F370242

General Info

Members Datasets Scaffolds Average Seq Length
261 160 522 263

Family's Representative Sequence

Representative Sequence 3300006038|Ga0075365_10147148|Ga0075365_101471482
Length 278
Sequence VVEEGALAPVSKPRPKLVATDLDGTLVRTDGSISPYTAEVLAAVEALGVPVVFVTGRPLRWTEVVFEHVGQHGLAVVSNGALVWDVARHVPRLERPIEPEVALGVARDLRAALPQVRFAVETLAGWSMEPGYARHRADEEHGFGARRESPLEELLEQPVLKLLARQDDADPDELVAAAVRVVGDRVNVTHSSFPLLEISAAAVTKASTLALLCADLGIEAAEVMAFGDMPNDLPMLTWAGTAYAMADAHPSVVAAADHLAPGHDEDGVAQVLAGVFDL

Samples

Sample ID Description Type Environment
1 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
2 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
32 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
33 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
34 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
35 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
36 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
37 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
38 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
39 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
40 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
41 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
42 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
46 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
47 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
55 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
56 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
57 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
58 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
81 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
83 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
84 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
85 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
86 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
87 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
88 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
89 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
90 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
91 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
92 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
93 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
94 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
95 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
96 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
97 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
98 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
99 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
100 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
101 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
102 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
103 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
104 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
105 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
106 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
107 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
108 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
109 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
110 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
111 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
121 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
126 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
127 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
128 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
129 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
130 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
131 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
132 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
133 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
134 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
137 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
138 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
139 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
140 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
141 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
142 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
143 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
144 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
145 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
146 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
147 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
148 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
149 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
150 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
151 2643221561 Nocardioides sp. Root151 Isolate Unclassified
152 2643221615 Nocardioides sp. Root224 Isolate Unclassified
153 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
154 2643221696 Nocardioides sp. Root140 Isolate Unclassified
155 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
156 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
157 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
158 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
159 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
160 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.17
Metatranscriptomes 0
Isolates 3.83

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 27.2
Nodule 0
Rhizoplane 3.07
Rhizosphere 64.37
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075365_10147148 3300006038 Bacteria 1637
2 JGI24738J21930_10015203 3300002075 Bacteria 1641
3 JGI24744J21845_10001382 3300002077 Bacteria 4807
4 Ga0070683_100071381 3300005329 Bacteria 3240
5 Ga0070683_100117042 3300005329 Bacteria 2516
6 Ga0070682_100013405 3300005337 Bacteria 4715
7 Ga0068868_100039402 3300005338 Bacteria 3671
8 Ga0070689_100142856 3300005340 Bacteria 1926
9 Ga0070691_10026421 3300005341 Bacteria 2706
10 Ga0070687_100003592 3300005343 Bacteria 6048
11 Ga0070687_100104208 3300005343 Bacteria 1594
12 Ga0070661_100148170 3300005344 Bacteria 1773
13 Ga0070692_10023164 3300005345 Bacteria 3040
14 Ga0070669_100326646 3300005353 Bacteria 1240
15 Ga0070675_100099683 3300005354 Bacteria 2446
16 Ga0070674_100082197 3300005356 Bacteria 2304
17 Ga0070673_100049398 3300005364 Bacteria 3285
18 Ga0070659_100101930 3300005366 Bacteria 2311
19 Ga0070667_100023347 3300005367 Bacteria 5130
20 Ga0070701_10013443 3300005438 Bacteria 3724
21 Ga0070700_100001691 3300005441 Bacteria 11068
22 Ga0070700_100046653 3300005441 Bacteria 2678
23 Ga0070708_100146603 3300005445 Bacteria 2193
24 Ga0070678_100164615 3300005456 Bacteria 1800
25 Ga0068867_100033532 3300005459 Bacteria 3719
26 Ga0070698_100001974 3300005471 Bacteria 22807
27 Ga0070684_100082346 3300005535 Bacteria 2849
28 Ga0068853_100036573 3300005539 Bacteria 4177
29 Ga0070672_100055731 3300005543 Bacteria 3097
30 Ga0070664_100274662 3300005564 Bacteria 1519
31 Ga0068854_100047380 3300005578 Bacteria 3063
32 Ga0068864_100125271 3300005618 Bacteria 2301
33 Ga0068861_100036764 3300005719 Bacteria 3637
34 Ga0068870_10005413 3300005840 Bacteria 5574
35 Ga0068860_100000253 3300005843 Bacteria 79802
36 Ga0068862_100168552 3300005844 Bacteria 1959
37 Ga0081539_10026044 3300005985 Bacteria 3746
38 Ga0075365_10000516 3300006038 Bacteria 14767
39 Ga0075365_10009413 3300006038 Bacteria 5614
40 Ga0075365_10012228 3300006038 Bacteria 5087
41 Ga0075365_10016107 3300006038 Bacteria 4538
42 Ga0075365_10033716 3300006038 Bacteria 3301
43 Ga0075365_10047167 3300006038 Bacteria 2831
44 Ga0075365_10096758 3300006038 Bacteria 2017
45 Ga0075365_10130189 3300006038 Bacteria 1741
46 Ga0075365_10133313 3300006038 Bacteria 1720
47 Ga0075365_10302182 3300006038 Bacteria 1126
48 Ga0075368_10001520 3300006042 Bacteria 7429
49 Ga0075368_10013299 3300006042 Bacteria 3022
50 Ga0075363_100001425 3300006048 Bacteria 9054
51 Ga0075363_100005425 3300006048 Bacteria 5668
52 Ga0075363_100022451 3300006048 Bacteria 3190
53 Ga0075363_100030679 3300006048 Bacteria 2784
54 Ga0075363_100033722 3300006048 Bacteria 2668
55 Ga0075363_100067472 3300006048 Bacteria 1938
56 Ga0075364_10000302 3300006051 Bacteria 24058
57 Ga0075364_10029070 3300006051 Bacteria 3543
58 Ga0075364_10029973 3300006051 Bacteria 3491
59 Ga0075364_10053867 3300006051 Bacteria 2630
60 Ga0075364_10130643 3300006051 Bacteria 1685
61 Ga0075364_10145804 3300006051 Bacteria 1594
62 Ga0075362_10000301 3300006177 Bacteria 13973
63 Ga0075367_10019314 3300006178 Bacteria 3778
64 Ga0075367_10067089 3300006178 Bacteria 2151
65 Ga0075367_10098930 3300006178 Bacteria 1781
66 Ga0075367_10103173 3300006178 Bacteria 1745
67 Ga0075367_10148724 3300006178 Bacteria 1453
68 Ga0075370_10148103 3300006353 Bacteria 1375
69 Ga0075428_100279365 3300006844 Bacteria 1797
70 Ga0068865_100054755 3300006881 Bacteria 2774
71 Ga0111539_10096143 3300009094 Bacteria 3479
72 Ga0105245_10044905 3300009098 Bacteria 3945
73 Ga0105243_10008469 3300009148 Bacteria 7895
74 Ga0105243_10026734 3300009148 Bacteria 4419
75 Ga0105241_10428339 3300009174 Bacteria 1166
76 Ga0105242_10255767 3300009176 Bacteria 1580
77 Ga0105248_10191485 3300009177 Bacteria 2305
78 Ga0105237_10176804 3300009545 Bacteria 2135
79 Ga0105249_10085647 3300009553 Bacteria 2937
80 Ga0105249_10162020 3300009553 Bacteria 2162
81 Ga0105239_10003004 3300010375 Bacteria 21030
82 Ga0157372_10204453 3300013307 Bacteria 2288
83 Ga0157375_10242366 3300013308 Bacteria 1962
84 Ga0163163_10203586 3300014325 Bacteria 2028
85 Ga0157380_10002931 3300014326 Bacteria 11597
86 Ga0157377_10051597 3300014745 Bacteria 2320
87 Ga0163161_10002659 3300017792 Bacteria 12700
88 Ga0207688_10006573 3300025901 Bacteria 6323
89 Ga0207643_10003981 3300025908 Bacteria 7951
90 Ga0207662_10038379 3300025918 Bacteria 2806
91 Ga0207662_10160433 3300025918 Bacteria 1436
92 Ga0207659_10055622 3300025926 Bacteria 2831
93 Ga0207709_10118411 3300025935 Bacteria 1784
94 Ga0207704_10014693 3300025938 Bacteria 3963
95 Ga0207691_10110761 3300025940 Bacteria 2441
96 Ga0207711_10135906 3300025941 Bacteria 2208
97 Ga0207661_10008292 3300025944 Bacteria 7425
98 Ga0207679_10310401 3300025945 Bacteria 1362
99 Ga0207651_10082287 3300025960 Bacteria 2324
100 Ga0207712_10274655 3300025961 Bacteria 1373
101 Ga0207712_10336056 3300025961 Bacteria 1251
102 Ga0207668_10070446 3300025972 Bacteria 2494
103 Ga0207640_10063800 3300025981 Bacteria 2449
104 Ga0207658_10007889 3300025986 Bacteria 7250
105 Ga0207677_10046176 3300026023 Bacteria 2915
106 Ga0207639_10285791 3300026041 Bacteria 1452
107 Ga0207708_10000523 3300026075 Bacteria 29609
108 Ga0207708_10055873 3300026075 Bacteria 3010
109 Ga0207648_10036718 3300026089 Bacteria 4317
110 Ga0207676_10088085 3300026095 Bacteria 2541
111 Ga0207675_100001254 3300026118 Bacteria 25321
112 Ga0207675_100018137 3300026118 Bacteria 6562
113 Ga0207675_100224511 3300026118 Bacteria 1811
114 Ga0207675_100387129 3300026118 Bacteria 1376
115 Ga0207698_10057061 3300026142 Bacteria 3018
116 Ga0209813_10001847 3300027866 Bacteria 4774
117 Ga0209813_10004267 3300027866 Bacteria 3401
118 Ga0209813_10027728 3300027866 Bacteria 1647
119 Ga0209813_10066973 3300027866 Bacteria 1159
120 Ga0268264_10000220 3300028381 Bacteria 111692
121 Ga0307413_10071867 3300031824 Bacteria 2182
122 Ga0307409_100123369 3300031995 Bacteria 2199
123 Ga0373938_0023605 3300034957 Bacteria 1266
124 Ga0395900_0075620 3300037418 Bacteria 3462
125 Ga0395905_0109944 3300037471 Bacteria 2588
126 Ga0395901_0056199 3300038443 Bacteria 4094
127 Ga0395901_0070199 3300038443 Bacteria 3649
128 Ga0451853_0033281 3300041512 Bacteria 1153
129 Ga0451853_0678336 3300041512 Bacteria 1462
130 Ga0451853_1235153 3300041512 Bacteria 1308
131 Ga0466969_0106806 3300044656 Bacteria 1313
132 Ga0466972_0162650 3300044658 Bacteria 1048
133 Ga0466965_0040936 3300044683 Bacteria 2282
134 Ga0466965_0059767 3300044683 Bacteria 1903
135 Ga0466965_0083314 3300044683 Bacteria 1619
136 Ga0466965_0093764 3300044683 Bacteria 1529
137 Ga0466965_0101711 3300044683 Bacteria 1470
138 Ga0466966_0137920 3300044684 Bacteria 1491
139 Ga0466966_0139833 3300044684 Bacteria 1480
140 Ga0466961_0004768 3300044693 Bacteria 8536
141 Ga0466961_0238738 3300044693 Bacteria 1117
142 Ga0466963_0012309 3300044694 Bacteria 5231
143 Ga0466964_0026596 3300044706 Bacteria 2266
144 Ga0466971_0017339 3300044719 Bacteria 3185
145 Ga0466971_0129020 3300044719 Bacteria 1173
146 Ga0466968_0019749 3300044735 Bacteria 2715
147 Ga0466970_0015968 3300044765 Bacteria 3866
148 Ga0466970_0023073 3300044765 Bacteria 3248
149 Ga0466970_0068780 3300044765 Bacteria 1903
150 Ga0466970_0104579 3300044765 Bacteria 1543
151 Ga0466970_0181289 3300044765 Bacteria 1169
152 Ga0466957_0012824 3300044842 Bacteria 4857
153 Ga0466957_0046062 3300044842 Bacteria 2646
154 Ga0466957_0064574 3300044842 Bacteria 2252
155 Ga0466957_0117641 3300044842 Bacteria 1692
156 Ga0466960_0001099 3300044901 Bacteria 9725
157 Ga0466960_0006194 3300044901 Bacteria 4791
158 Ga0466960_0162786 3300044901 Bacteria 1199
159 Ga0466958_0034671 3300045836 Bacteria 3012
160 Ga0466967_0042327 3300045976 Bacteria 3935
161 Ga0466967_0051839 3300045976 Bacteria 3598
162 Ga0496100_0210878 3300048903 Bacteria 1421
163 Ga0496101_0303008 3300048904 Bacteria 1252
164 Ga0496102_0107001 3300048905 Bacteria 2604
165 Ga0496108_0078785 3300048911 Bacteria 2789
166 Ga0496109_0044124 3300048912 Bacteria 4044
167 Ga0496110_0109470 3300048913 Bacteria 2481
168 Ga0496110_0323906 3300048913 Bacteria 1404
169 Ga0496114_0358253 3300048917 Bacteria 1290
170 Ga0496124_0310428 3300048927 Bacteria 1134
171 Ga0501031_0028284 3300049568 Bacteria 3654
172 Ga0501032_0010390 3300049569 Bacteria 6714
173 Ga0501033_0001464 3300049570 Bacteria 20930
174 Ga0501033_0063931 3300049570 Bacteria 2708
175 Ga0501034_0038543 3300049571 Bacteria 4839
176 Ga0501034_0039394 3300049571 Bacteria 4787
177 Ga0501036_0100899 3300049572 Bacteria 2441
178 Ga0501037_0005980 3300049573 Bacteria 8888
179 Ga0501037_0009641 3300049573 Bacteria 7085
180 Ga0501038_0005199 3300049574 Bacteria 12108
181 Ga0501038_0010020 3300049574 Bacteria 8679
182 Ga0501039_0025504 3300049575 Bacteria 4542
183 Ga0501040_0114613 3300049576 Bacteria 1887
184 Ga0501042_0009550 3300049578 Bacteria 6469
185 Ga0501042_0028422 3300049578 Bacteria 3940
186 Ga0501043_0065495 3300049579 Bacteria 2853
187 Ga0501043_0351626 3300049579 Bacteria 1120
188 Ga0501046_0005304 3300049580 Bacteria 11532
189 Ga0501046_0038060 3300049580 Bacteria 3862
190 Ga0501047_0032282 3300049581 Bacteria 5053
191 Ga0501048_0030700 3300049582 Bacteria 3888
192 Ga0501048_0228150 3300049582 Bacteria 1321
193 Ga0501067_0006311 3300049583 Bacteria 6575
194 Ga0501067_0165803 3300049583 Bacteria 1230
195 Ga0501067_0274392 3300049583 Bacteria 939
196 Ga0501068_0143337 3300049584 Bacteria 1498
197 Ga0501070_0116918 3300049586 Bacteria 2202
198 Ga0501070_0138523 3300049586 Bacteria 2009
199 Ga0501071_0241973 3300049587 Bacteria 1361
200 Ga0501071_0275319 3300049587 Bacteria 1273
201 Ga0501071_0348750 3300049587 Bacteria 1126
202 Ga0501073_0048625 3300049589 Bacteria 2977
203 Ga0501073_0327096 3300049589 Bacteria 1058
204 Ga0501076_0326848 3300049592 Bacteria 1258
205 Ga0501079_0346869 3300049741 Bacteria 1163
206 Ga0501080_0087357 3300049742 Bacteria 2897
207 Ga0501081_0243094 3300049743 Bacteria 1313
208 Ga0501035_0005810 3300049822 Bacteria 11632
209 Ga0501035_0043491 3300049822 Bacteria 4047
210 Ga0501044_0010654 3300049823 Bacteria 9976
211 Ga0501044_0119185 3300049823 Bacteria 2641
212 Ga0501045_0072358 3300049824 Bacteria 2538
213 nmdc:mga03683_2895_c1 3300050489 Bacteria 5413
214 nmdc:mga03n38_136856_c1 3300050490 Bacteria 1220
215 nmdc:mga03n38_4869_c1 3300050490 Bacteria 4499
216 nmdc:mga03n38_66911_c1 3300050490 Bacteria 1652
217 nmdc:mga00v17_11949_c1 3300050491 Bacteria 4781
218 nmdc:mga00v17_134278_c1 3300050491 Bacteria 1583
219 nmdc:mga00v17_216844_c1 3300050491 Bacteria 1239
220 nmdc:mga00v17_249970_c1 3300050491 Bacteria 1150
221 nmdc:mga00v17_43578_c1 3300050491 Bacteria 2703
222 nmdc:mga0yw44_113486_c1 3300050492 Bacteria 1738
223 nmdc:mga0yw44_129552_c1 3300050492 Bacteria 1632
224 nmdc:mga0yw44_129912_c1 3300050492 Bacteria 1630
225 nmdc:mga0yw44_142970_c1 3300050492 Bacteria 1556
226 nmdc:mga0yw44_148507_c1 3300050492 Bacteria 1528
227 nmdc:mga0yw44_156715_c1 3300050492 Bacteria 1489
228 nmdc:mga0yw44_160660_c1 3300050492 Bacteria 1471
229 nmdc:mga0yw44_187483_c1 3300050492 Bacteria 1363
230 nmdc:mga0yw44_226812_c1 3300050492 Bacteria 1239
231 nmdc:mga0yw44_306861_c1 3300050492 Bacteria 1064
232 nmdc:mga0yw44_380180_c1 3300050492 Bacteria 953
233 nmdc:mga0yw44_80613_c1 3300050492 Bacteria 2039
234 nmdc:mga0yw44_9144_c1 3300050492 Bacteria 4985
235 nmdc:mga06z11_136067_c1 3300050494 Bacteria 1384
236 nmdc:mga06z11_18974_c1 3300050494 Bacteria 3153
237 nmdc:mga06z11_95974_c1 3300050494 Bacteria 1619
238 nmdc:mga04h51_26163_c1 3300050495 Bacteria 1802
239 nmdc:mga04h51_3364_c1 3300050495 Bacteria 3883
240 nmdc:mga04h51_4341_c1 3300050495 Bacteria 3520
241 nmdc:mga04h51_78741_c1 3300050495 Bacteria 1165
242 nmdc:mga07m45_224526_c1 3300050496 Bacteria 1093
243 nmdc:mga07m45_9933_c1 3300050496 Bacteria 4953
244 nmdc:mga09592_576449_c1 3300050508 Bacteria 965
245 nmdc:mga0sz30_21758_c2 3300050516 Bacteria 1574
246 Ga0500644_0000049 3300053088 Bacteria 72195
247 Ga0500556_0000210 3300053104 Bacteria 47478
248 Ga0500593_001046 3300053117 Bacteria 10029
249 Ga0501084_0406833 3300054114 Bacteria 1150
250 Ga0530510_0080043 3300061734 Bacteria 2377
251 Ga0530510_0456241 3300061734 Bacteria 967
252 2643825081 2643221561 Bacteria 4984412
253 2644092128 2643221615 Bacteria 5487866
254 2644321931 2643221657 Bacteria 5490246
255 2644534613 2643221696 Bacteria 5431823
256 2774395245 2773857762 Bacteria 5971770
257 2809193921 2808606439 Bacteria 5952208
258 2812348661 2811994878 Bacteria 5992952
259 2855390410 2855386786 Bacteria 4752232
260 2857485009 2857481737 Bacteria 4761446
261 2891973604 2891968417 Bacteria 5821697
262 Ga0075365_10147148
263 JGI24738J21930_10015203
264 JGI24744J21845_10001382
265 Ga0070683_100071381
266 Ga0070683_100117042
267 Ga0070682_100013405
268 Ga0068868_100039402
269 Ga0070689_100142856
270 Ga0070691_10026421
271 Ga0070687_100003592
272 Ga0070687_100104208
273 Ga0070661_100148170
274 Ga0070692_10023164
275 Ga0070669_100326646
276 Ga0070675_100099683
277 Ga0070674_100082197
278 Ga0070673_100049398
279 Ga0070659_100101930
280 Ga0070667_100023347
281 Ga0070701_10013443
282 Ga0070700_100001691
283 Ga0070700_100046653
284 Ga0070708_100146603
285 Ga0070678_100164615
286 Ga0068867_100033532
287 Ga0070698_100001974
288 Ga0070684_100082346
289 Ga0068853_100036573
290 Ga0070672_100055731
291 Ga0070664_100274662
292 Ga0068854_100047380
293 Ga0068864_100125271
294 Ga0068861_100036764
295 Ga0068870_10005413
296 Ga0068860_100000253
297 Ga0068862_100168552
298 Ga0081539_10026044
299 Ga0075365_10000516
300 Ga0075365_10009413
301 Ga0075365_10012228
302 Ga0075365_10016107
303 Ga0075365_10033716
304 Ga0075365_10047167
305 Ga0075365_10096758
306 Ga0075365_10130189
307 Ga0075365_10133313
308 Ga0075365_10302182
309 Ga0075368_10001520
310 Ga0075368_10013299
311 Ga0075363_100001425
312 Ga0075363_100005425
313 Ga0075363_100022451
314 Ga0075363_100030679
315 Ga0075363_100033722
316 Ga0075363_100067472
317 Ga0075364_10000302
318 Ga0075364_10029070
319 Ga0075364_10029973
320 Ga0075364_10053867
321 Ga0075364_10130643
322 Ga0075364_10145804
323 Ga0075362_10000301
324 Ga0075367_10019314
325 Ga0075367_10067089
326 Ga0075367_10098930
327 Ga0075367_10103173
328 Ga0075367_10148724
329 Ga0075370_10148103
330 Ga0075428_100279365
331 Ga0068865_100054755
332 Ga0111539_10096143
333 Ga0105245_10044905
334 Ga0105243_10008469
335 Ga0105243_10026734
336 Ga0105241_10428339
337 Ga0105242_10255767
338 Ga0105248_10191485
339 Ga0105237_10176804
340 Ga0105249_10085647
341 Ga0105249_10162020
342 Ga0105239_10003004
343 Ga0157372_10204453
344 Ga0157375_10242366
345 Ga0163163_10203586
346 Ga0157380_10002931
347 Ga0157377_10051597
348 Ga0163161_10002659
349 Ga0207688_10006573
350 Ga0207643_10003981
351 Ga0207662_10038379
352 Ga0207662_10160433
353 Ga0207659_10055622
354 Ga0207709_10118411
355 Ga0207704_10014693
356 Ga0207691_10110761
357 Ga0207711_10135906
358 Ga0207661_10008292
359 Ga0207679_10310401
360 Ga0207651_10082287
361 Ga0207712_10274655
362 Ga0207712_10336056
363 Ga0207668_10070446
364 Ga0207640_10063800
365 Ga0207658_10007889
366 Ga0207677_10046176
367 Ga0207639_10285791
368 Ga0207708_10000523
369 Ga0207708_10055873
370 Ga0207648_10036718
371 Ga0207676_10088085
372 Ga0207675_100001254
373 Ga0207675_100018137
374 Ga0207675_100224511
375 Ga0207675_100387129
376 Ga0207698_10057061
377 Ga0209813_10001847
378 Ga0209813_10004267
379 Ga0209813_10027728
380 Ga0209813_10066973
381 Ga0268264_10000220
382 Ga0307413_10071867
383 Ga0307409_100123369
384 Ga0373938_0023605
385 Ga0395900_0075620
386 Ga0395905_0109944
387 Ga0395901_0056199
388 Ga0395901_0070199
389 Ga0451853_0033281
390 Ga0451853_0678336
391 Ga0451853_1235153
392 Ga0466969_0106806
393 Ga0466972_0162650
394 Ga0466965_0040936
395 Ga0466965_0059767
396 Ga0466965_0083314
397 Ga0466965_0093764
398 Ga0466965_0101711
399 Ga0466966_0137920
400 Ga0466966_0139833
401 Ga0466961_0004768
402 Ga0466961_0238738
403 Ga0466963_0012309
404 Ga0466964_0026596
405 Ga0466971_0017339
406 Ga0466971_0129020
407 Ga0466968_0019749
408 Ga0466970_0015968
409 Ga0466970_0023073
410 Ga0466970_0068780
411 Ga0466970_0104579
412 Ga0466970_0181289
413 Ga0466957_0012824
414 Ga0466957_0046062
415 Ga0466957_0064574
416 Ga0466957_0117641
417 Ga0466960_0001099
418 Ga0466960_0006194
419 Ga0466960_0162786
420 Ga0466958_0034671
421 Ga0466967_0042327
422 Ga0466967_0051839
423 Ga0496100_0210878
424 Ga0496101_0303008
425 Ga0496102_0107001
426 Ga0496108_0078785
427 Ga0496109_0044124
428 Ga0496110_0109470
429 Ga0496110_0323906
430 Ga0496114_0358253
431 Ga0496124_0310428
432 Ga0501031_0028284
433 Ga0501032_0010390
434 Ga0501033_0001464
435 Ga0501033_0063931
436 Ga0501034_0038543
437 Ga0501034_0039394
438 Ga0501036_0100899
439 Ga0501037_0005980
440 Ga0501037_0009641
441 Ga0501038_0005199
442 Ga0501038_0010020
443 Ga0501039_0025504
444 Ga0501040_0114613
445 Ga0501042_0009550
446 Ga0501042_0028422
447 Ga0501043_0065495
448 Ga0501043_0351626
449 Ga0501046_0005304
450 Ga0501046_0038060
451 Ga0501047_0032282
452 Ga0501048_0030700
453 Ga0501048_0228150
454 Ga0501067_0006311
455 Ga0501067_0165803
456 Ga0501067_0274392
457 Ga0501068_0143337
458 Ga0501070_0116918
459 Ga0501070_0138523
460 Ga0501071_0241973
461 Ga0501071_0275319
462 Ga0501071_0348750
463 Ga0501073_0048625
464 Ga0501073_0327096
465 Ga0501076_0326848
466 Ga0501079_0346869
467 Ga0501080_0087357
468 Ga0501081_0243094
469 Ga0501035_0005810
470 Ga0501035_0043491
471 Ga0501044_0010654
472 Ga0501044_0119185
473 Ga0501045_0072358
474 nmdc:mga03683_2895_c1
475 nmdc:mga03n38_136856_c1
476 nmdc:mga03n38_4869_c1
477 nmdc:mga03n38_66911_c1
478 nmdc:mga00v17_11949_c1
479 nmdc:mga00v17_134278_c1
480 nmdc:mga00v17_216844_c1
481 nmdc:mga00v17_249970_c1
482 nmdc:mga00v17_43578_c1
483 nmdc:mga0yw44_113486_c1
484 nmdc:mga0yw44_129552_c1
485 nmdc:mga0yw44_129912_c1
486 nmdc:mga0yw44_142970_c1
487 nmdc:mga0yw44_148507_c1
488 nmdc:mga0yw44_156715_c1
489 nmdc:mga0yw44_160660_c1
490 nmdc:mga0yw44_187483_c1
491 nmdc:mga0yw44_226812_c1
492 nmdc:mga0yw44_306861_c1
493 nmdc:mga0yw44_380180_c1
494 nmdc:mga0yw44_80613_c1
495 nmdc:mga0yw44_9144_c1
496 nmdc:mga06z11_136067_c1
497 nmdc:mga06z11_18974_c1
498 nmdc:mga06z11_95974_c1
499 nmdc:mga04h51_26163_c1
500 nmdc:mga04h51_3364_c1
501 nmdc:mga04h51_4341_c1
502 nmdc:mga04h51_78741_c1
503 nmdc:mga07m45_224526_c1
504 nmdc:mga07m45_9933_c1
505 nmdc:mga09592_576449_c1
506 nmdc:mga0sz30_21758_c2
507 Ga0500644_0000049
508 Ga0500556_0000210
509 Ga0500593_001046
510 Ga0501084_0406833
511 Ga0530510_0080043
512 Ga0530510_0456241
513 2643825081
514 2644092128
515 2644321931
516 2644534613
517 2774395245
518 2809193921
519 2812348661
520 2855390410
521 2857485009
522 2891973604

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08282

Hydrolase_3

haloacid dehalogenase-like hydrolase

18

272

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3pgv-assembly3.cif.gz_C crystal structure of a haloacid dehalogenase-like hydrolase (kpn_04322) from klebsiella pneumoniae subsp. pneumoniae mgh 78578 at 2.39 a resolution 0.862 10 269
3pgv-assembly1.cif.gz_A crystal structure of a haloacid dehalogenase-like hydrolase (kpn_04322) from klebsiella pneumoniae subsp. pneumoniae mgh 78578 at 2.39 a resolution 0.8537 11 267
3pgv-assembly3.cif.gz_C crystal structure of a haloacid dehalogenase-like hydrolase (kpn_04322) from klebsiella pneumoniae subsp. pneumoniae mgh 78578 at 2.39 a resolution 0.8527 10 269
1nrw-assembly1.cif.gz_A the structure of a haloacid dehalogenase-like hydrolase from b. subtilis 0.8517 10 265
3l7y-assembly1.cif.gz_A the crystal structure of smu.1108c from streptococcus mutans ua159 0.8513 10 269
ID Description Score Start End Superfamily
af_Q86KT5_213_287_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9743 198 269 3.40.50.1000
af_A0A1D6GSK2_41_144_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9505 216 251 3.40.50.1000
af_O07810_7_266_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9305 12 262 3.40.50.2020
1nrwA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9281 12 261 3.40.50.1000
af_Q86KT5_213_287_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9243 198 269 3.40.50.1000
ID Description Score Start End GO Terms
AF-A0A538MQT7-F1-model_v4 HAD family phosphatase 0.9757 196 268 GO:0000287
GO:0005829
GO:0016791
AF-A0A2W6DVB7-F1-model_v4 Hydrolase 0.9628 9 267 GO:0000287
GO:0005829
GO:0016791
AF-A0A3S9PJS9-F1-model_v4 Cof-type HAD-IIB family hydrolase 0.954 3 269 GO:0000287
GO:0005829
GO:0016791
AF-A0A132NFF2-F1-model_v4 Hydrolase 0.951 9 268 GO:0000287
GO:0005829
GO:0016791
AF-C8XK24-F1-model_v4 Cof-like hydrolase 0.9504 13 266 GO:0000287
GO:0005829
GO:0016791

Map