ga0068871_100136371
339 Ga0075428_100004794
340 Ga0075428_100017683
341 Ga0075430_100023057
342 Ga0075430_100084474
343 Ga0075430_100097620
344 Ga0075431_100015059
345 Ga0075431_100069542
346 Ga0075433_10188813
347 Ga0075433_10379309
348 Ga0075429_100040169
349 Ga0068865_100030691
350 Ga0068865_100116484
351 Ga0068865_100131117
352 Ga0097620_100160970
353 Ga0097620_100339784
354 Ga0097620_100445743
355 Ga0105240_10281103
356 Ga0111539_10012793
357 Ga0111539_10027993
358 Ga0111539_10041426
359 Ga0111539_10571143
360 Ga0105245_10545870
361 Ga0105247_10001931
362 Ga0114129_10027454
363 Ga0114129_10342771
364 Ga0114129_10442493
365 Ga0105242_10021740
366 Ga0105242_10054716
367 Ga0105242_10425230
368 Ga0105248_10003322
369 Ga0105248_10058961
370 Ga0105248_10115421
371 Ga0105248_10252726
372 Ga0105248_10310654
373 Ga0105248_10488961
374 Ga0105238_10039958
375 Ga0105238_10264608
376 Ga0105249_10660624
377 Ga0157370_10157688
378 Ga0157374_10013895
379 Ga0163162_10065678
380 Ga0163162_10135304
381 Ga0163162_10141156
382 Ga0157372_10084055
383 Ga0157375_10049243
384 Ga0157375_10346881
385 Ga0163163_10043424
386 Ga0163163_10069137
387 Ga0163163_10098817
388 Ga0163163_10693837
389 Ga0157380_10000557
390 Ga0157380_10150748
391 Ga0157379_10011865
392 Ga0157379_10161062
393 Ga0157376_10026978
394 Ga0157376_10192122
395 Ga0157376_10467183
396 Ga0207697_10012429
397 Ga0207682_10035153
398 Ga0207688_10120097
399 Ga0207680_10288603
400 Ga0207645_10168666
401 Ga0207705_10000244
402 Ga0207654_10147295
403 Ga0207657_10013347
404 Ga0207650_10014734
405 Ga0207650_10155099
406 Ga0207659_10181799
407 Ga0207687_10066555
408 Ga0207700_10089751
409 Ga0207644_10063567
410 Ga0207706_10091722
411 Ga0207686_10035409
412 Ga0207686_10272337
413 Ga0207704_10151924
414 Ga0207704_10360334
415 Ga0207691_10098433
416 Ga0207711_10019774
417 Ga0207711_10176432
418 Ga0207711_10201581
419 Ga0207689_10024804
420 Ga0207689_10277430
421 Ga0207651_10100253
422 Ga0207651_10218648
423 Ga0207677_10034477
424 Ga0207703_10031550
425 Ga0207703_10050378
426 Ga0207703_10240144
427 Ga0207703_10292073
428 Ga0207708_10158143
429 Ga0207641_10366840
430 Ga0207648_10181793
431 Ga0207676_10081636
432 Ga0207675_100002231
433 Ga0207683_10146424
434 Ga0207683_10160599
435 Ga0207683_10293818
436 Ga0207428_10020694
437 Ga0268266_10009805
438 Ga0268266_10226023
439 Ga0268266_10439029
440 Ga0268265_10051754
441 Ga0268264_10058760
442 Ga0268264_10244262
443 Ga0265331_10143533
444 Ga0265314_10132592
445 Ga0373955_0147919
446 Ga0373924_0051058
447 Ga0373933_0017388
448 Ga0373937_0004290
449 Ga0395898_0032025
450 Ga0439464_0019853
451 Ga0453684_0001017
452 Ga0466967_0338484
453 Ga0495592_0024834
454 Ga0495603_0113950
455 Ga0495608_0042420
456 Ga0495652_0085811
457 Ga0495586_0017994
458 Ga0495587_0027399
459 Ga0495645_0004319
460 Ga0495667_0021043
461 Ga0495635_0031954
462 Ga0495657_0070708
463 Ga0495599_0012435
464 Ga0495623_0012631
465 Ga0495658_0019471
466 Ga0495649_0171027
467 Ga0495600_0028385
468 Ga0495604_0102912
469 Ga0495684_0295994
470 Ga0496102_0114739
471 Ga0496104_0069952
472 Ga0496106_0256337
473 Ga0496107_0191540
474 Ga0496108_0045043
475 Ga0496108_0127805
476 Ga0496109_0349423
477 Ga0496112_0003987
478 Ga0496113_0149436
479 Ga0496114_0076268
480 Ga0496114_0099647
481 Ga0501033_0091786
482 Ga0501034_0011144
483 Ga0501034_0131634
484 Ga0501034_0283629
485 Ga0501036_0218742
486 Ga0501037_0273806
487 Ga0501038_0053280
488 Ga0501043_0001847
489 Ga0501046_0193191
490 Ga0501047_0001470
491 Ga0501068_0295746
492 Ga0501073_0034707
493 Ga0501073_0375294
494 Ga0501074_0010375
495 Ga0501074_0350628
496 Ga0501080_0009718
497 Ga0501080_0098185
498 Ga0501083_0000467
499 Ga0501035_0246730
500 Ga0501044_0078946
501 nmdc:mga00v17_51121_c1
502 nmdc:mga0k408_232736_c1
503 nmdc:mga0k408_335_c1
504 nmdc:mga0k408_8705_c1
505 nmdc:mga06z11_52474_c1
506 nmdc:mga04h51_21127_c1
507 nmdc:mga04h51_77618_c1
508 nmdc:mga05p37_46628_c1
509 nmdc:mga09592_11598_c1
510 nmdc:mga0qj67_9284_c1
511 nmdc:mga06r32_654_c1
512 nmdc:mga08y16_11089_c1
513 nmdc:mga08y16_450108_c1
514 nmdc:mga08y16_9219_c1
515 nmdc:mga0a205_517070_c1
516 nmdc:mga0a205_85210_c1
517 Ga0495601_0038058
518 Ga0495595_0037366
519 Ga0495595_0057280
520 Ga0500646_0004149
521 Ga0501084_0012814
522 Ga0501082_0089292

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6m9g-assembly1.cif.gz_B-2 bbvci b2 dimer with ta6br14 clusters 0.7963 123 150
4s1p-assembly1.cif.gz_A shel_16390 protein, a putative sgnh hydrolase from slackia heliotrinireducens 0.796 21 247
4s1p-assembly1.cif.gz_A shel_16390 protein, a putative sgnh hydrolase from slackia heliotrinireducens 0.7881 21 247
1u8u-assembly1.cif.gz_A e. coli thioesterase i/protease i/lysophospholiase l1 in complexed with octanoic acid 0.7286 23 247
7e16-assembly2.cif.gz_B crystal structure of gdsl esterase from geobacillus thermodenitrificans 0.7282 22 248
ID Description Score Start End Superfamily
4s1pA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;SGNH hydrolase 0.7836 24 244 3.40.50.1110
4s1pA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;SGNH hydrolase 0.7634 24 244 3.40.50.1110
4rw0B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;SGNH hydrolase 0.7571 23 250 3.40.50.1110
4rw0B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;SGNH hydrolase 0.7499 23 250 3.40.50.1110
4jggB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;SGNH hydrolase 0.7169 24 247 3.40.50.1110
ID Description Score Start End GO Terms
AF-A0A3N5NZN3-F1-model_v4 PEP-CTERM sorting domain-containing protein 0.9965 97 199
AF-A0A2A2QV60-F1-model_v4 PEP-CTERM sorting domain-containing protein 0.9959 24 286
AF-A0A4V1SCV2-F1-model_v4 PEP-CTERM sorting domain-containing protein 0.9952 195 285 GO:0052689
AF-A0A285QYP7-F1-model_v4 PEP-CTERM protein-sorting domain-containing protein 0.9933 22 285 GO:0052689
AF-A0A0N0GN73-F1-model_v4 CBM56 domain-containing protein 0.9852 20 287 GO:0030246
GO:0052689

Map