F370208

General Info

Members Datasets Scaffolds Average Seq Length
261 177 522 308

Family's Representative Sequence

Representative Sequence 3300005546|Ga0070696_100119694|Ga0070696_1001196942
Length 337
Sequence MPSSRHSARSARAGPVAMAEAMFDRVSLIGLGLIGSSLAHAMRRKGLAKHIAGHARSEATRETAKRLKLTDSVHASAGEAVAGADLVILCVPVGACGPVAKDISSSLKSGAILTDVGSVKSAVLRDVAEHVPKSVHFIPGHPIAGTEQSGPESGFAELFDGRWCILTPPKGSDAAAIAKLEKFWQACGSQVEVMDAEHHDLVLAITSHLPHLIAYNIVGTAADLEQVTKSEVIKYSAGGFRDFTRIAASDPVMWRDVFLNNKDAVLEMLGRFSEDLSALQRAIRWSEGDTLISLFTRAREIRRGIIAAGQDTPAPDFGRHSADHQSGGSSPSLKGPR

Samples

Sample ID Description Type Environment
1 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
2 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
9 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
29 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
30 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
41 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
42 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
43 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
44 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
45 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
51 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
66 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
67 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
68 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
69 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
70 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
91 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
92 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
95 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
96 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
97 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
98 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
99 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
100 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
101 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
102 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
103 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
104 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
105 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
106 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
107 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
108 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
109 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
110 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
111 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
112 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
113 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
114 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
115 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
116 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
117 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
118 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
119 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
120 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
121 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
122 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
123 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
124 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
125 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
126 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
127 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
128 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
129 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
130 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
131 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
132 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
133 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
134 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
145 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
146 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
147 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
148 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
149 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
150 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
151 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
152 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
153 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
154 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
155 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
156 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
157 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
160 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
161 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
162 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
163 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
164 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
165 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
166 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
167 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
168 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
169 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
170 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
171 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
172 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
173 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
174 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
175 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
176 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
177 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.62
Metatranscriptomes 0
Isolates 0.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.43
Nodule 0
Rhizoplane 9.96
Rhizosphere 79.69
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070696_100119694 3300005546 Bacteria 1904
2 Ga0068869_100141494 3300005334 Bacteria 1858
3 Ga0070680_100030701 3300005336 Bacteria 4318
4 Ga0070682_100016312 3300005337 Bacteria 4317
5 Ga0070660_100004929 3300005339 Bacteria 9233
6 Ga0070691_10079418 3300005341 Bacteria 1604
7 Ga0070687_100017844 3300005343 Bacteria 3273
8 Ga0070687_100089656 3300005343 Bacteria 1698
9 Ga0070673_100126365 3300005364 Bacteria 2140
10 Ga0070688_100252993 3300005365 Bacteria 1255
11 Ga0070659_100015229 3300005366 Bacteria 5756
12 Ga0070667_100166033 3300005367 Bacteria 1947
13 Ga0070703_10000502 3300005406 Bacteria 15266
14 Ga0070714_100015380 3300005435 Bacteria 6158
15 Ga0070705_100000344 3300005440 Bacteria 27454
16 Ga0070705_100057573 3300005440 Bacteria 2293
17 Ga0070700_100003040 3300005441 Bacteria 8597
18 Ga0070694_100000269 3300005444 Bacteria 27454
19 Ga0070694_100079708 3300005444 Bacteria 2274
20 Ga0070708_100008890 3300005445 Bacteria 8088
21 Ga0070663_100002672 3300005455 Bacteria 10097
22 Ga0070678_100049022 3300005456 Bacteria 3046
23 Ga0070681_10018053 3300005458 Bacteria 7049
24 Ga0070681_10024777 3300005458 Bacteria 6036
25 Ga0068867_100369976 3300005459 Bacteria 1201
26 Ga0070706_100048346 3300005467 Bacteria 3926
27 Ga0070698_100202752 3300005471 Bacteria 1919
28 Ga0070699_100000920 3300005518 Bacteria 27447
29 Ga0070679_100025141 3300005530 Bacteria 5841
30 Ga0070679_100025199 3300005530 Bacteria 5834
31 Ga0070679_100025425 3300005530 Bacteria 5811
32 Ga0070697_100046766 3300005536 Bacteria 3508
33 Ga0068853_100001911 3300005539 Bacteria 15346
34 Ga0070695_100016304 3300005545 Bacteria 4495
35 Ga0070696_100000923 3300005546 Bacteria 19072
36 Ga0070696_100002341 3300005546 Bacteria 12510
37 Ga0070693_100003506 3300005547 Bacteria 7323
38 Ga0070693_100007259 3300005547 Bacteria 5410
39 Ga0070704_100002177 3300005549 Bacteria 10905
40 Ga0068855_100198601 3300005563 Bacteria 2259
41 Ga0068857_100069228 3300005577 Bacteria 3142
42 Ga0070702_100035293 3300005615 Bacteria 2762
43 Ga0068859_100071718 3300005617 Bacteria 3500
44 Ga0068861_100045474 3300005719 Bacteria 3306
45 Ga0068870_10146634 3300005840 Bacteria 1386
46 Ga0068858_100023129 3300005842 Bacteria 5797
47 Ga0068860_100007862 3300005843 Bacteria 10645
48 Ga0068860_100541170 3300005843 Bacteria 1166
49 Ga0068862_100000951 3300005844 Bacteria 27863
50 Ga0068862_100106291 3300005844 Bacteria 2460
51 Ga0081540_1002283 3300005983 Bacteria 15742
52 Ga0075365_10077686 3300006038 Bacteria 2243
53 Ga0075368_10001572 3300006042 Bacteria 7340
54 Ga0075368_10017039 3300006042 Bacteria 2714
55 Ga0075363_100001993 3300006048 Bacteria 8128
56 Ga0075363_100118812 3300006048 Bacteria 1475
57 Ga0075364_10001284 3300006051 Bacteria 13526
58 Ga0075367_10002780 3300006178 Bacteria 8105
59 Ga0075367_10003101 3300006178 Bacteria 7812
60 Ga0075367_10008407 3300006178 Bacteria 5347
61 Ga0068871_100091087 3300006358 Bacteria 2541
62 Ga0075428_100089316 3300006844 Bacteria 3361
63 Ga0075430_100007646 3300006846 Bacteria 9129
64 Ga0075431_100008005 3300006847 Bacteria 10544
65 Ga0075431_100025466 3300006847 Bacteria 6063
66 Ga0075431_100035047 3300006847 Bacteria 5170
67 Ga0075431_100063749 3300006847 Bacteria 3803
68 Ga0075433_10183318 3300006852 Bacteria 1863
69 Ga0075429_100032197 3300006880 Bacteria 4557
70 Ga0075429_100037014 3300006880 Bacteria 4247
71 Ga0097620_100071718 3300006931 Bacteria 3500
72 Ga0105240_10042804 3300009093 Bacteria 5769
73 Ga0111539_10004305 3300009094 Bacteria 18620
74 Ga0111539_10127335 3300009094 Bacteria 2983
75 Ga0105245_10405316 3300009098 Bacteria 1364
76 Ga0114129_10040861 3300009147 Bacteria 6537
77 Ga0105243_10235351 3300009148 Bacteria 1627
78 Ga0105237_10050486 3300009545 Bacteria 4180
79 Ga0105238_10011729 3300009551 Bacteria 8834
80 Ga0105249_10000972 3300009553 Bacteria 25403
81 Ga0105239_10101689 3300010375 Bacteria 3180
82 Ga0105239_10628064 3300010375 Bacteria 1226
83 Ga0157369_10138599 3300013105 Bacteria 2575
84 Ga0157372_10014748 3300013307 Bacteria 8365
85 Ga0157372_10510598 3300013307 Bacteria 1401
86 Ga0157375_10060021 3300013308 Bacteria 3770
87 Ga0157380_10124105 3300014326 Bacteria 2192
88 Ga0157380_10512809 3300014326 Bacteria 1168
89 Ga0157379_10048427 3300014968 Bacteria 3793
90 Ga0157376_10111170 3300014969 Bacteria 2412
91 Ga0157376_10352782 3300014969 Bacteria 1408
92 Ga0213872_10053604 3300021361 Bacteria 1829
93 Ga0213876_10000146 3300021384 Bacteria 76106
94 Ga0213876_10000322 3300021384 Bacteria 41914
95 Ga0207684_10041519 3300025910 Bacteria 3900
96 Ga0207707_10037269 3300025912 Bacteria 4249
97 Ga0207695_10032367 3300025913 Bacteria 5723
98 Ga0207660_10001204 3300025917 Bacteria 17319
99 Ga0207660_10015459 3300025917 Bacteria 5039
100 Ga0207662_10021640 3300025918 Bacteria 3679
101 Ga0207662_10316424 3300025918 Bacteria 1041
102 Ga0207657_10061174 3300025919 Bacteria 3230
103 Ga0207652_10010665 3300025921 Bacteria 7401
104 Ga0207652_10015643 3300025921 Bacteria 6176
105 Ga0207687_10282932 3300025927 Bacteria 1330
106 Ga0207664_10117517 3300025929 Bacteria 2220
107 Ga0207690_10073983 3300025932 Bacteria 2358
108 Ga0207689_10090379 3300025942 Bacteria 2516
109 Ga0207667_10170582 3300025949 Bacteria 2236
110 Ga0207712_10010400 3300025961 Bacteria 5907
111 Ga0207703_10061756 3300026035 Bacteria 3068
112 Ga0207639_10001440 3300026041 Bacteria 16044
113 Ga0207678_10000115 3300026067 Bacteria 66130
114 Ga0207678_10011271 3300026067 Bacteria 7848
115 Ga0207708_10001591 3300026075 Bacteria 16962
116 Ga0207674_10003284 3300026116 Bacteria 19891
117 Ga0207675_100101225 3300026118 Bacteria 2714
118 Ga0207675_100550746 3300026118 Bacteria 1152
119 Ga0207698_10192659 3300026142 Bacteria 1818
120 Ga0209813_10002291 3300027866 Bacteria 4376
121 Ga0209813_10002507 3300027866 Bacteria 4203
122 Ga0207428_10042205 3300027907 Bacteria 3689
123 Ga0268265_10004866 3300028380 Bacteria 9256
124 Ga0268265_10121207 3300028380 Bacteria 2155
125 Ga0268264_10012722 3300028381 Bacteria 6924
126 Ga0268264_10477081 3300028381 Bacteria 1213
127 Ga0265338_10032289 3300028800 Bacteria 5111
128 Ga0265332_10028897 3300031238 Bacteria 2425
129 Ga0265332_10054653 3300031238 Bacteria 1713
130 Ga0265325_10003315 3300031241 Bacteria 10585
131 Ga0265340_10004124 3300031247 Bacteria 8158
132 Ga0265340_10019348 3300031247 Bacteria 3506
133 Ga0265316_10263771 3300031344 Bacteria 1262
134 Ga0265314_10000624 3300031711 Bacteria 43582
135 Ga0373934_0103429 3300035086 Bacteria 1152
136 Ga0373943_0004763 3300035170 Bacteria 6137
137 Ga0373943_0068140 3300035170 Bacteria 1796
138 Ga0373935_0007068 3300035692 Bacteria 6701
139 Ga0373933_0083394 3300035724 Bacteria 1963
140 Ga0373947_0145411 3300035725 Bacteria 1524
141 Ga0373947_0262491 3300035725 Bacteria 1145
142 Ga0373937_0017256 3300036401 Bacteria 6427
143 Ga0373937_0030740 3300036401 Bacteria 4864
144 Ga0373925_0012236 3300037068 Bacteria 6208
145 Ga0373925_0201525 3300037068 Bacteria 1583
146 Ga0395899_0056547 3300037312 Bacteria 2899
147 Ga0395900_0085573 3300037418 Bacteria 3240
148 Ga0400485_01313 3300038735 Bacteria 2480
149 Ga0400486_01785 3300038742 Bacteria 1508
150 Ga0436365_0947350 3300039437 Bacteria 45208
151 Ga0436360_0928144 3300039438 Bacteria 1729
152 Ga0436361_0697950 3300039447 Bacteria 11818
153 Ga0439451_023878 3300042009 Bacteria 1232
154 Ga0439459_0032663 3300042438 Bacteria 1068
155 Ga0495582_0003692 3300046473 Bacteria 8619
156 Ga0495652_0119122 3300046529 Bacteria 2109
157 Ga0495600_0247229 3300046809 Bacteria 1135
158 Ga0496100_0127322 3300048903 Bacteria 1789
159 Ga0496100_0217198 3300048903 Bacteria 1402
160 Ga0496101_0116456 3300048904 Bacteria 2016
161 Ga0496102_0022125 3300048905 Bacteria 5632
162 Ga0496102_0241442 3300048905 Bacteria 1703
163 Ga0496103_0012603 3300048906 Bacteria 5014
164 Ga0496104_0000318 3300048907 Bacteria 42800
165 Ga0496104_0137112 3300048907 Bacteria 2351
166 Ga0496105_0010431 3300048908 Bacteria 7308
167 Ga0496105_0149384 3300048908 Bacteria 1921
168 Ga0496106_0001185 3300048909 Bacteria 19446
169 Ga0496106_0009802 3300048909 Bacteria 7076
170 Ga0496107_0149052 3300048910 Bacteria 1730
171 Ga0496108_0000579 3300048911 Bacteria 28604
172 Ga0496108_0038555 3300048911 Bacteria 3981
173 Ga0496108_0148635 3300048911 Bacteria 2021
174 Ga0496109_0025246 3300048912 Bacteria 5293
175 Ga0496109_0026571 3300048912 Bacteria 5163
176 Ga0496110_0013972 3300048913 Bacteria 6652
177 Ga0496111_0063818 3300048914 Bacteria 2671
178 Ga0496111_0063921 3300048914 Bacteria 2669
179 Ga0496112_0236310 3300048915 Bacteria 1781
180 Ga0496113_0003472 3300048916 Bacteria 9440
181 Ga0496113_0070388 3300048916 Bacteria 2659
182 Ga0496115_0014834 3300048918 Bacteria 5910
183 Ga0496115_0488079 3300048918 Bacteria 991
184 Ga0501034_0378217 3300049571 Bacteria 1341
185 Ga0501036_0226359 3300049572 Bacteria 1570
186 Ga0501038_0007324 3300049574 Bacteria 10180
187 Ga0501039_0208228 3300049575 Bacteria 1538
188 Ga0501039_0285930 3300049575 Bacteria 1296
189 Ga0501040_0038405 3300049576 Bacteria 3255
190 Ga0501040_0085348 3300049576 Bacteria 2191
191 Ga0501040_0340340 3300049576 Bacteria 1074
192 Ga0501042_0145840 3300049578 Bacteria 1707
193 Ga0501043_0161742 3300049579 Bacteria 1749
194 Ga0501046_0000058 3300049580 Bacteria 127462
195 Ga0501046_0077663 3300049580 Bacteria 2570
196 Ga0501047_0127631 3300049581 Bacteria 2423
197 Ga0501048_0128604 3300049582 Bacteria 1791
198 Ga0501067_0011252 3300049583 Bacteria 4952
199 Ga0501070_0000014 3300049586 Bacteria 180454
200 Ga0501070_0007600 3300049586 Bacteria 9206
201 Ga0501071_0043694 3300049587 Bacteria 3214
202 Ga0501072_0024387 3300049588 Bacteria 4705
203 Ga0501073_0014345 3300049589 Bacteria 5756
204 Ga0501073_0085191 3300049589 Bacteria 2199
205 Ga0501074_0111805 3300049590 Bacteria 1954
206 Ga0501075_0024255 3300049591 Bacteria 4445
207 Ga0501075_0095960 3300049591 Bacteria 2250
208 Ga0501076_0002486 3300049592 Bacteria 12675
209 Ga0501076_0276132 3300049592 Bacteria 1376
210 Ga0501077_0059868 3300049593 Bacteria 2417
211 Ga0501079_0026156 3300049741 Bacteria 4475
212 Ga0501079_0134469 3300049741 Bacteria 1925
213 Ga0501080_0001192 3300049742 Bacteria 21558
214 Ga0501080_0047139 3300049742 Bacteria 4012
215 Ga0501080_0081811 3300049742 Bacteria 3000
216 Ga0501081_0007338 3300049743 Bacteria 7156
217 Ga0501081_0091527 3300049743 Bacteria 2139
218 Ga0501081_0169666 3300049743 Bacteria 1575
219 Ga0501083_0019574 3300049744 Bacteria 4714
220 Ga0501035_0000876 3300049822 Bacteria 31978
221 Ga0501035_0169819 3300049822 Bacteria 1885
222 Ga0501044_0011090 3300049823 Bacteria 9776
223 Ga0501044_0012854 3300049823 Bacteria 9062
224 Ga0501044_0014534 3300049823 Bacteria 8492
225 Ga0501045_0085480 3300049824 Bacteria 2328
226 nmdc:mga03n38_10770_c1 3300050490 Bacteria 3380
227 nmdc:mga03n38_1617_c1 3300050490 Bacteria 6577
228 nmdc:mga00v17_4644_c1 3300050491 Bacteria 7165
229 nmdc:mga0yw44_17466_c1 3300050492 Bacteria 3904
230 nmdc:mga06z11_200_c1 3300050494 Bacteria 23961
231 nmdc:mga06z11_257_c1 3300050494 Bacteria 20706
232 nmdc:mga06z11_62692_c1 3300050494 Bacteria 1943
233 nmdc:mga04h51_2489_c1 3300050495 Bacteria 4376
234 nmdc:mga04h51_685_c1 3300050495 Bacteria 7875
235 nmdc:mga05p37_528992_c1 3300050507 Bacteria 1347
236 nmdc:mga09592_12447_c1 3300050508 Bacteria 6931
237 nmdc:mga0qj67_112747_c1 3300050509 Bacteria 2195
238 nmdc:mga0qj67_6784_c1 3300050509 Bacteria 8417
239 nmdc:mga06r32_113568_c1 3300050510 Bacteria 2666
240 nmdc:mga06r32_37192_c1 3300050510 Bacteria 4605
241 nmdc:mga06r32_45839_c1 3300050510 Bacteria 4170
242 nmdc:mga06r32_57439_c1 3300050510 Bacteria 3738
243 nmdc:mga06r32_9264_c1 3300050510 Bacteria 8874
244 nmdc:mga08y16_13430_c1 3300050511 Bacteria 8618
245 nmdc:mga08y16_37933_c1 3300050511 Bacteria 5059
246 nmdc:mga08y16_73057_c1 3300050511 Bacteria 3574
247 nmdc:mga0n895_209005_c1 3300050512 Bacteria 1982
248 Ga0495619_0274834 3300053085 Bacteria 1167
249 Ga0500583_0098789 3300053092 Bacteria 1428
250 Ga0500616_0036941 3300053153 Bacteria 2647
251 Ga0501084_0000033 3300054114 Bacteria 114778
252 Ga0501084_0010184 3300054114 Bacteria 7774
253 Ga0501084_0028380 3300054114 Bacteria 4677
254 Ga0501084_0073926 3300054114 Bacteria 2854
255 Ga0501084_0083580 3300054114 Bacteria 2680
256 Ga0501084_0367222 3300054114 Bacteria 1216
257 Ga0501082_0173778 3300060353 Bacteria 1873
258 Ga0501082_0198449 3300060353 Bacteria 1745
259 Ga0501082_0401373 3300060353 Bacteria 1196
260 Ga0530510_0059032 3300061734 Bacteria 2774
261 2883296589 2883291878 Bacteria 5894118
262 Ga0070696_100119694
263 Ga0068869_100141494
264 Ga0070680_100030701
265 Ga0070682_100016312
266 Ga0070660_100004929
267 Ga0070691_10079418
268 Ga0070687_100017844
269 Ga0070687_100089656
270 Ga0070673_100126365
271 Ga0070688_100252993
272 Ga0070659_100015229
273 Ga0070667_100166033
274 Ga0070703_10000502
275 Ga0070714_100015380
276 Ga0070705_100000344
277 Ga0070705_100057573
278 Ga0070700_100003040
279 Ga0070694_100000269
280 Ga0070694_100079708
281 Ga0070708_100008890
282 Ga0070663_100002672
283 Ga0070678_100049022
284 Ga0070681_10018053
285 Ga0070681_10024777
286 Ga0068867_100369976
287 Ga0070706_100048346
288 Ga0070698_100202752
289 Ga0070699_100000920
290 Ga0070679_100025141
291 Ga0070679_100025199
292 Ga0070679_100025425
293 Ga0070697_100046766
294 Ga0068853_100001911
295 Ga0070695_100016304
296 Ga0070696_100000923
297 Ga0070696_100002341
298 Ga0070693_100003506
299 Ga0070693_100007259
300 Ga0070704_100002177
301 Ga0068855_100198601
302 Ga0068857_100069228
303 Ga0070702_100035293
304 Ga0068859_100071718
305 Ga0068861_100045474
306 Ga0068870_10146634
307 Ga0068858_100023129
308 Ga0068860_100007862
309 Ga0068860_100541170
310 Ga0068862_100000951
311 Ga0068862_100106291
312 Ga0081540_1002283
313 Ga0075365_10077686
314 Ga0075368_10001572
315 Ga0075368_10017039
316 Ga0075363_100001993
317 Ga0075363_100118812
318 Ga0075364_10001284
319 Ga0075367_10002780
320 Ga0075367_10003101
321 Ga0075367_10008407
322 Ga0068871_100091087
323 Ga0075428_100089316
324 Ga0075430_100007646
325 Ga0075431_100008005
326 Ga0075431_100025466
327 Ga0075431_100035047
328 Ga0075431_100063749
329 Ga0075433_10183318
330 Ga0075429_100032197
331 Ga0075429_100037014
332 Ga0097620_100071718
333 Ga0105240_10042804
334 Ga0111539_10004305
335 Ga0111539_10127335
336 Ga0105245_10405316
337 Ga0114129_10040861
338 Ga0105243_10235351
339 Ga0105237_10050486
340 Ga0105238_10011729
341 Ga0105249_10000972
342 Ga0105239_10101689
343 Ga0105239_10628064
344 Ga0157369_10138599
345 Ga0157372_10014748
346 Ga0157372_10510598
347 Ga0157375_10060021
348 Ga0157380_10124105
349 Ga0157380_10512809
350 Ga0157379_10048427
351 Ga0157376_10111170
352 Ga0157376_10352782
353 Ga0213872_10053604
354 Ga0213876_10000146
355 Ga0213876_10000322
356 Ga0207684_10041519
357 Ga0207707_10037269
358 Ga0207695_10032367
359 Ga0207660_10001204
360 Ga0207660_10015459
361 Ga0207662_10021640
362 Ga0207662_10316424
363 Ga0207657_10061174
364 Ga0207652_10010665
365 Ga0207652_10015643
366 Ga0207687_10282932
367 Ga0207664_10117517
368 Ga0207690_10073983
369 Ga0207689_10090379
370 Ga0207667_10170582
371 Ga0207712_10010400
372 Ga0207703_10061756
373 Ga0207639_10001440
374 Ga0207678_10000115
375 Ga0207678_10011271
376 Ga0207708_10001591
377 Ga0207674_10003284
378 Ga0207675_100101225
379 Ga0207675_100550746
380 Ga0207698_10192659
381 Ga0209813_10002291
382 Ga0209813_10002507
383 Ga0207428_10042205
384 Ga0268265_10004866
385 Ga0268265_10121207
386 Ga0268264_10012722
387 Ga0268264_10477081
388 Ga0265338_10032289
389 Ga0265332_10028897
390 Ga0265332_10054653
391 Ga0265325_10003315
392 Ga0265340_10004124
393 Ga0265340_10019348
394 Ga0265316_10263771
395 Ga0265314_10000624
396 Ga0373934_0103429
397 Ga0373943_0004763
398 Ga0373943_0068140
399 Ga0373935_0007068
400 Ga0373933_0083394
401 Ga0373947_0145411
402 Ga0373947_0262491
403 Ga0373937_0017256
404 Ga0373937_0030740
405 Ga0373925_0012236
406 Ga0373925_0201525
407 Ga0395899_0056547
408 Ga0395900_0085573
409 Ga0400485_01313
410 Ga0400486_01785
411 Ga0436365_0947350
412 Ga0436360_0928144
413 Ga0436361_0697950
414 Ga0439451_023878
415 Ga0439459_0032663
416 Ga0495582_0003692
417 Ga0495652_0119122
418 Ga0495600_0247229
419 Ga0496100_0127322
420 Ga0496100_0217198
421 Ga0496101_0116456
422 Ga0496102_0022125
423 Ga0496102_0241442
424 Ga0496103_0012603
425 Ga0496104_0000318
426 Ga0496104_0137112
427 Ga0496105_0010431
428 Ga0496105_0149384
429 Ga0496106_0001185
430 Ga0496106_0009802
431 Ga0496107_0149052
432 Ga0496108_0000579
433 Ga0496108_0038555
434 Ga0496108_0148635
435 Ga0496109_0025246
436 Ga0496109_0026571
437 Ga0496110_0013972
438 Ga0496111_0063818
439 Ga0496111_0063921
440 Ga0496112_0236310
441 Ga0496113_0003472
442 Ga0496113_0070388
443 Ga0496115_0014834
444 Ga0496115_0488079
445 Ga0501034_0378217
446 Ga0501036_0226359
447 Ga0501038_0007324
448 Ga0501039_0208228
449 Ga0501039_0285930
450 Ga0501040_0038405
451 Ga0501040_0085348
452 Ga0501040_0340340
453 Ga0501042_0145840
454 Ga0501043_0161742
455 Ga0501046_0000058
456 Ga0501046_0077663
457 Ga0501047_0127631
458 Ga0501048_0128604
459 Ga0501067_0011252
460 Ga0501070_0000014
461 Ga0501070_0007600
462 Ga0501071_0043694
463 Ga0501072_0024387
464 Ga0501073_0014345
465 Ga0501073_0085191
466 Ga0501074_0111805
467 Ga0501075_0024255
468 Ga0501075_0095960
469 Ga0501076_0002486
470 Ga0501076_0276132
471 Ga0501077_0059868
472 Ga0501079_0026156
473 Ga0501079_0134469
474 Ga0501080_0001192
475 Ga0501080_0047139
476 Ga0501080_0081811
477 Ga0501081_0007338
478 Ga0501081_0091527
479 Ga0501081_0169666
480 Ga0501083_0019574
481 Ga0501035_0000876
482 Ga0501035_0169819
483 Ga0501044_0011090
484 Ga0501044_0012854
485 Ga0501044_0014534
486 Ga0501045_0085480
487 nmdc:mga03n38_10770_c1
488 nmdc:mga03n38_1617_c1
489 nmdc:mga00v17_4644_c1
490 nmdc:mga0yw44_17466_c1
491 nmdc:mga06z11_200_c1
492 nmdc:mga06z11_257_c1
493 nmdc:mga06z11_62692_c1
494 nmdc:mga04h51_2489_c1
495 nmdc:mga04h51_685_c1
496 nmdc:mga05p37_528992_c1
497 nmdc:mga09592_12447_c1
498 nmdc:mga0qj67_112747_c1
499 nmdc:mga0qj67_6784_c1
500 nmdc:mga06r32_113568_c1
501 nmdc:mga06r32_37192_c1
502 nmdc:mga06r32_45839_c1
503 nmdc:mga06r32_57439_c1
504 nmdc:mga06r32_9264_c1
505 nmdc:mga08y16_13430_c1
506 nmdc:mga08y16_37933_c1
507 nmdc:mga08y16_73057_c1
508 nmdc:mga0n895_209005_c1
509 Ga0495619_0274834
510 Ga0500583_0098789
511 Ga0500616_0036941
512 Ga0501084_0000033
513 Ga0501084_0010184
514 Ga0501084_0028380
515 Ga0501084_0073926
516 Ga0501084_0083580
517 Ga0501084_0367222
518 Ga0501082_0173778
519 Ga0501082_0198449
520 Ga0501082_0401373
521 Ga0530510_0059032
522 2883296589

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02153

PDH_N

Prephenate dehydrogenase, nucleotide-binding domain

38

193

0.98

PF20463

PDH_C

Prephenate dehydrogenase, dimerization domain

195

297

0.95

PF03807

F420_oxidored

NADP oxidoreductase coenzyme F420-dependent

25

118

0.85

PF10727

Rossmann-like

Rossmann-like domain

14

137

0.84

PF03446

NAD_binding_2

NAD binding domain of 6-phosphogluconate dehydrogenase

25

161

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
4wji-assembly1.cif.gz_A-2 crystal structure of cyclohexadienyl dehydrogenase from sinorhizobium meliloti in complex with nadp and tyrosine 0.9407 12 302
4wji-assembly1.cif.gz_A-2 crystal structure of cyclohexadienyl dehydrogenase from sinorhizobium meliloti in complex with nadp and tyrosine 0.9314 12 302
3ggp-assembly2.cif.gz_D crystal structure of prephenate dehydrogenase from a. aeolicus in complex with hydroxyphenyl propionate and nad+ 0.921 14 295
7mqv-assembly1.cif.gz_B crystal structure of truncated (act domain removed) prephenate dehydrogenase tyra from bacillus anthracis in complex with nad 0.9174 14 293
3dzb-assembly1.cif.gz_A crystal structure of prephenate dehydrogenase from streptococcus thermophilus 0.9134 14 295
ID Description Score Start End Superfamily
af_Q2FYS1_177_282_1.10.3660.10 Mainly Alpha;Orthogonal Bundle;6-phosphogluconate dehydrogenase C-terminal fold;6-phosphogluconate dehydrogenase C-terminal like domain 0.9321 189 293 1.10.3660.10
3gggD02 Mainly Alpha;Orthogonal Bundle;6-phosphogluconate dehydrogenase C-terminal fold;6-phosphogluconate dehydrogenase C-terminal like domain 0.9116 185 294 1.10.3660.10
3ggoD02 Mainly Alpha;Orthogonal Bundle;6-phosphogluconate dehydrogenase C-terminal fold;6-phosphogluconate dehydrogenase C-terminal like domain 0.9114 185 292 1.10.3660.10
3ggpC02 Mainly Alpha;Orthogonal Bundle;6-phosphogluconate dehydrogenase C-terminal fold;6-phosphogluconate dehydrogenase C-terminal like domain 0.9095 185 289 1.10.3660.10
2f1kD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9091 15 184 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A257QIA3-F1-model_v4 Cyclohexadienyl dehydrogenase 0.9777 9 101 GO:0004665
GO:0006571
GO:0008977
GO:0070403
AF-A0A0F9GBZ0-F1-model_v4 Prephenate/arogenate dehydrogenase domain-containing protein 0.9724 11 135 GO:0004665
GO:0006571
GO:0008977
GO:0070403
AF-A0A7Y3IWP4-F1-model_v4 Prephenate dehydrogenase/arogenate dehydrogenase family protein 0.9666 12 117 GO:0004665
GO:0006571
GO:0008977
GO:0070403
AF-A0A2E1KVZ6-F1-model_v4 Prephenate/arogenate dehydrogenase domain-containing protein 0.9665 13 120 GO:0004665
GO:0006571
GO:0008977
GO:0070403
AF-A0A2E8SRA7-F1-model_v4 Cyclohexadienyl dehydrogenase (EC 1.3.1.12) 0.9653 13 121 GO:0004665
GO:0006571
GO:0008977
GO:0070403

Map