F370229

General Info

Members Datasets Scaffolds Average Seq Length
261 186 522 138

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10340927|Ga0081455_103409272
Length 142
Sequence MANEVKDVVEGDGYAVANVDGLADGPGFRKVRRALGVTAFGVNAIELPAGYETGRHFHEEQEELYFLHRGKIEITLDDDTFLLGPGGLARVDAATVRKIKNVGDEPAVYLVTGGKDGYVGRDGRLPEGETSRVGETAGEQQQ

Samples

Sample ID Description Type Environment
1 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
31 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
32 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
33 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
34 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
35 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
36 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
37 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
38 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
39 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
40 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
43 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
44 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
48 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
49 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
50 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
51 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
52 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
57 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
88 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
90 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
91 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
92 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
93 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
94 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
95 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
96 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
97 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
98 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
99 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
100 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
101 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
102 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
103 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
104 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
105 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
106 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
107 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
108 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
109 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
110 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
111 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
112 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
113 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
114 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
115 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
116 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
117 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
118 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
119 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
120 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
121 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
122 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
123 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
124 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
125 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
126 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
127 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
128 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
129 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
130 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
131 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
132 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
133 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
134 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
135 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
136 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
137 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
138 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
139 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
140 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
141 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
142 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
143 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
144 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
145 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
146 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
147 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
148 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
149 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
150 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
151 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
152 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
153 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
154 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
155 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
156 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
157 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
158 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
159 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
160 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
161 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
168 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
169 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
170 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
171 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
172 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
173 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
174 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
175 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
176 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
177 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
178 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
179 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
180 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
181 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
182 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
183 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
184 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
185 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
186 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.32
Metatranscriptomes 2.68
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.92
Nodule 0
Rhizoplane 7.66
Rhizosphere 90.04
Stem 0
Stem Tuber 0
Unclassified 10.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081455_10340927 3300005937 Unclassified 1061
2 LJQas_1009188 3300000549 Bacteria 1193
3 JGI24743J22301_10086453 3300001991 Bacteria 665
4 JGI25407J50210_10004026 3300003373 Bacteria 3564
5 JGI25407J50210_10104477 3300003373 Bacteria 699
6 Ga0070683_100034927 3300005329 Bacteria 4595
7 Ga0070683_100062335 3300005329 Bacteria 3467
8 Ga0070683_100118607 3300005329 Bacteria 2499
9 Ga0070683_100122452 3300005329 Bacteria 2457
10 Ga0070683_100638485 3300005329 Unclassified 1019
11 Ga0070666_10120764 3300005335 Bacteria 1817
12 Ga0070682_100000171 3300005337 Bacteria 48470
13 Ga0070682_100628999 3300005337 Bacteria 851
14 Ga0068868_100003306 3300005338 Bacteria 11219
15 Ga0070661_100000035 3300005344 Bacteria 111363
16 Ga0070668_100106891 3300005347 Bacteria 2224
17 Ga0070668_100150615 3300005347 Bacteria 1881
18 Ga0070675_100000377 3300005354 Bacteria 30146
19 Ga0070673_100000474 3300005364 Bacteria 21373
20 Ga0070673_100998967 3300005364 Unclassified 779
21 Ga0070688_100000285 3300005365 Bacteria 26015
22 Ga0070659_100537339 3300005366 Bacteria 1000
23 Ga0070659_101621483 3300005366 Bacteria 578
24 Ga0070714_100192236 3300005435 Bacteria 1863
25 Ga0070714_100777686 3300005435 Bacteria 926
26 Ga0070713_100000380 3300005436 Bacteria 28361
27 Ga0070711_100073303 3300005439 Bacteria 2419
28 Ga0070678_100022681 3300005456 Bacteria 4166
29 Ga0070685_10000159 3300005466 Bacteria 43951
30 Ga0070684_100415345 3300005535 Bacteria 1242
31 Ga0070684_100711447 3300005535 Bacteria 937
32 Ga0070697_101317385 3300005536 Unclassified 644
33 Ga0068853_100401489 3300005539 Bacteria 1283
34 Ga0070672_100000006 3300005543 Bacteria 117060
35 Ga0070665_100169526 3300005548 Bacteria 2184
36 Ga0070664_100119123 3300005564 Bacteria 2310
37 Ga0068857_101040074 3300005577 Unclassified 789
38 Ga0068854_100024981 3300005578 Bacteria 4098
39 Ga0068854_100906776 3300005578 Unclassified 775
40 Ga0068856_100000925 3300005614 Bacteria 31449
41 Ga0068856_100077098 3300005614 Bacteria 3302
42 Ga0068856_100223944 3300005614 Bacteria 1896
43 Ga0068852_100006635 3300005616 Bacteria 8385
44 Ga0081455_10017592 3300005937 Bacteria 6843
45 Ga0081538_10000691 3300005981 Bacteria 37035
46 Ga0081538_10000894 3300005981 Bacteria 32276
47 Ga0081538_10009157 3300005981 Bacteria 8304
48 Ga0081540_1042483 3300005983 Bacteria 2345
49 Ga0081540_1284191 3300005983 Bacteria 570
50 Ga0075365_10240920 3300006038 Bacteria 1270
51 Ga0075363_100520166 3300006048 Bacteria 708
52 Ga0070712_100012842 3300006175 Bacteria 5333
53 Ga0070712_101621756 3300006175 Unclassified 566
54 Ga0075367_10554581 3300006178 Bacteria 730
55 Ga0075433_10622216 3300006852 Bacteria 947
56 Ga0075434_100794369 3300006871 Bacteria 963
57 Ga0068865_100001059 3300006881 Bacteria 15817
58 Ga0105251_10117569 3300009011 Unclassified 1208
59 Ga0111539_10118468 3300009094 Bacteria 3103
60 Ga0105245_10020367 3300009098 Bacteria 5817
61 Ga0105247_10103375 3300009101 Bacteria 1824
62 Ga0105243_10053717 3300009148 Bacteria 3196
63 Ga0105241_10150816 3300009174 Bacteria 1902
64 Ga0105241_10308971 3300009174 Unclassified 1359
65 Ga0105248_10001622 3300009177 Bacteria 24979
66 Ga0105239_10110448 3300010375 Bacteria 3048
67 Ga0157370_10159693 3300013104 Bacteria 2098
68 Ga0157370_10272610 3300013104 Unclassified 1563
69 Ga0157378_10154364 3300013297 Bacteria 2141
70 Ga0157378_10211031 3300013297 Bacteria 1841
71 Ga0157375_10373080 3300013308 Bacteria 1593
72 Ga0157375_11613584 3300013308 Bacteria 767
73 Ga0163163_11796446 3300014325 Bacteria 673
74 Ga0157380_10000445 3300014326 Bacteria 25326
75 Ga0197907_10034932 3300020069 Unclassified 1116
76 Ga0206356_10258878 3300020070 Bacteria 3533
77 Ga0206356_10394249 3300020070 Bacteria 1120
78 Ga0206349_1670028 3300020075 Unclassified 1646
79 Ga0206352_11286604 3300020078 Unclassified 1551
80 Ga0206354_10669761 3300020081 Unclassified 1147
81 Ga0206353_10298658 3300020082 Unclassified 1117
82 Ga0207656_10001648 3300025321 Bacteria 7432
83 Ga0207710_10066194 3300025900 Bacteria 1648
84 Ga0207680_10151375 3300025903 Bacteria 1547
85 Ga0207654_10075293 3300025911 Bacteria 2017
86 Ga0207693_10019603 3300025915 Bacteria 5379
87 Ga0207693_11222066 3300025915 Unclassified 566
88 Ga0207663_10000487 3300025916 Bacteria 17285
89 Ga0207649_10000028 3300025920 Bacteria 161482
90 Ga0207650_10134382 3300025925 Bacteria 1939
91 Ga0207659_10000246 3300025926 Bacteria 32971
92 Ga0207687_10004445 3300025927 Bacteria 9352
93 Ga0207700_10000033 3300025928 Bacteria 123113
94 Ga0207664_10008515 3300025929 Bacteria 7161
95 Ga0207664_10237872 3300025929 Bacteria 1585
96 Ga0207690_11338343 3300025932 Bacteria 599
97 Ga0207709_10105514 3300025935 Bacteria 1872
98 Ga0207704_10000103 3300025938 Bacteria 47628
99 Ga0207691_10000025 3300025940 Bacteria 129424
100 Ga0207711_10000006 3300025941 Bacteria 792692
101 Ga0207661_10009459 3300025944 Bacteria 6990
102 Ga0207661_10023059 3300025944 Bacteria 4699
103 Ga0207661_10030514 3300025944 Bacteria 4154
104 Ga0207661_10546403 3300025944 Unclassified 1061
105 Ga0207679_10170227 3300025945 Bacteria 1792
106 Ga0207679_10622914 3300025945 Bacteria 974
107 Ga0207651_10000664 3300025960 Bacteria 14678
108 Ga0207668_10097771 3300025972 Bacteria 2173
109 Ga0207668_10448440 3300025972 Bacteria 1101
110 Ga0207640_10000551 3300025981 Bacteria 22450
111 Ga0207640_10365806 3300025981 Bacteria 1164
112 Ga0207677_10001888 3300026023 Bacteria 11062
113 Ga0207703_10000088 3300026035 Bacteria 106080
114 Ga0207639_10167634 3300026041 Bacteria 1857
115 Ga0207639_10250615 3300026041 Bacteria 1544
116 Ga0207702_10000242 3300026078 Bacteria 63808
117 Ga0207702_10022205 3300026078 Bacteria 5260
118 Ga0207702_10331452 3300026078 Bacteria 1452
119 Ga0207674_12020221 3300026116 Unclassified 541
120 Ga0207683_10031904 3300026121 Bacteria 4574
121 Ga0207698_10000414 3300026142 Bacteria 24644
122 Ga0207698_10021589 3300026142 Bacteria 4457
123 Ga0207428_10065837 3300027907 Bacteria 2857
124 Ga0268266_10001578 3300028379 Bacteria 26646
125 Ga0268266_10118622 3300028379 Bacteria 2352
126 Ga0268266_10776017 3300028379 Bacteria 925
127 Ga0265327_10034253 3300031251 Bacteria 2821
128 Ga0307408_100055850 3300031548 Bacteria 2861
129 Ga0307405_11717915 3300031731 Bacteria 556
130 Ga0307413_10001669 3300031824 Bacteria 8622
131 Ga0307413_11089487 3300031824 Unclassified 689
132 Ga0307410_10018720 3300031852 Bacteria 4191
133 Ga0307410_10057292 3300031852 Bacteria 2653
134 Ga0307406_10041822 3300031901 Bacteria 2858
135 Ga0307407_10180731 3300031903 Bacteria 1398
136 Ga0307412_10346637 3300031911 Unclassified 1191
137 Ga0307409_100038352 3300031995 Bacteria 3543
138 Ga0307409_100322874 3300031995 Bacteria 1446
139 Ga0307409_100468741 3300031995 Bacteria 1219
140 Ga0307409_100535452 3300031995 Unclassified 1147
141 Ga0307416_100003565 3300032002 Bacteria 9183
142 Ga0307416_100117860 3300032002 Bacteria 2358
143 Ga0307411_10340719 3300032005 Bacteria 1218
144 Ga0307415_100000715 3300032126 Bacteria 14842
145 Ga0307415_100003877 3300032126 Bacteria 7679
146 Ga0307415_100068677 3300032126 Bacteria 2481
147 Ga0307415_100129610 3300032126 Bacteria 1907
148 Ga0307415_100980965 3300032126 Bacteria 784
149 Ga0373959_0085333 3300034820 Bacteria 733
150 Ga0373932_0047254 3300035112 Bacteria 1265
151 Ga0373939_0043293 3300035114 Bacteria 1365
152 Ga0373953_0277012 3300035117 Bacteria 731
153 Ga0373960_0031242 3300035121 Bacteria 1488
154 Ga0373931_0335039 3300035691 Bacteria 943
155 Ga0373935_1500207 3300035692 Bacteria 505
156 Ga0373933_0250790 3300035724 Bacteria 1140
157 Ga0373937_0007200 3300036401 Bacteria 9627
158 Ga0373937_0762918 3300036401 Bacteria 915
159 Ga0451847_0360256 3300041503 Archaea 684
160 Ga0450888_006547 3300042126 Bacteria 1269
161 Ga0450900_065906 3300042136 Bacteria 570
162 Ga0439460_0054825 3300042461 Bacteria 1204
163 Ga0466957_0005836 3300044842 Bacteria 6932
164 Ga0466959_0188528 3300045049 Bacteria 1440
165 Ga0466958_0345772 3300045836 Unclassified 957
166 Ga0466958_0563766 3300045836 Bacteria 740
167 Ga0466967_0000017 3300045976 Bacteria 89904
168 Ga0495592_0374079 3300046454 Bacteria 908
169 Ga0495603_0000593 3300046455 Bacteria 20342
170 Ga0495629_0000999 3300046459 Bacteria 22693
171 Ga0495641_0030362 3300046461 Bacteria 2593
172 Ga0495651_0102313 3300046462 Bacteria 2131
173 Ga0495653_0787313 3300046463 Bacteria 572
174 Ga0495605_0347133 3300046474 Bacteria 623
175 Ga0495664_0000022 3300046477 Bacteria 134123
176 Ga0495664_0340220 3300046477 Bacteria 904
177 Ga0495584_0137369 3300046491 Bacteria 1241
178 Ga0495585_0269797 3300046492 Unclassified 844
179 Ga0495596_0083732 3300046500 Bacteria 1238
180 Ga0495606_0000108 3300046507 Bacteria 140473
181 Ga0495608_0000036 3300046511 Bacteria 129609
182 Ga0495608_0319078 3300046511 Bacteria 960
183 Ga0495616_0091455 3300046513 Bacteria 1440
184 Ga0495628_0034129 3300046516 Bacteria 4096
185 Ga0495630_0000012 3300046517 Bacteria 223330
186 Ga0495637_0363069 3300046520 Archaea 506
187 Ga0495644_0146190 3300046523 Bacteria 904
188 Ga0495652_0098666 3300046529 Bacteria 2374
189 Ga0495654_0264961 3300046530 Bacteria 711
190 Ga0495665_0271595 3300046531 Unclassified 871
191 Ga0495587_0250660 3300046536 Bacteria 995
192 Ga0495635_0439666 3300046663 Bacteria 863
193 Ga0495657_0000001 3300046675 Bacteria 445641
194 Ga0495647_0002790 3300046681 Bacteria 5537
195 Ga0495658_0032106 3300046683 Bacteria 2865
196 Ga0495658_0350455 3300046683 Bacteria 938
197 Ga0495589_0043419 3300046794 Bacteria 2238
198 Ga0495600_0003292 3300046809 Bacteria 9474
199 Ga0495604_0028724 3300047317 Bacteria 4425
200 Ga0495674_0511362 3300047319 Bacteria 960
201 Ga0495680_0811806 3300047322 Bacteria 610
202 Ga0495675_0000515 3300047444 Bacteria 25086
203 Ga0495684_0458962 3300047471 Unclassified 884
204 Ga0495684_0631185 3300047471 Bacteria 719
205 Ga0496102_0000040 3300048905 Bacteria 196737
206 Ga0496103_0000067 3300048906 Bacteria 125906
207 Ga0496104_0000070 3300048907 Bacteria 107129
208 Ga0496105_0203798 3300048908 Bacteria 1614
209 Ga0496108_0000355 3300048911 Bacteria 38685
210 Ga0496108_0017846 3300048911 Bacteria 5804
211 Ga0496108_1082198 3300048911 Archaea 682
212 Ga0496109_0000400 3300048912 Bacteria 39194
213 Ga0496109_0000903 3300048912 Bacteria 24701
214 Ga0496109_0172674 3300048912 Bacteria 2028
215 Ga0496110_0000011 3300048913 Bacteria 97293
216 Ga0496110_0000653 3300048913 Bacteria 23661
217 Ga0496110_0002236 3300048913 Bacteria 14470
218 Ga0496110_0030839 3300048913 Bacteria 4624
219 Ga0496110_1082366 3300048913 Bacteria 710
220 Ga0496111_0000444 3300048914 Bacteria 21023
221 Ga0496111_0004792 3300048914 Bacteria 8582
222 Ga0496111_0006159 3300048914 Bacteria 7765
223 Ga0496112_0268554 3300048915 Bacteria 1654
224 Ga0496113_0000283 3300048916 Bacteria 23978
225 Ga0501031_0665302 3300049568 Bacteria 669
226 Ga0501036_0433462 3300049572 Bacteria 1096
227 Ga0501036_0475512 3300049572 Bacteria 1040
228 Ga0501037_0467697 3300049573 Bacteria 859
229 Ga0501039_0510980 3300049575 Bacteria 943
230 Ga0501040_0143896 3300049576 Bacteria 1680
231 Ga0501046_0306477 3300049580 Bacteria 1159
232 Ga0501068_0217617 3300049584 Bacteria 1213
233 Ga0501069_0247426 3300049585 Bacteria 1040
234 Ga0501071_0530513 3300049587 Bacteria 903
235 Ga0501072_1047256 3300049588 Bacteria 635
236 Ga0501076_0403471 3300049592 Unclassified 1124
237 Ga0501076_1049230 3300049592 Bacteria 671
238 Ga0501045_0401405 3300049824 Bacteria 1020
239 nmdc:mga0yw44_356774_c1 3300050492 Bacteria 985
240 nmdc:mga06z11_445255_c1 3300050494 Bacteria 782
241 nmdc:mga0qj67_142777_c1 3300050509 Bacteria 1941
242 nmdc:mga06r32_135500_c1 3300050510 Bacteria 2437
243 nmdc:mga08y16_176756_c1 3300050511 Bacteria 2217
244 nmdc:mga0n895_104589_c1 3300050512 Bacteria 2843
245 Ga0495601_0014470 3300053077 Bacteria 4756
246 Ga0495601_0129450 3300053077 Bacteria 1643
247 Ga0495612_0001134 3300053078 Bacteria 10926
248 Ga0495655_0010223 3300053083 Bacteria 1845
249 Ga0495655_0055044 3300053083 Unclassified 1066
250 Ga0495595_0000002 3300053084 Bacteria 445641
251 Ga0495595_0320096 3300053084 Bacteria 781
252 Ga0495619_0000008 3300053085 Bacteria 305999
253 Ga0495619_0000277 3300053085 Bacteria 36725
254 Ga0495619_0000776 3300053085 Bacteria 20883
255 Ga0495619_0093316 3300053085 Bacteria 2040
256 Ga0495619_0289784 3300053085 Bacteria 1134
257 Ga0495619_0395873 3300053085 Bacteria 954
258 Ga0495619_1179115 3300053085 Unclassified 508
259 Ga0501084_0201401 3300054114 Bacteria 1680
260 Ga0501082_0713810 3300060353 Bacteria 877
261 Ga0530510_0098556 3300061734 Bacteria 2137
262 Ga0081455_10340927
263 LJQas_1009188
264 JGI24743J22301_10086453
265 JGI25407J50210_10004026
266 JGI25407J50210_10104477
267 Ga0070683_100034927
268 Ga0070683_100062335
269 Ga0070683_100118607
270 Ga0070683_100122452
271 Ga0070683_100638485
272 Ga0070666_10120764
273 Ga0070682_100000171
274 Ga0070682_100628999
275 Ga0068868_100003306
276 Ga0070661_100000035
277 Ga0070668_100106891
278 Ga0070668_100150615
279 Ga0070675_100000377
280 Ga0070673_100000474
281 Ga0070673_100998967
282 Ga0070688_100000285
283 Ga0070659_100537339
284 Ga0070659_101621483
285 Ga0070714_100192236
286 Ga0070714_100777686
287 Ga0070713_100000380
288 Ga0070711_100073303
289 Ga0070678_100022681
290 Ga0070685_10000159
291 Ga0070684_100415345
292 Ga0070684_100711447
293 Ga0070697_101317385
294 Ga0068853_100401489
295 Ga0070672_100000006
296 Ga0070665_100169526
297 Ga0070664_100119123
298 Ga0068857_101040074
299 Ga0068854_100024981
300 Ga0068854_100906776
301 Ga0068856_100000925
302 Ga0068856_100077098
303 Ga0068856_100223944
304 Ga0068852_100006635
305 Ga0081455_10017592
306 Ga0081538_10000691
307 Ga0081538_10000894
308 Ga0081538_10009157
309 Ga0081540_1042483
310 Ga0081540_1284191
311 Ga0075365_10240920
312 Ga0075363_100520166
313 Ga0070712_100012842
314 Ga0070712_101621756
315 Ga0075367_10554581
316 Ga0075433_10622216
317 Ga0075434_100794369
318 Ga0068865_100001059
319 Ga0105251_10117569
320 Ga0111539_10118468
321 Ga0105245_10020367
322 Ga0105247_10103375
323 Ga0105243_10053717
324 Ga0105241_10150816
325 Ga0105241_10308971
326 Ga0105248_10001622
327 Ga0105239_10110448
328 Ga0157370_10159693
329 Ga0157370_10272610
330 Ga0157378_10154364
331 Ga0157378_10211031
332 Ga0157375_10373080
333 Ga0157375_11613584
334 Ga0163163_11796446
335 Ga0157380_10000445
336 Ga0197907_10034932
337 Ga0206356_10258878
338 Ga0206356_10394249
339 Ga0206349_1670028
340 Ga0206352_11286604
341 Ga0206354_10669761
342 Ga0206353_10298658
343 Ga0207656_10001648
344 Ga0207710_10066194
345 Ga0207680_10151375
346 Ga0207654_10075293
347 Ga0207693_10019603
348 Ga0207693_11222066
349 Ga0207663_10000487
350 Ga0207649_10000028
351 Ga0207650_10134382
352 Ga0207659_10000246
353 Ga0207687_10004445
354 Ga0207700_10000033
355 Ga0207664_10008515
356 Ga0207664_10237872
357 Ga0207690_11338343
358 Ga0207709_10105514
359 Ga0207704_10000103
360 Ga0207691_10000025
361 Ga0207711_10000006
362 Ga0207661_10009459
363 Ga0207661_10023059
364 Ga0207661_10030514
365 Ga0207661_10546403
366 Ga0207679_10170227
367 Ga0207679_10622914
368 Ga0207651_10000664
369 Ga0207668_10097771
370 Ga0207668_10448440
371 Ga0207640_10000551
372 Ga0207640_10365806
373 Ga0207677_10001888
374 Ga0207703_10000088
375 Ga0207639_10167634
376 Ga0207639_10250615
377 Ga0207702_10000242
378 Ga0207702_10022205
379 Ga0207702_10331452
380 Ga0207674_12020221
381 Ga0207683_10031904
382 Ga0207698_10000414
383 Ga0207698_10021589
384 Ga0207428_10065837
385 Ga0268266_10001578
386 Ga0268266_10118622
387 Ga0268266_10776017
388 Ga0265327_10034253
389 Ga0307408_100055850
390 Ga0307405_11717915
391 Ga0307413_10001669
392 Ga0307413_11089487
393 Ga0307410_10018720
394 Ga0307410_10057292
395 Ga0307406_10041822
396 Ga0307407_10180731
397 Ga0307412_10346637
398 Ga0307409_100038352
399 Ga0307409_100322874
400 Ga0307409_100468741
401 Ga0307409_100535452
402 Ga0307416_100003565
403 Ga0307416_100117860
404 Ga0307411_10340719
405 Ga0307415_100000715
406 Ga0307415_100003877
407 Ga0307415_100068677
408 Ga0307415_100129610
409 Ga0307415_100980965
410 Ga0373959_0085333
411 Ga0373932_0047254
412 Ga0373939_0043293
413 Ga0373953_0277012
414 Ga0373960_0031242
415 Ga0373931_0335039
416 Ga0373935_1500207
417 Ga0373933_0250790
418 Ga0373937_0007200
419 Ga0373937_0762918
420 Ga0451847_0360256
421 Ga0450888_006547
422 Ga0450900_065906
423 Ga0439460_0054825
424 Ga0466957_0005836
425 Ga0466959_0188528
426 Ga0466958_0345772
427 Ga0466958_0563766
428 Ga0466967_0000017
429 Ga0495592_0374079
430 Ga0495603_0000593
431 Ga0495629_0000999
432 Ga0495641_0030362
433 Ga0495651_0102313
434 Ga0495653_0787313
435 Ga0495605_0347133
436 Ga0495664_0000022
437 Ga0495664_0340220
438 Ga0495584_0137369
439 Ga0495585_0269797
440 Ga0495596_0083732
441 Ga0495606_0000108
442 Ga0495608_0000036
443 Ga0495608_0319078
444 Ga0495616_0091455
445 Ga0495628_0034129
446 Ga0495630_0000012
447 Ga0495637_0363069
448 Ga0495644_0146190
449 Ga0495652_0098666
450 Ga0495654_0264961
451 Ga0495665_0271595
452 Ga0495587_0250660
453 Ga0495635_0439666
454 Ga0495657_0000001
455 Ga0495647_0002790
456 Ga0495658_0032106
457 Ga0495658_0350455
458 Ga0495589_0043419
459 Ga0495600_0003292
460 Ga0495604_0028724
461 Ga0495674_0511362
462 Ga0495680_0811806
463 Ga0495675_0000515
464 Ga0495684_0458962
465 Ga0495684_0631185
466 Ga0496102_0000040
467 Ga0496103_0000067
468 Ga0496104_0000070
469 Ga0496105_0203798
470 Ga0496108_0000355
471 Ga0496108_0017846
472 Ga0496108_1082198
473 Ga0496109_0000400
474 Ga0496109_0000903
475 Ga0496109_0172674
476 Ga0496110_0000011
477 Ga0496110_0000653
478 Ga0496110_0002236
479 Ga0496110_0030839
480 Ga0496110_1082366
481 Ga0496111_0000444
482 Ga0496111_0004792
483 Ga0496111_0006159
484 Ga0496112_0268554
485 Ga0496113_0000283
486 Ga0501031_0665302
487 Ga0501036_0433462
488 Ga0501036_0475512
489 Ga0501037_0467697
490 Ga0501039_0510980
491 Ga0501040_0143896
492 Ga0501046_0306477
493 Ga0501068_0217617
494 Ga0501069_0247426
495 Ga0501071_0530513
496 Ga0501072_1047256
497 Ga0501076_0403471
498 Ga0501076_1049230
499 Ga0501045_0401405
500 nmdc:mga0yw44_356774_c1
501 nmdc:mga06z11_445255_c1
502 nmdc:mga0qj67_142777_c1
503 nmdc:mga06r32_135500_c1
504 nmdc:mga08y16_176756_c1
505 nmdc:mga0n895_104589_c1
506 Ga0495601_0014470
507 Ga0495601_0129450
508 Ga0495612_0001134
509 Ga0495655_0010223
510 Ga0495655_0055044
511 Ga0495595_0000002
512 Ga0495595_0320096
513 Ga0495619_0000008
514 Ga0495619_0000277
515 Ga0495619_0000776
516 Ga0495619_0093316
517 Ga0495619_0289784
518 Ga0495619_0395873
519 Ga0495619_1179115
520 Ga0501084_0201401
521 Ga0501082_0713810
522 Ga0530510_0098556

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07883

Cupin_2

Cupin domain

43

113

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ozj-assembly2.cif.gz_B-3 crystal structure of a cupin superfamily protein (dsy2733) from desulfitobacterium hafniense dcb-2 at 1.60 a resolution 0.9548 35 109
1o4t-assembly1.cif.gz_B crystal structure of a predicted oxalate decarboxylase (tm1287) from thermotoga maritima at 1.95 a resolution 0.9536 38 111
6o2d-assembly1.cif.gz_B schizosaccharomyces pombe cnp3 cupin domain 0.9446 35 111
8ch4-assembly1.cif.gz_C crystal structure of the ring cleaving dioxygenase 5-nitrosalicylate 1,2-dioxygenase from bradyrhizobium sp. 0.9383 38 110
7zyb-assembly1.cif.gz_A bekdgf with ca 0.9298 34 110
ID Description Score Start End Superfamily
af_A0A1D8PPZ7_421_512_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9585 35 111 2.60.120.10
1o4tB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9536 38 111 2.60.120.10
af_E7FAC3_1039_1126_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9503 35 112 2.60.120.10
af_Q9USR9_537_626_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.95 35 112 2.60.120.10
af_Q03188_852_942_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9437 35 112 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A522LBI6-F1-model_v4 Cupin domain-containing protein 0.9753 38 111
AF-A0A3A4JPZ0-F1-model_v4 Cupin domain-containing protein 0.975 38 111
AF-A0A150SF67-F1-model_v4 Cupin type-2 domain-containing protein 0.9639 36 111
AF-A0A6A6K265-F1-model_v4 Mif2/CENP-C cupin domain-containing protein 0.9637 36 111 GO:0000776
GO:0005634
GO:0019237
GO:0051315
GO:0051382
GO:0051455
AF-A0A7V1H515-F1-model_v4 Cupin domain-containing protein 0.9623 35 111

Map