F370255

General Info

Members Datasets Scaffolds Average Seq Length
261 151 260 219

Family's Representative Sequence

Representative Sequence 3300006358|Ga0068871_100171321|Ga0068871_1001713212
Length 242
Sequence VRLHGQREWRAVDSFQVFRVHMTESSDPHQERVLDAARQLGLMLSNADVDQLLAYLALLQRWNGTYNLTAVRDPERMLVQHLFDCLAVIAPLRRHLGIARSRRVLDVGSGGGLPGVVIAALNPDIDVTCVDTVGKKAAFIQQVATSLRLRNLHSEHARVESLKAPPFNVVTSRAFASLADFATLTRSHLSADGVWLAMKGKDPVDERAALRTDVEVFHVEQLHVPSLDAERCLIWMRPRPSL

Samples

Sample ID Description Type Environment
1 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
7 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
8 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
9 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
10 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
11 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
12 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
16 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
17 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
18 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
19 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
20 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
21 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
22 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
23 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
24 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
25 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
26 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
27 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
28 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
29 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
30 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
32 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
33 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
34 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
35 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
36 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
37 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
38 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
39 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
40 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
41 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
42 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
43 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
44 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
45 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
46 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
47 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
48 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
49 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
50 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
68 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
69 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
70 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
71 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
74 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
75 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
76 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
77 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
78 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
79 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
80 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
81 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
82 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
83 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
84 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
85 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
86 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
87 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
88 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
89 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
90 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
91 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
92 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
93 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
94 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
95 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
96 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
97 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
98 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
99 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
100 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
101 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
102 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
103 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
104 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
105 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
106 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
107 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
108 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
109 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
110 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
111 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
112 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
113 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
114 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
115 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
116 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
117 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
121 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
122 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
123 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
124 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
125 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
126 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
128 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
129 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
130 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
131 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
132 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
133 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
134 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
135 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
136 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
137 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
138 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
139 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
140 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
141 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
142 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
143 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
144 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
145 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
146 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
147 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
148 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
149 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
150 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
151 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.62
Metatranscriptomes 0
Isolates 0.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 31.8
Nodule 0
Rhizoplane 1.15
Rhizosphere 52.11
Stem 0
Stem Tuber 0
Unclassified 14.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10000413 3300003215 Bacteria 28090
2 rootL2_10141319 3300003322 Bacteria 1483
3 Ga0070670_100032375 3300005331 Bacteria 4503
4 Ga0068869_100984544 3300005334 Unclassified 733
5 Ga0070671_100007932 3300005355 Bacteria 8491
6 Ga0070671_100276720 3300005355 Bacteria 1427
7 Ga0070659_100367756 3300005366 Bacteria 1209
8 Ga0070667_100208567 3300005367 Bacteria 1736
9 Ga0070667_100832035 3300005367 Bacteria 858
10 Ga0070678_100131800 3300005456 Bacteria 1987
11 Ga0070678_100137070 3300005456 Bacteria 1953
12 Ga0070662_100123877 3300005457 Bacteria 1984
13 Ga0068867_100035982 3300005459 Bacteria 3592
14 Ga0068867_100058743 3300005459 Bacteria 2850
15 Ga0070706_100001745 3300005467 Bacteria 22564
16 Ga0070707_100014555 3300005468 Bacteria 7375
17 Ga0070698_100181568 3300005471 Bacteria 2042
18 Ga0070699_100280942 3300005518 Bacteria 1491
19 Ga0068853_100115572 3300005539 Bacteria 2388
20 Ga0068853_100183210 3300005539 Bacteria 1900
21 Ga0070672_100047751 3300005543 Bacteria 3323
22 Ga0070672_100225190 3300005543 Bacteria 1574
23 Ga0070664_100224368 3300005564 Bacteria 1682
24 Ga0068857_100055623 3300005577 Bacteria 3511
25 Ga0068857_100632436 3300005577 Bacteria 1013
26 Ga0068864_100231221 3300005618 Bacteria 1710
27 Ga0068870_10255291 3300005840 Bacteria 1088
28 Ga0075365_10038084 3300006038 Bacteria 3123
29 Ga0075365_10264265 3300006038 Bacteria 1210
30 Ga0075368_10003414 3300006042 Bacteria 5301
31 Ga0075368_10015624 3300006042 Bacteria 2820
32 Ga0075368_10064482 3300006042 Bacteria 1471
33 Ga0075368_10093343 3300006042 Bacteria 1232
34 Ga0075363_100357726 3300006048 Bacteria 853
35 Ga0075364_10003457 3300006051 Bacteria 8986
36 Ga0075364_10081064 3300006051 Bacteria 2146
37 Ga0075362_10003277 3300006177 Bacteria 5625
38 Ga0075362_10024364 3300006177 Bacteria 2567
39 Ga0075362_10059155 3300006177 Bacteria 1730
40 Ga0075362_10153250 3300006177 Bacteria 1107
41 Ga0075367_10009407 3300006178 Bacteria 5107
42 Ga0075367_10065682 3300006178 Bacteria 2173
43 Ga0075367_10131851 3300006178 Bacteria 1545
44 Ga0075369_10001280 3300006186 Bacteria 8548
45 Ga0075366_10000870 3300006195 Bacteria 14567
46 Ga0075366_10007677 3300006195 Bacteria 5972
47 Ga0075366_10057725 3300006195 Bacteria 2306
48 Ga0075366_10097287 3300006195 Bacteria 1765
49 Ga0075366_10108584 3300006195 Bacteria 1668
50 Ga0075366_10170467 3300006195 Bacteria 1320
51 Ga0075366_10218710 3300006195 Bacteria 1160
52 Ga0075366_10219074 3300006195 Bacteria 1159
53 Ga0075366_10338038 3300006195 Bacteria 923
54 Ga0097621_100047925 3300006237 Bacteria 3464
55 Ga0097621_100196359 3300006237 Bacteria 1750
56 Ga0075370_10000638 3300006353 Bacteria 13583
57 Ga0075370_10025884 3300006353 Bacteria 3247
58 Ga0075370_10030341 3300006353 Bacteria 3016
59 Ga0075370_10037141 3300006353 Bacteria 2738
60 Ga0075370_10077912 3300006353 Bacteria 1902
61 Ga0075370_10274471 3300006353 Bacteria 1001
62 Ga0075370_10443880 3300006353 Bacteria 780
63 Ga0068871_100074244 3300006358 Bacteria 2805
64 Ga0068871_100171321 3300006358 Bacteria 1861
65 Ga0105240_10008342 3300009093 Bacteria 14825
66 Ga0105245_10848964 3300009098 Bacteria 953
67 Ga0105243_10402296 3300009148 Bacteria 1272
68 Ga0105242_10118457 3300009176 Bacteria 2268
69 Ga0105248_10018665 3300009177 Bacteria 7667
70 Ga0105237_10000080 3300009545 Bacteria 127788
71 Ga0105237_10014391 3300009545 Bacteria 8274
72 Ga0105237_10445303 3300009545 Bacteria 1301
73 Ga0105238_10001604 3300009551 Bacteria 22652
74 Ga0105249_10043102 3300009553 Bacteria 4105
75 Ga0105032_103439 3300009979 Bacteria 1375
76 Ga0105028_100958 3300009993 Bacteria 3036
77 Ga0105239_10000116 3300010375 Bacteria 112811
78 Ga0105239_10073788 3300010375 Bacteria 3751
79 Ga0157374_10935106 3300013296 Unclassified 885
80 Ga0163162_10603553 3300013306 Bacteria 1224
81 Ga0157375_10608419 3300013308 Bacteria 1251
82 Ga0163163_10471505 3300014325 Bacteria 1316
83 Ga0209129_1020996 3300025258 Bacteria 1205
84 Ga0209758_1000177 3300025297 Bacteria 142824
85 Ga0207684_10015729 3300025910 Bacteria 6510
86 Ga0207695_10015295 3300025913 Bacteria 9041
87 Ga0207671_10016004 3300025914 Bacteria 5846
88 Ga0207671_10281691 3300025914 Bacteria 1311
89 Ga0207694_10003888 3300025924 Bacteria 11807
90 Ga0207650_10122951 3300025925 Bacteria 2023
91 Ga0207644_10008405 3300025931 Bacteria 6756
92 Ga0207644_10198158 3300025931 Bacteria 1583
93 Ga0207706_10125589 3300025933 Bacteria 2256
94 Ga0207686_10253146 3300025934 Bacteria 1288
95 Ga0207709_10323501 3300025935 Bacteria 1155
96 Ga0207691_10067660 3300025940 Bacteria 3229
97 Ga0207691_10231887 3300025940 Bacteria 1598
98 Ga0207711_10008067 3300025941 Bacteria 8813
99 Ga0207679_10148711 3300025945 Bacteria 1903
100 Ga0207658_10172926 3300025986 Bacteria 1781
101 Ga0207648_10008024 3300026089 Bacteria 10288
102 Ga0207648_10113055 3300026089 Bacteria 2384
103 Ga0207676_10123293 3300026095 Bacteria 2189
104 Ga0207674_10022548 3300026116 Bacteria 6760
105 Ga0207674_10619993 3300026116 Bacteria 1045
106 Ga0207683_10085824 3300026121 Bacteria 2798
107 Ga0207683_10163722 3300026121 Bacteria 2012
108 Ga0207683_10175243 3300026121 Bacteria 1943
109 Ga0209981_1010169 3300027378 Bacteria 1289
110 Ga0209968_1000116 3300027526 Bacteria 14650
111 Ga0209966_1000030 3300027695 Bacteria 63782
112 Ga0209813_10148346 3300027866 Bacteria 838
113 Ga0268266_10059610 3300028379 Bacteria 3289
114 Ga0268264_10318322 3300028381 Bacteria 1470
115 Ga0307517_10001027 3300028786 Bacteria 47444
116 Ga0307517_10037756 3300028786 Bacteria 5380
117 Ga0307517_10067507 3300028786 Bacteria 3272
118 Ga0307515_10000374 3300028794 Bacteria 109304
119 Ga0307515_10000585 3300028794 Bacteria 85580
120 Ga0307515_10004409 3300028794 Bacteria 29143
121 Ga0307515_10016241 3300028794 Bacteria 13644
122 Ga0307515_10148259 3300028794 Bacteria 2470
123 Ga0307512_10031826 3300030522 Bacteria 4563
124 Ga0307512_10107815 3300030522 Bacteria 1851
125 Ga0265331_10010996 3300031250 Bacteria 4968
126 Ga0265327_10000027 3300031251 Bacteria 364541
127 Ga0307513_10024103 3300031456 Bacteria 7087
128 Ga0307513_10179625 3300031456 Bacteria 1981
129 Ga0307509_10000993 3300031507 Bacteria 48743
130 Ga0307509_10010193 3300031507 Bacteria 11559
131 Ga0307509_10032069 3300031507 Bacteria 5793
132 Ga0307509_10036403 3300031507 Bacteria 5388
133 Ga0307509_10067390 3300031507 Bacteria 3750
134 Ga0307509_10072621 3300031507 Bacteria 3584
135 Ga0307509_10156904 3300031507 Bacteria 2180
136 Ga0307508_10000539 3300031616 Bacteria 44995
137 Ga0307508_10000940 3300031616 Bacteria 33950
138 Ga0307508_10002735 3300031616 Bacteria 18411
139 Ga0307508_10039477 3300031616 Bacteria 4241
140 Ga0307508_10075552 3300031616 Bacteria 2946
141 Ga0307508_10307023 3300031616 Bacteria 1179
142 Ga0307514_10012754 3300031649 Bacteria 6984
143 Ga0307516_10003030 3300031730 Bacteria 21913
144 Ga0307516_10052821 3300031730 Bacteria 3977
145 Ga0307516_10071089 3300031730 Bacteria 3341
146 Ga0307416_100343172 3300032002 Bacteria 1507
147 Ga0307507_10082348 3300033179 Bacteria 2822
148 Ga0307510_10000129 3300033180 Bacteria 60839
149 Ga0307510_10009594 3300033180 Bacteria 11535
150 Ga0307510_10210656 3300033180 Bacteria 1466
151 Ga0307510_10215658 3300033180 Bacteria 1436
152 Ga0395905_0005567 3300037471 Bacteria 12841
153 Ga0395905_0009377 3300037471 Bacteria 9572
154 Ga0395905_0116253 3300037471 Bacteria 2514
155 Ga0436365_1927715 3300039437 Bacteria 2706
156 Ga0439436_0098021 3300041404 Bacteria 817
157 Ga0451793_0978980 3300041452 Unclassified 783
158 Ga0451797_1262244 3300041453 Bacteria 1035
159 Ga0451800_0023691 3300041459 Bacteria 938
160 Ga0439449_0027889 3300042007 Bacteria 2106
161 Ga0439449_0089332 3300042007 Bacteria 1138
162 Ga0450894_018816 3300042131 Bacteria 925
163 Ga0450898_010941 3300042134 Bacteria 1478
164 Ga0450899_005180 3300042135 Bacteria 1400
165 Ga0451577_0000941 3300042876 Bacteria 42690
166 Ga0451577_0061567 3300042876 Bacteria 3347
167 Ga0451577_0180054 3300042876 Bacteria 1905
168 Ga0451577_0425765 3300042876 Bacteria 1205
169 Ga0451576_0005107 3300045051 Bacteria 16636
170 Ga0495592_0004068 3300046454 Bacteria 10635
171 Ga0495590_0002793 3300046457 Bacteria 7211
172 Ga0495590_0123238 3300046457 Bacteria 929
173 Ga0495620_0032782 3300046515 Bacteria 2364
174 Ga0495632_0002259 3300046519 Bacteria 14843
175 Ga0495632_0007218 3300046519 Bacteria 7014
176 Ga0495632_0070113 3300046519 Bacteria 1686
177 Ga0495643_0052401 3300046522 Bacteria 2191
178 Ga0495597_0024462 3300046542 Bacteria 2787
179 Ga0495597_0096132 3300046542 Bacteria 1253
180 Ga0495622_0054688 3300046557 Bacteria 1852
181 Ga0495611_0211664 3300046648 Bacteria 903
182 Ga0495625_0001689 3300046660 Bacteria 25725
183 Ga0495625_0032575 3300046660 Bacteria 3862
184 Ga0495625_0119354 3300046660 Bacteria 1796
185 Ga0495625_0390466 3300046660 Bacteria 871
186 Ga0495646_0166741 3300046680 Bacteria 1216
187 Ga0495658_0020190 3300046683 Bacteria 3492
188 Ga0495649_0006852 3300046694 Bacteria 7052
189 Ga0495660_0003887 3300046810 Bacteria 9132
190 Ga0495660_0021332 3300046810 Bacteria 3710
191 Ga0495687_001215 3300047443 Bacteria 24645
192 Ga0495687_011559 3300047443 Bacteria 4735
193 Ga0495687_013474 3300047443 Bacteria 4264
194 Ga0495614_0203635 3300048089 Bacteria 896
195 Ga0495626_0052693 3300048091 Bacteria 1875
196 Ga0496124_0002551 3300048927 Bacteria 23634
197 Ga0496125_0014840 3300048928 Bacteria 7566
198 Ga0496125_0241453 3300048928 Bacteria 1147
199 Ga0501292_035203 3300049515 Bacteria 852
200 Ga0501032_0008771 3300049569 Bacteria 7365
201 Ga0501032_0190242 3300049569 Bacteria 1341
202 Ga0501034_0454967 3300049571 Bacteria 1197
203 Ga0501047_0269191 3300049581 Bacteria 1550
204 Ga0501068_0103295 3300049584 Bacteria 1767
205 Ga0501068_0427256 3300049584 Bacteria 856
206 Ga0501069_0032573 3300049585 Bacteria 2869
207 Ga0501070_0174979 3300049586 Bacteria 1767
208 Ga0501072_0143984 3300049588 Bacteria 1900
209 Ga0501073_0325856 3300049589 Bacteria 1060
210 Ga0501080_0427523 3300049742 Bacteria 1189
211 Ga0501035_0387029 3300049822 Bacteria 1166
212 Ga0501044_0027439 3300049823 Bacteria 6018
213 Ga0501044_0443560 3300049823 Bacteria 1205
214 nmdc:mga03683_15687_c2 3300050489 Bacteria 1458
215 nmdc:mga03683_29006_c1 3300050489 Bacteria 2204
216 nmdc:mga03683_8587_c1 3300050489 Bacteria 3597
217 nmdc:mga00v17_46816_c1 3300050491 Bacteria 2618
218 nmdc:mga0k408_112660_c1 3300050493 Bacteria 1609
219 nmdc:mga0k408_218252_c1 3300050493 Bacteria 1139
220 nmdc:mga0k408_223_c2 3300050493 Bacteria 25073
221 nmdc:mga0k408_37365_c1 3300050493 Bacteria 2788
222 nmdc:mga0k408_4000_c1 3300050493 Bacteria 7817
223 nmdc:mga0k408_60797_c1 3300050493 Bacteria 2196
224 nmdc:mga0k408_8921_c1 3300050493 Bacteria 5396
225 nmdc:mga0k408_939_c1 3300050493 Bacteria 15986
226 nmdc:mga0k408_98482_c1 3300050493 Bacteria 1723
227 nmdc:mga06z11_2971_c1 3300050494 Bacteria 6533
228 nmdc:mga06z11_341806_c1 3300050494 Bacteria 895
229 nmdc:mga04h51_124934_c1 3300050495 Bacteria 962
230 nmdc:mga04h51_43643_c1 3300050495 Bacteria 1475
231 nmdc:mga07m45_107687_c1 3300050496 Bacteria 1604
232 nmdc:mga07m45_158942_c1 3300050496 Bacteria 1312
233 nmdc:mga07m45_183_c1 3300050496 Bacteria 24910
234 nmdc:mga07m45_211343_c1 3300050496 Bacteria 1129
235 nmdc:mga07m45_21963_c1 3300050496 Bacteria 3481
236 nmdc:mga07m45_346036_c1 3300050496 Bacteria 864
237 nmdc:mga07m45_60109_c1 3300050496 Bacteria 2151
238 nmdc:mga07m45_79479_c1 3300050496 Bacteria 1872
239 nmdc:mga07m45_84950_c2 3300050496 Bacteria 1117
240 nmdc:mga0sz30_43484_c1 3300050516 Bacteria 1891
241 Ga0500643_036437 3300053087 Bacteria 1469
242 Ga0500644_0001115 3300053088 Bacteria 7912
243 Ga0500651_0103952 3300053093 Bacteria 1739
244 Ga0500650_0048627 3300053098 Bacteria 1967
245 Ga0500650_0055941 3300053098 Bacteria 1838
246 Ga0500650_0060671 3300053098 Bacteria 1766
247 Ga0500562_005469 3300053108 Bacteria 3188
248 Ga0500614_025978 3300053123 Bacteria 1396
249 Ga0500658_0024122 3300053134 Bacteria 2328
250 Ga0500559_0000047 3300053136 Bacteria 95447
251 Ga0500564_054300 3300053138 Bacteria 1828
252 Ga0500568_0017830 3300053139 Bacteria 3123
253 Ga0500568_0054032 3300053139 Bacteria 1572
254 Ga0500577_0207226 3300053142 Bacteria 847
255 Ga0500604_0041220 3300053151 Bacteria 1395
256 Ga0500622_0001747 3300053156 Bacteria 16748
257 Ga0500627_0122826 3300053158 Bacteria 1172
258 Ga0500599_006418 3300053736 Bacteria 1498
259 Ga0500587_000834 3300053739 Bacteria 4046
260 Ga0590071_002337 3300059421 Bacteria 4792

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041452 Ga0451793_0978980 Ga0451793_0978980_199_753 184
2 3300041453 Ga0451797_1262244 Ga0451797_1262244_343_903 186
3 3300049584 Ga0501068_0427256 Ga0501068_0427256_150_779 191
4 3300049585 Ga0501069_0032573 Ga0501069_0032573_2184_2825 191
5 3300049742 Ga0501080_0427523 Ga0501080_0427523_433_1062 191
6 3300005539 Ga0068853_100183210 Ga0068853_1001832102 193
7 3300042876 Ga0451577_0180054 Ga0451577_0180054_573_1163 195
8 3300049569 Ga0501032_0190242 Ga0501032_0190242_86_718 195
9 3300049571 Ga0501034_0454967 Ga0501034_0454967_550_1182 195
10 3300049581 Ga0501047_0269191 Ga0501047_0269191_200_829 195
11 3300049584 Ga0501068_0103295 Ga0501068_0103295_184_816 195
12 3300049586 Ga0501070_0174979 Ga0501070_0174979_688_1317 195
13 3300049589 Ga0501073_0325856 Ga0501073_0325856_420_1049 195
14 3300049822 Ga0501035_0387029 Ga0501035_0387029_16_648 195
15 3300049823 Ga0501044_0027439 Ga0501044_0027439_1429_2058 195
16 3300049823 Ga0501044_0443560 Ga0501044_0443560_558_1190 195
17 3300045051 Ga0451576_0005107 Ga0451576_0005107_15104_15697 196
18 3300050493 nmdc:mga0k408_223_c2 nmdc:mga0k408_223_c2_15211_15834 206
19 3300006195 Ga0075366_10338038 Ga0075366_103380382 207
20 3300026121 Ga0207683_10175243 Ga0207683_101752433 207
21 3300042007 Ga0439449_0089332 Ga0439449_0089332_49_690 207
22 3300050493 nmdc:mga0k408_98482_c1 nmdc:mga0k408_98482_c1_823_1455 207
23 3300005367 Ga0070667_100208567 Ga0070667_1002085672 208
24 3300009979 Ga0105032_103439 Ga0105032_1034391 208
25 3300009993 Ga0105028_100958 Ga0105028_1009585 208
26 3300025986 Ga0207658_10172926 Ga0207658_101729262 208
27 3300031250 Ga0265331_10010996 Ga0265331_100109962 208
28 3300031251 Ga0265327_10000027 Ga0265327_1000002781 208
29 3300049569 Ga0501032_0008771 Ga0501032_0008771_3967_4608 208
30 3300009553 Ga0105249_10043102 Ga0105249_100431022 209
31 3300046557 Ga0495622_0054688 Ga0495622_0054688_130_762 209
32 3300046648 Ga0495611_0211664 Ga0495611_0211664_255_884 209
33 3300046683 Ga0495658_0020190 Ga0495658_0020190_257_889 209
34 3300048089 Ga0495614_0203635 Ga0495614_0203635_159_791 209
35 3300050493 nmdc:mga0k408_4000_c1 nmdc:mga0k408_4000_c1_363_1007 209
36 3300050496 nmdc:mga07m45_21963_c1 nmdc:mga07m45_21963_c1_1738_2382 209
37 3300048927 Ga0496124_0002551 Ga0496124_0002551_18217_18870 210
38 3300048928 Ga0496125_0014840 Ga0496125_0014840_3202_3855 210
39 3300049588 Ga0501072_0143984 Ga0501072_0143984_226_882 210
40 3300005331 Ga0070670_100032375 Ga0070670_1000323753 213
41 3300005355 Ga0070671_100007932 Ga0070671_1000079324 213
42 3300005456 Ga0070678_100131800 Ga0070678_1001318001 213
43 3300005543 Ga0070672_100047751 Ga0070672_1000477514 213
44 3300006237 Ga0097621_100047925 Ga0097621_1000479253 213
45 3300006358 Ga0068871_100074244 Ga0068871_1000742443 213
46 3300009098 Ga0105245_10848964 Ga0105245_108489642 213
47 3300009177 Ga0105248_10018665 Ga0105248_100186654 213
48 3300013306 Ga0163162_10603553 Ga0163162_106035532 213
49 3300013308 Ga0157375_10608419 Ga0157375_106084192 213
50 3300025925 Ga0207650_10122951 Ga0207650_101229512 213
51 3300025931 Ga0207644_10008405 Ga0207644_100084052 213
52 3300025940 Ga0207691_10067660 Ga0207691_100676604 213
53 3300025941 Ga0207711_10008067 Ga0207711_100080675 213
54 3300026095 Ga0207676_10123293 Ga0207676_101232932 213
55 3300026121 Ga0207683_10085824 Ga0207683_100858242 213
56 3300031730 Ga0307516_10071089 Ga0307516_100710894 213
57 iso_pu_bacteria 2585428062 2587756746 213
58 3300005366 Ga0070659_100367756 Ga0070659_1003677562 214
59 3300005456 Ga0070678_100137070 Ga0070678_1001370702 214
60 3300005459 Ga0068867_100058743 Ga0068867_1000587433 214
61 3300005539 Ga0068853_100115572 Ga0068853_1001155724 214
62 3300005564 Ga0070664_100224368 Ga0070664_1002243681 214
63 3300005577 Ga0068857_100632436 Ga0068857_1006324362 214
64 3300006177 Ga0075362_10024364 Ga0075362_100243642 214
65 3300006195 Ga0075366_10000870 Ga0075366_100008706 214
66 3300006195 Ga0075366_10108584 Ga0075366_101085842 214
67 3300006353 Ga0075370_10030341 Ga0075370_100303412 214
68 3300006353 Ga0075370_10274471 Ga0075370_102744711 214
69 3300009093 Ga0105240_10008342 Ga0105240_1000834210 214
70 3300009148 Ga0105243_10402296 Ga0105243_104022962 214
71 3300009176 Ga0105242_10118457 Ga0105242_101184572 214
72 3300009545 Ga0105237_10000080 Ga0105237_1000008091 214
73 3300009551 Ga0105238_10001604 Ga0105238_1000160412 214
74 3300010375 Ga0105239_10000116 Ga0105239_1000011616 214
75 3300014325 Ga0163163_10471505 Ga0163163_104715052 214
76 3300025913 Ga0207695_10015295 Ga0207695_100152956 214
77 3300025924 Ga0207694_10003888 Ga0207694_1000388812 214
78 3300025933 Ga0207706_10125589 Ga0207706_101255892 214
79 3300025934 Ga0207686_10253146 Ga0207686_102531462 214
80 3300025935 Ga0207709_10323501 Ga0207709_103235012 214
81 3300025945 Ga0207679_10148711 Ga0207679_101487112 214
82 3300026089 Ga0207648_10008024 Ga0207648_100080247 214
83 3300026116 Ga0207674_10619993 Ga0207674_106199931 214
84 3300026121 Ga0207683_10163722 Ga0207683_101637222 214
85 3300037471 Ga0395905_0005567 Ga0395905_0005567_6960_7625 214
86 3300037471 Ga0395905_0116253 Ga0395905_0116253_906_1574 214
87 3300039437 Ga0436365_1927715 Ga0436365_1927715_956_1636 214
88 3300046457 Ga0495590_0002793 Ga0495590_0002793_2546_3217 214
89 3300046810 Ga0495660_0021332 Ga0495660_0021332_1851_2522 214
90 3300050489 nmdc:mga03683_29006_c1 nmdc:mga03683_29006_c1_736_1398 214
91 3300050496 nmdc:mga07m45_79479_c1 nmdc:mga07m45_79479_c1_21_743 214
92 3300050496 nmdc:mga07m45_84950_c2 nmdc:mga07m45_84950_c2_387_1049 214
93 3300005334 Ga0068869_100984544 Ga0068869_1009845441 215
94 3300005355 Ga0070671_100276720 Ga0070671_1002767201 215
95 3300005543 Ga0070672_100225190 Ga0070672_1002251902 215
96 3300013296 Ga0157374_10935106 Ga0157374_109351061 215
97 3300025931 Ga0207644_10198158 Ga0207644_101981581 215
98 3300025940 Ga0207691_10231887 Ga0207691_102318872 215
99 3300037471 Ga0395905_0009377 Ga0395905_0009377_4734_5399 215
100 3300041404 Ga0439436_0098021 Ga0439436_0098021_16_678 215
101 3300042007 Ga0439449_0027889 Ga0439449_0027889_694_1356 215
102 3300042131 Ga0450894_018816 Ga0450894_018816_194_865 215
103 3300042134 Ga0450898_010941 Ga0450898_010941_307_978 215
104 3300042135 Ga0450899_005180 Ga0450899_005180_448_1119 215
105 3300042876 Ga0451577_0000941 Ga0451577_0000941_20349_21011 215
106 3300003322 rootL2_10141319 rootL2_101413192 216
107 3300005467 Ga0070706_100001745 Ga0070706_10000174513 216
108 3300005468 Ga0070707_100014555 Ga0070707_1000145552 216
109 3300005471 Ga0070698_100181568 Ga0070698_1001815682 216
110 3300005518 Ga0070699_100280942 Ga0070699_1002809422 216
111 3300006178 Ga0075367_10065682 Ga0075367_100656822 216
112 3300006195 Ga0075366_10057725 Ga0075366_100577252 216
113 3300006353 Ga0075370_10025884 Ga0075370_100258842 216
114 3300025910 Ga0207684_10015729 Ga0207684_100157292 216
115 3300028794 Ga0307515_10000585 Ga0307515_1000058546 216
116 3300031649 Ga0307514_10012754 Ga0307514_100127544 216
117 3300032002 Ga0307416_100343172 Ga0307416_1003431722 216
118 3300033179 Ga0307507_10082348 Ga0307507_100823482 216
119 3300049515 Ga0501292_035203 Ga0501292_035203_136_786 216
120 3300050495 nmdc:mga04h51_43643_c1 nmdc:mga04h51_43643_c1_624_1307 216
121 3300003215 JGI25153J46596_10000413 JGI25153J46596_100004139 217
122 3300005367 Ga0070667_100832035 Ga0070667_1008320351 217
123 3300005457 Ga0070662_100123877 Ga0070662_1001238772 217
124 3300005459 Ga0068867_100035982 Ga0068867_1000359823 217
125 3300005577 Ga0068857_100055623 Ga0068857_1000556232 217
126 3300005618 Ga0068864_100231221 Ga0068864_1002312212 217
127 3300005840 Ga0068870_10255291 Ga0068870_102552912 217
128 3300006038 Ga0075365_10038084 Ga0075365_100380842 217
129 3300006038 Ga0075365_10264265 Ga0075365_102642652 217
130 3300006042 Ga0075368_10003414 Ga0075368_100034142 217
131 3300006042 Ga0075368_10015624 Ga0075368_100156244 217
132 3300006042 Ga0075368_10064482 Ga0075368_100644822 217
133 3300006042 Ga0075368_10093343 Ga0075368_100933432 217
134 3300006048 Ga0075363_100357726 Ga0075363_1003577262 217
135 3300006051 Ga0075364_10003457 Ga0075364_100034576 217
136 3300006051 Ga0075364_10081064 Ga0075364_100810641 217
137 3300006177 Ga0075362_10003277 Ga0075362_100032772 217
138 3300006177 Ga0075362_10059155 Ga0075362_100591551 217
139 3300006177 Ga0075362_10153250 Ga0075362_101532501 217
140 3300006178 Ga0075367_10009407 Ga0075367_100094073 217
141 3300006178 Ga0075367_10131851 Ga0075367_101318512 217
142 3300006186 Ga0075369_10001280 Ga0075369_100012805 217
143 3300006195 Ga0075366_10007677 Ga0075366_100076772 217
144 3300006195 Ga0075366_10097287 Ga0075366_100972872 217
145 3300006195 Ga0075366_10170467 Ga0075366_101704672 217
146 3300006195 Ga0075366_10218710 Ga0075366_102187102 217
147 3300006195 Ga0075366_10219074 Ga0075366_102190742 217
148 3300006237 Ga0097621_100196359 Ga0097621_1001963591 217
149 3300006353 Ga0075370_10000638 Ga0075370_1000063810 217
150 3300006353 Ga0075370_10037141 Ga0075370_100371412 217
151 3300006353 Ga0075370_10077912 Ga0075370_100779122 217
152 3300006353 Ga0075370_10443880 Ga0075370_104438801 217
153 3300006358 Ga0068871_100171321 Ga0068871_1001713212 217
154 3300009545 Ga0105237_10014391 Ga0105237_100143914 217
155 3300009545 Ga0105237_10445303 Ga0105237_104453032 217
156 3300010375 Ga0105239_10073788 Ga0105239_100737882 217
157 3300025258 Ga0209129_1020996 Ga0209129_10209962 217
158 3300025297 Ga0209758_1000177 Ga0209758_100017765 217
159 3300025914 Ga0207671_10016004 Ga0207671_100160042 217
160 3300025914 Ga0207671_10281691 Ga0207671_102816912 217
161 3300026089 Ga0207648_10113055 Ga0207648_101130551 217
162 3300026116 Ga0207674_10022548 Ga0207674_100225487 217
163 3300027378 Ga0209981_1010169 Ga0209981_10101692 217
164 3300027526 Ga0209968_1000116 Ga0209968_100011610 217
165 3300027695 Ga0209966_1000030 Ga0209966_100003021 217
166 3300027866 Ga0209813_10148346 Ga0209813_101483462 217
167 3300028379 Ga0268266_10059610 Ga0268266_100596102 217
168 3300028381 Ga0268264_10318322 Ga0268264_103183222 217
169 3300028786 Ga0307517_10001027 Ga0307517_1000102720 217
170 3300028786 Ga0307517_10037756 Ga0307517_100377565 217
171 3300028786 Ga0307517_10067507 Ga0307517_100675072 217
172 3300028794 Ga0307515_10000374 Ga0307515_1000037446 217
173 3300028794 Ga0307515_10004409 Ga0307515_1000440910 217
174 3300028794 Ga0307515_10016241 Ga0307515_100162417 217
175 3300028794 Ga0307515_10148259 Ga0307515_101482592 217
176 3300030522 Ga0307512_10031826 Ga0307512_100318262 217
177 3300030522 Ga0307512_10107815 Ga0307512_101078152 217
178 3300031456 Ga0307513_10024103 Ga0307513_100241032 217
179 3300031456 Ga0307513_10179625 Ga0307513_101796252 217
180 3300031507 Ga0307509_10000993 Ga0307509_1000099320 217
181 3300031507 Ga0307509_10010193 Ga0307509_100101937 217
182 3300031507 Ga0307509_10032069 Ga0307509_100320697 217
183 3300031507 Ga0307509_10036403 Ga0307509_100364032 217
184 3300031507 Ga0307509_10067390 Ga0307509_100673903 217
185 3300031507 Ga0307509_10072621 Ga0307509_100726212 217
186 3300031507 Ga0307509_10156904 Ga0307509_101569042 217
187 3300031616 Ga0307508_10000539 Ga0307508_100005396 217
188 3300031616 Ga0307508_10000940 Ga0307508_1000094011 217
189 3300031616 Ga0307508_10002735 Ga0307508_100027358 217
190 3300031616 Ga0307508_10039477 Ga0307508_100394772 217
191 3300031616 Ga0307508_10075552 Ga0307508_100755522 217
192 3300031616 Ga0307508_10307023 Ga0307508_103070232 217
193 3300031730 Ga0307516_10003030 Ga0307516_1000303018 217
194 3300031730 Ga0307516_10052821 Ga0307516_100528215 217
195 3300033180 Ga0307510_10000129 Ga0307510_1000012911 217
196 3300033180 Ga0307510_10009594 Ga0307510_100095946 217
197 3300033180 Ga0307510_10210656 Ga0307510_102106562 217
198 3300033180 Ga0307510_10215658 Ga0307510_102156582 217
199 3300041459 Ga0451800_0023691 Ga0451800_0023691_56_721 217
200 3300042876 Ga0451577_0061567 Ga0451577_0061567_1093_1752 217
201 3300042876 Ga0451577_0425765 Ga0451577_0425765_305_985 217
202 3300046454 Ga0495592_0004068 Ga0495592_0004068_5019_5696 217
203 3300046457 Ga0495590_0123238 Ga0495590_0123238_77_745 217
204 3300046515 Ga0495620_0032782 Ga0495620_0032782_103_756 217
205 3300046519 Ga0495632_0002259 Ga0495632_0002259_1311_1979 217
206 3300046519 Ga0495632_0007218 Ga0495632_0007218_5787_6440 217
207 3300046519 Ga0495632_0070113 Ga0495632_0070113_244_897 217
208 3300046522 Ga0495643_0052401 Ga0495643_0052401_523_1176 217
209 3300046542 Ga0495597_0024462 Ga0495597_0024462_678_1346 217
210 3300046542 Ga0495597_0096132 Ga0495597_0096132_93_761 217
211 3300046660 Ga0495625_0001689 Ga0495625_0001689_1075_1728 217
212 3300046660 Ga0495625_0032575 Ga0495625_0032575_1425_2093 217
213 3300046660 Ga0495625_0119354 Ga0495625_0119354_836_1504 217
214 3300046660 Ga0495625_0390466 Ga0495625_0390466_84_752 217
215 3300046680 Ga0495646_0166741 Ga0495646_0166741_514_1191 217
216 3300046694 Ga0495649_0006852 Ga0495649_0006852_5832_6500 217
217 3300046810 Ga0495660_0003887 Ga0495660_0003887_5312_5980 217
218 3300047443 Ga0495687_001215 Ga0495687_001215_4644_5312 217
219 3300047443 Ga0495687_011559 Ga0495687_011559_3471_4139 217
220 3300047443 Ga0495687_013474 Ga0495687_013474_2960_3628 217
221 3300048091 Ga0495626_0052693 Ga0495626_0052693_369_1037 217
222 3300048928 Ga0496125_0241453 Ga0496125_0241453_368_1096 217
223 3300050489 nmdc:mga03683_15687_c2 nmdc:mga03683_15687_c2_365_1033 217
224 3300050489 nmdc:mga03683_8587_c1 nmdc:mga03683_8587_c1_449_1117 217
225 3300050491 nmdc:mga00v17_46816_c1 nmdc:mga00v17_46816_c1_1668_2336 217
226 3300050493 nmdc:mga0k408_112660_c1 nmdc:mga0k408_112660_c1_560_1225 217
227 3300050493 nmdc:mga0k408_218252_c1 nmdc:mga0k408_218252_c1_398_1066 217
228 3300050493 nmdc:mga0k408_37365_c1 nmdc:mga0k408_37365_c1_1438_2106 217
229 3300050493 nmdc:mga0k408_60797_c1 nmdc:mga0k408_60797_c1_575_1228 217
230 3300050493 nmdc:mga0k408_8921_c1 nmdc:mga0k408_8921_c1_74_742 217
231 3300050493 nmdc:mga0k408_939_c1 nmdc:mga0k408_939_c1_4450_5118 217
232 3300050494 nmdc:mga06z11_2971_c1 nmdc:mga06z11_2971_c1_2230_2898 217
233 3300050494 nmdc:mga06z11_341806_c1 nmdc:mga06z11_341806_c1_67_720 217
234 3300050495 nmdc:mga04h51_124934_c1 nmdc:mga04h51_124934_c1_164_817 217
235 3300050496 nmdc:mga07m45_107687_c1 nmdc:mga07m45_107687_c1_116_784 217
236 3300050496 nmdc:mga07m45_158942_c1 nmdc:mga07m45_158942_c1_125_790 217
237 3300050496 nmdc:mga07m45_183_c1 nmdc:mga07m45_183_c1_15198_15866 217
238 3300050496 nmdc:mga07m45_211343_c1 nmdc:mga07m45_211343_c1_341_994 217
239 3300050496 nmdc:mga07m45_346036_c1 nmdc:mga07m45_346036_c1_125_778 217
240 3300050496 nmdc:mga07m45_60109_c1 nmdc:mga07m45_60109_c1_934_1587 217
241 3300050516 nmdc:mga0sz30_43484_c1 nmdc:mga0sz30_43484_c1_775_1443 217
242 3300053087 Ga0500643_036437 Ga0500643_036437_609_1289 217
243 3300053088 Ga0500644_0001115 Ga0500644_0001115_2379_3047 217
244 3300053093 Ga0500651_0103952 Ga0500651_0103952_452_1120 217
245 3300053098 Ga0500650_0048627 Ga0500650_0048627_493_1161 217
246 3300053098 Ga0500650_0055941 Ga0500650_0055941_586_1254 217
247 3300053098 Ga0500650_0060671 Ga0500650_0060671_464_1132 217
248 3300053108 Ga0500562_005469 Ga0500562_005469_1559_2227 217
249 3300053123 Ga0500614_025978 Ga0500614_025978_226_894 217
250 3300053134 Ga0500658_0024122 Ga0500658_0024122_343_1011 217
251 3300053136 Ga0500559_0000047 Ga0500559_0000047_11074_11742 217
252 3300053138 Ga0500564_054300 Ga0500564_054300_453_1130 217
253 3300053139 Ga0500568_0017830 Ga0500568_0017830_652_1320 217
254 3300053139 Ga0500568_0054032 Ga0500568_0054032_840_1508 217
255 3300053142 Ga0500577_0207226 Ga0500577_0207226_60_767 217
256 3300053151 Ga0500604_0041220 Ga0500604_0041220_389_1057 217
257 3300053156 Ga0500622_0001747 Ga0500622_0001747_11105_11773 217
258 3300053158 Ga0500627_0122826 Ga0500627_0122826_405_1073 217
259 3300053736 Ga0500599_006418 Ga0500599_006418_435_1103 217
260 3300053739 Ga0500587_000834 Ga0500587_000834_2220_2873 217
261 3300059421 Ga0590071_002337 Ga0590071_002337_3258_3971 217

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02527

GidB

rRNA small subunit methyltransferase G

48

234

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1jsx-assembly1.cif.gz_A crystal structure of the escherichia coli glucose-inhibited division protein b (gidb) 0.9069 5 215
1jsx-assembly1.cif.gz_A crystal structure of the escherichia coli glucose-inhibited division protein b (gidb) 0.8893 5 215
3g8b-assembly1.cif.gz_A t. thermophilus 16s rrna g527 methyltransferase in complex with adomet in space group i222 0.8863 1 214
3g89-assembly2.cif.gz_B t. thermophilus 16s rrna g527 methyltransferase in complex with adomet and amp in space group p61 0.8747 5 214
3g8b-assembly1.cif.gz_A t. thermophilus 16s rrna g527 methyltransferase in complex with adomet in space group i222 0.8709 1 214
ID Description Score Start End Superfamily
af_I1JZW8_31_274_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9286 20 214 3.40.50.150
af_Q67VB2_1_103_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9194 43 138 3.40.50.150
1jsxA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9069 5 215 3.40.50.150
af_Q2FUQ4_1_237_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9003 5 214 3.40.50.150
1jsxA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8893 5 215 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A839HTM7-F1-model_v4 Ribosomal RNA small subunit methyltransferase G (EC 2.1.1.170) (16S rRNA 7-methylguanosine methyltransferase) (16S rRNA m7G methyltransferase) 0.9868 4 214 GO:0005829
GO:0070043
AF-A0A522LPJ9-F1-model_v4 16S rRNA (Guanine(527)-N(7))-methyltransferase RsmG 0.9827 102 216 GO:0005829
GO:0070043
AF-A0A6B2QYT3-F1-model_v4 Ribosomal RNA small subunit methyltransferase G (EC 2.1.1.170) (16S rRNA 7-methylguanosine methyltransferase) (16S rRNA m7G methyltransferase) 0.9816 5 217 GO:0005829
GO:0070043
AF-A0A5F1D742-F1-model_v4 deleted 0.9815 145 215
AF-K4KKK1-F1-model_v4 Methyltransferase GidB 0.9795 143 214 GO:0005737
GO:0008649

Feature Viewer

pLDDT pTM Quality
94.46 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map