F369898

General Info

Members Datasets Scaffolds Average Seq Length
260 172 520 167

Family's Representative Sequence

Representative Sequence 3300049587|Ga0501071_0401575|Ga0501071_0401575_35_592
Length 185
Sequence VGSDFDARGDTGFDATLGTEFGAEFDDLLAANRKFAETFALAGFDGVAHRGVALVTCMDSRIDPLGMLGLEPGDAKIFRNPGGRITSAAVDALVLGVHLLGVERILVVPHTRCAMATSSEAELRDQVTEASGQDAGWTRWQVVPDQEAALFDDVARIKAHPLIPDRVAVGGFMYDVDTGLLTRLT

Samples

Sample ID Description Type Environment
1 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
7 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
42 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
43 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
44 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
45 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
61 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
62 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
63 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
64 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
65 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
101 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
103 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
104 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
105 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
106 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
107 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
108 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
109 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
110 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
111 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
112 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
113 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
114 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
115 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
116 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
117 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
118 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
119 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
120 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
121 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
122 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
123 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
124 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
125 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
127 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
137 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
138 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
139 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
140 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
141 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
142 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
143 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
144 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
145 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
146 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
147 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
148 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
149 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
152 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
153 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
154 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
155 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
156 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
157 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
158 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
159 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
160 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
161 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
162 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
163 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
164 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
165 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
166 2643221576 Nocardioides sp. Root614 Isolate Unclassified
167 2643221590 Nocardioides sp. Root682 Isolate Unclassified
168 2643221604 Nocardioides sp. Root190 Isolate Unclassified
169 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
170 2739367898 Nocardioides sp. CF479 Isolate Unclassified
171 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
172 3001889506 Janibacter sp. YIM B02568 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95
Metatranscriptomes 2.31
Isolates 2.69

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.15
Nodule 0
Rhizoplane 4.62
Rhizosphere 86.92
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501071_0401575 3300049587 Bacteria 1046
2 JGI24743J22301_10026156 3300001991 Bacteria 1134
3 JGI24735J21928_10067230 3300002067 Bacteria 1028
4 JGI24750J21931_1042247 3300002070 Bacteria 695
5 JGI24738J21930_10007742 3300002075 Bacteria 2466
6 JGI24744J21845_10001073 3300002077 Bacteria 5287
7 JGI24033J26618_1006394 3300002155 Bacteria 1320
8 Ga0070658_10007152 3300005327 Bacteria 9014
9 Ga0070658_10011684 3300005327 Bacteria 7043
10 Ga0070658_10149638 3300005327 Bacteria 1954
11 Ga0070658_10651123 3300005327 Bacteria 914
12 Ga0070683_100008509 3300005329 Bacteria 8718
13 Ga0070683_100154830 3300005329 Bacteria 2174
14 Ga0070683_100398280 3300005329 Bacteria 1313
15 Ga0070683_100583012 3300005329 Bacteria 1070
16 Ga0070683_101026594 3300005329 Bacteria 792
17 Ga0070670_100080629 3300005331 Bacteria 2797
18 Ga0070680_100000530 3300005336 Bacteria 26042
19 Ga0070680_100606434 3300005336 Bacteria 940
20 Ga0068868_100032672 3300005338 Bacteria 4005
21 Ga0070660_100064788 3300005339 Bacteria 2844
22 Ga0070660_100348185 3300005339 Bacteria 1220
23 Ga0070689_100730982 3300005340 Bacteria 866
24 Ga0070689_100901680 3300005340 Bacteria 782
25 Ga0070691_10061267 3300005341 Bacteria 1810
26 Ga0070692_10063815 3300005345 Bacteria 1947
27 Ga0070692_10514669 3300005345 Bacteria 778
28 Ga0070668_100188987 3300005347 Bacteria 1686
29 Ga0070675_100117953 3300005354 Bacteria 2253
30 Ga0070674_100022693 3300005356 Bacteria 4050
31 Ga0070673_100214362 3300005364 Bacteria 1664
32 Ga0070659_100075710 3300005366 Bacteria 2683
33 Ga0070659_100151540 3300005366 Bacteria 1892
34 Ga0070667_100731929 3300005367 Bacteria 916
35 Ga0070667_100732292 3300005367 Bacteria 916
36 Ga0070714_100002773 3300005435 Bacteria 12909
37 Ga0070701_10001989 3300005438 Bacteria 7750
38 Ga0070678_100726044 3300005456 Bacteria 897
39 Ga0070681_10000101 3300005458 Bacteria 63429
40 Ga0070681_10480274 3300005458 Bacteria 1155
41 Ga0068867_100004889 3300005459 Bacteria 9431
42 Ga0070685_10107367 3300005466 Bacteria 1714
43 Ga0070679_100030253 3300005530 Bacteria 5345
44 Ga0070679_100572362 3300005530 Bacteria 1073
45 Ga0070684_100003875 3300005535 Bacteria 11322
46 Ga0070684_100014929 3300005535 Bacteria 6305
47 Ga0070684_100034921 3300005535 Bacteria 4301
48 Ga0070684_100422136 3300005535 Bacteria 1231
49 Ga0070672_100001684 3300005543 Bacteria 13785
50 Ga0068855_100304010 3300005563 Bacteria 1766
51 Ga0068857_100217727 3300005577 Bacteria 1743
52 Ga0068857_100245238 3300005577 Bacteria 1641
53 Ga0070702_100006418 3300005615 Bacteria 5565
54 Ga0068852_100008268 3300005616 Bacteria 7656
55 Ga0068864_100209414 3300005618 Bacteria 1795
56 Ga0068866_10086570 3300005718 Bacteria 1696
57 Ga0068861_100007730 3300005719 Bacteria 7383
58 Ga0068870_10090752 3300005840 Bacteria 1708
59 Ga0068862_100232922 3300005844 Bacteria 1672
60 Ga0075365_10011900 3300006038 Bacteria 5138
61 Ga0075363_100014330 3300006048 Bacteria 3870
62 Ga0075363_100019774 3300006048 Bacteria 3370
63 Ga0075363_100027925 3300006048 Bacteria 2898
64 Ga0075364_10434138 3300006051 Bacteria 897
65 Ga0075370_10084150 3300006353 Bacteria 1831
66 Ga0075428_100760588 3300006844 Bacteria 1031
67 Ga0068865_100098388 3300006881 Bacteria 2137
68 Ga0105240_10123465 3300009093 Bacteria 3115
69 Ga0111539_10493644 3300009094 Bacteria 1426
70 Ga0105245_10016311 3300009098 Bacteria 6477
71 Ga0105243_10048775 3300009148 Bacteria 3339
72 Ga0105242_10165364 3300009176 Bacteria 1940
73 Ga0105248_10035320 3300009177 Bacteria 5591
74 Ga0105249_10016635 3300009553 Bacteria 6529
75 Ga0105239_10192734 3300010375 Bacteria 2281
76 Ga0105246_10477075 3300011119 Bacteria 1054
77 Ga0105246_10483859 3300011119 Bacteria 1048
78 Ga0157369_11378436 3300013105 Bacteria 718
79 Ga0157374_10648632 3300013296 Bacteria 1067
80 Ga0157372_10104815 3300013307 Bacteria 3234
81 Ga0157372_10121670 3300013307 Bacteria 2998
82 Ga0157372_10585986 3300013307 Bacteria 1300
83 Ga0157372_10792044 3300013307 Bacteria 1102
84 Ga0157372_11960900 3300013307 Bacteria 673
85 Ga0157375_10990526 3300013308 Bacteria 981
86 Ga0163163_10092633 3300014325 Bacteria 3037
87 Ga0157380_10012627 3300014326 Bacteria 6130
88 Ga0157377_10004523 3300014745 Bacteria 6418
89 Ga0157379_10313180 3300014968 Bacteria 1432
90 Ga0163161_10183728 3300017792 Bacteria 1605
91 Ga0206356_10070626 3300020070 Bacteria 2470
92 Ga0206354_11543417 3300020081 Bacteria 1137
93 Ga0206353_10301200 3300020082 Bacteria 957
94 Ga0206353_11024863 3300020082 Bacteria 4276
95 Ga0206353_11503956 3300020082 Bacteria 1032
96 Ga0206353_11703101 3300020082 Bacteria 1152
97 Ga0207642_10085198 3300025899 Bacteria 1546
98 Ga0207688_10027151 3300025901 Bacteria 3149
99 Ga0207647_10086728 3300025904 Bacteria 1871
100 Ga0207643_10000932 3300025908 Bacteria 17549
101 Ga0207705_10124562 3300025909 Bacteria 1914
102 Ga0207707_10001741 3300025912 Bacteria 20017
103 Ga0207695_10199243 3300025913 Bacteria 1917
104 Ga0207660_10002519 3300025917 Bacteria 12044
105 Ga0207660_10578034 3300025917 Bacteria 914
106 Ga0207657_10078425 3300025919 Bacteria 2781
107 Ga0207652_10008936 3300025921 Bacteria 8073
108 Ga0207652_10138693 3300025921 Bacteria 2173
109 Ga0207650_10232900 3300025925 Bacteria 1486
110 Ga0207687_10163817 3300025927 Bacteria 1709
111 Ga0207644_10301871 3300025931 Bacteria 1291
112 Ga0207690_10092404 3300025932 Bacteria 2141
113 Ga0207690_10207915 3300025932 Bacteria 1490
114 Ga0207709_10031596 3300025935 Bacteria 3094
115 Ga0207704_10397588 3300025938 Bacteria 1086
116 Ga0207691_10010057 3300025940 Bacteria 9079
117 Ga0207711_10118783 3300025941 Bacteria 2359
118 Ga0207689_10291085 3300025942 Bacteria 1353
119 Ga0207661_10067342 3300025944 Bacteria 2912
120 Ga0207661_10124720 3300025944 Bacteria 2198
121 Ga0207661_10131748 3300025944 Bacteria 2142
122 Ga0207661_10281472 3300025944 Bacteria 1487
123 Ga0207661_10392238 3300025944 Bacteria 1258
124 Ga0207667_10324200 3300025949 Bacteria 1573
125 Ga0207712_10045502 3300025961 Bacteria 3039
126 Ga0207668_10215633 3300025972 Bacteria 1538
127 Ga0207677_10075677 3300026023 Bacteria 2393
128 Ga0207708_10000227 3300026075 Bacteria 44512
129 Ga0207641_11159055 3300026088 Bacteria 772
130 Ga0207648_10000576 3300026089 Bacteria 41193
131 Ga0207676_10448006 3300026095 Bacteria 1216
132 Ga0207674_10264027 3300026116 Bacteria 1669
133 Ga0207675_100004066 3300026118 Bacteria 14158
134 Ga0207683_10889874 3300026121 Bacteria 827
135 Ga0207698_10157992 3300026142 Bacteria 1978
136 Ga0207428_10067093 3300027907 Bacteria 2825
137 Ga0268265_10100805 3300028380 Bacteria 2332
138 Ga0307409_100905058 3300031995 Bacteria 896
139 Ga0395899_0018143 3300037312 Bacteria 5354
140 Ga0395900_0076778 3300037418 Bacteria 3433
141 Ga0395898_0075502 3300037466 Bacteria 3256
142 Ga0395901_0386577 3300038443 Bacteria 1439
143 Ga0395901_1153586 3300038443 Bacteria 743
144 Ga0451804_0356831 3300041463 Bacteria 601
145 Ga0451853_3725642 3300041512 Bacteria 888
146 Ga0466969_0246724 3300044656 Bacteria 810
147 Ga0466972_0110610 3300044658 Bacteria 1298
148 Ga0466972_0309380 3300044658 Bacteria 738
149 Ga0466965_0033739 3300044683 Bacteria 2502
150 Ga0466965_0125955 3300044683 Bacteria 1325
151 Ga0466966_0028706 3300044684 Bacteria 3621
152 Ga0466963_0021493 3300044694 Bacteria 4072
153 Ga0466957_0063258 3300044842 Bacteria 2274
154 Ga0466960_0018985 3300044901 Bacteria 3022
155 Ga0466960_0133359 3300044901 Bacteria 1313
156 Ga0466959_0038696 3300045049 Bacteria 3524
157 Ga0466967_0021160 3300045976 Bacteria 5275
158 Ga0466967_0022773 3300045976 Bacteria 5121
159 Ga0466967_0921847 3300045976 Bacteria 869
160 Ga0495677_0304451 3300047445 Bacteria 627
161 Ga0496102_0482641 3300048905 Bacteria 1161
162 Ga0496108_0826111 3300048911 Bacteria 798
163 Ga0496109_0032620 3300048912 Bacteria 4682
164 Ga0496109_0541099 3300048912 Bacteria 1099
165 Ga0496110_0079478 3300048913 Bacteria 2920
166 Ga0496110_0127964 3300048913 Bacteria 2292
167 Ga0496110_0387081 3300048913 Bacteria 1274
168 Ga0496111_0528138 3300048914 Bacteria 867
169 Ga0496114_0058307 3300048917 Bacteria 3224
170 Ga0496114_0125909 3300048917 Bacteria 2208
171 Ga0496114_1400312 3300048917 Bacteria 587
172 Ga0501031_0005383 3300049568 Bacteria 8336
173 Ga0501031_0055019 3300049568 Bacteria 2593
174 Ga0501033_0036157 3300049570 Bacteria 3702
175 Ga0501036_0030483 3300049572 Bacteria 4555
176 Ga0501038_0175612 3300049574 Bacteria 1731
177 Ga0501038_0480359 3300049574 Bacteria 952
178 Ga0501038_0807775 3300049574 Bacteria 697
179 Ga0501039_0013136 3300049575 Bacteria 6329
180 Ga0501039_0050826 3300049575 Bacteria 3207
181 Ga0501040_0006621 3300049576 Bacteria 7520
182 Ga0501040_0007068 3300049576 Bacteria 7276
183 Ga0501041_0009045 3300049577 Bacteria 5861
184 Ga0501041_0020404 3300049577 Bacteria 3962
185 Ga0501041_0105322 3300049577 Bacteria 1748
186 Ga0501041_0223754 3300049577 Bacteria 1181
187 Ga0501042_0005774 3300049578 Bacteria 7991
188 Ga0501043_0106067 3300049579 Bacteria 2207
189 Ga0501043_0797077 3300049579 Bacteria 684
190 Ga0501046_0038031 3300049580 Bacteria 3864
191 Ga0501046_0120791 3300049580 Bacteria 1993
192 Ga0501048_0058578 3300049582 Bacteria 2730
193 Ga0501048_1026966 3300049582 Bacteria 593
194 Ga0501067_0071989 3300049583 Bacteria 1915
195 Ga0501068_0008819 3300049584 Bacteria 5625
196 Ga0501068_0032129 3300049584 Bacteria 3120
197 Ga0501068_0343340 3300049584 Bacteria 959
198 Ga0501068_0461305 3300049584 Bacteria 822
199 Ga0501070_0483177 3300049586 Bacteria 996
200 Ga0501070_0484616 3300049586 Bacteria 994
201 Ga0501071_0002621 3300049587 Bacteria 10998
202 Ga0501071_0056945 3300049587 Bacteria 2824
203 Ga0501071_0346803 3300049587 Bacteria 1130
204 Ga0501071_1021608 3300049587 Bacteria 639
205 Ga0501072_0002981 3300049588 Bacteria 12753
206 Ga0501072_0004851 3300049588 Bacteria 10241
207 Ga0501072_0037594 3300049588 Bacteria 3797
208 Ga0501073_0106768 3300049589 Bacteria 1943
209 Ga0501074_0015509 3300049590 Bacteria 5539
210 Ga0501075_0000413 3300049591 Bacteria 24963
211 Ga0501075_0091804 3300049591 Bacteria 2304
212 Ga0501076_0010783 3300049592 Bacteria 6793
213 Ga0501076_0047561 3300049592 Bacteria 3392
214 Ga0501076_0272615 3300049592 Bacteria 1386
215 Ga0501076_0631565 3300049592 Bacteria 884
216 Ga0501076_0851214 3300049592 Bacteria 752
217 Ga0501077_0003862 3300049593 Bacteria 9032
218 Ga0501077_0039826 3300049593 Bacteria 2993
219 Ga0501077_0784354 3300049593 Bacteria 613
220 Ga0501079_0012791 3300049741 Bacteria 6408
221 Ga0501079_0039234 3300049741 Bacteria 3652
222 Ga0501080_0019881 3300049742 Bacteria 6219
223 Ga0501080_0401333 3300049742 Bacteria 1233
224 Ga0501081_0001867 3300049743 Bacteria 13091
225 Ga0501083_0079794 3300049744 Bacteria 2170
226 Ga0501083_0387921 3300049744 Bacteria 908
227 Ga0501035_0045483 3300049822 Bacteria 3950
228 Ga0501035_0591776 3300049822 Bacteria 905
229 Ga0501044_0078755 3300049823 Bacteria 3340
230 Ga0501045_0011860 3300049824 Bacteria 6125
231 nmdc:mga03683_273292_c1 3300050489 Bacteria 788
232 nmdc:mga03n38_201254_c1 3300050490 Bacteria 1031
233 nmdc:mga03n38_42894_c1 3300050490 Bacteria 1980
234 nmdc:mga03n38_67488_c1 3300050490 Bacteria 1646
235 nmdc:mga00v17_397302_c1 3300050491 Bacteria 896
236 nmdc:mga0yw44_14854_c1 3300050492 Bacteria 4150
237 nmdc:mga0yw44_362859_c1 3300050492 Bacteria 976
238 nmdc:mga06z11_58604_c1 3300050494 Bacteria 1998
239 nmdc:mga07m45_113637_c1 3300050496 Bacteria 1561
240 nmdc:mga08y16_37267_c1 3300050511 Bacteria 5108
241 Ga0495601_0375661 3300053077 Bacteria 923
242 Ga0495612_0198802 3300053078 Bacteria 884
243 Ga0500643_001646 3300053087 Bacteria 12490
244 Ga0501084_0000803 3300054114 Bacteria 24054
245 Ga0501084_0093229 3300054114 Bacteria 2528
246 Ga0501082_0029736 3300060353 Bacteria 4707
247 Ga0501082_0046035 3300060353 Bacteria 3761
248 Ga0501082_0485323 3300060353 Bacteria 1080
249 Ga0466962_0576425 3300061719 Bacteria 573
250 Ga0530510_0039573 3300061734 Bacteria 3404
251 Ga0530510_0065955 3300061734 Bacteria 2623
252 Ga0530510_0198302 3300061734 Bacteria 1490
253 Ga0530510_0800515 3300061734 Bacteria 719
254 2643891320 2643221576 Bacteria 5214352
255 2643960368 2643221590 Bacteria 5214697
256 2644036210 2643221604 Bacteria 5014917
257 2676473314 2675903058 Bacteria 6822861
258 2740169051 2739367898 Bacteria 4367674
259 2827628549 2827628540 Bacteria 6858585
260 3001890632 3001889506 Bacteria 2975194
261 Ga0501071_0401575
262 JGI24743J22301_10026156
263 JGI24735J21928_10067230
264 JGI24750J21931_1042247
265 JGI24738J21930_10007742
266 JGI24744J21845_10001073
267 JGI24033J26618_1006394
268 Ga0070658_10007152
269 Ga0070658_10011684
270 Ga0070658_10149638
271 Ga0070658_10651123
272 Ga0070683_100008509
273 Ga0070683_100154830
274 Ga0070683_100398280
275 Ga0070683_100583012
276 Ga0070683_101026594
277 Ga0070670_100080629
278 Ga0070680_100000530
279 Ga0070680_100606434
280 Ga0068868_100032672
281 Ga0070660_100064788
282 Ga0070660_100348185
283 Ga0070689_100730982
284 Ga0070689_100901680
285 Ga0070691_10061267
286 Ga0070692_10063815
287 Ga0070692_10514669
288 Ga0070668_100188987
289 Ga0070675_100117953
290 Ga0070674_100022693
291 Ga0070673_100214362
292 Ga0070659_100075710
293 Ga0070659_100151540
294 Ga0070667_100731929
295 Ga0070667_100732292
296 Ga0070714_100002773
297 Ga0070701_10001989
298 Ga0070678_100726044
299 Ga0070681_10000101
300 Ga0070681_10480274
301 Ga0068867_100004889
302 Ga0070685_10107367
303 Ga0070679_100030253
304 Ga0070679_100572362
305 Ga0070684_100003875
306 Ga0070684_100014929
307 Ga0070684_100034921
308 Ga0070684_100422136
309 Ga0070672_100001684
310 Ga0068855_100304010
311 Ga0068857_100217727
312 Ga0068857_100245238
313 Ga0070702_100006418
314 Ga0068852_100008268
315 Ga0068864_100209414
316 Ga0068866_10086570
317 Ga0068861_100007730
318 Ga0068870_10090752
319 Ga0068862_100232922
320 Ga0075365_10011900
321 Ga0075363_100014330
322 Ga0075363_100019774
323 Ga0075363_100027925
324 Ga0075364_10434138
325 Ga0075370_10084150
326 Ga0075428_100760588
327 Ga0068865_100098388
328 Ga0105240_10123465
329 Ga0111539_10493644
330 Ga0105245_10016311
331 Ga0105243_10048775
332 Ga0105242_10165364
333 Ga0105248_10035320
334 Ga0105249_10016635
335 Ga0105239_10192734
336 Ga0105246_10477075
337 Ga0105246_10483859
338 Ga0157369_11378436
339 Ga0157374_10648632
340 Ga0157372_10104815
341 Ga0157372_10121670
342 Ga0157372_10585986
343 Ga0157372_10792044
344 Ga0157372_11960900
345 Ga0157375_10990526
346 Ga0163163_10092633
347 Ga0157380_10012627
348 Ga0157377_10004523
349 Ga0157379_10313180
350 Ga0163161_10183728
351 Ga0206356_10070626
352 Ga0206354_11543417
353 Ga0206353_10301200
354 Ga0206353_11024863
355 Ga0206353_11503956
356 Ga0206353_11703101
357 Ga0207642_10085198
358 Ga0207688_10027151
359 Ga0207647_10086728
360 Ga0207643_10000932
361 Ga0207705_10124562
362 Ga0207707_10001741
363 Ga0207695_10199243
364 Ga0207660_10002519
365 Ga0207660_10578034
366 Ga0207657_10078425
367 Ga0207652_10008936
368 Ga0207652_10138693
369 Ga0207650_10232900
370 Ga0207687_10163817
371 Ga0207644_10301871
372 Ga0207690_10092404
373 Ga0207690_10207915
374 Ga0207709_10031596
375 Ga0207704_10397588
376 Ga0207691_10010057
377 Ga0207711_10118783
378 Ga0207689_10291085
379 Ga0207661_10067342
380 Ga0207661_10124720
381 Ga0207661_10131748
382 Ga0207661_10281472
383 Ga0207661_10392238
384 Ga0207667_10324200
385 Ga0207712_10045502
386 Ga0207668_10215633
387 Ga0207677_10075677
388 Ga0207708_10000227
389 Ga0207641_11159055
390 Ga0207648_10000576
391 Ga0207676_10448006
392 Ga0207674_10264027
393 Ga0207675_100004066
394 Ga0207683_10889874
395 Ga0207698_10157992
396 Ga0207428_10067093
397 Ga0268265_10100805
398 Ga0307409_100905058
399 Ga0395899_0018143
400 Ga0395900_0076778
401 Ga0395898_0075502
402 Ga0395901_0386577
403 Ga0395901_1153586
404 Ga0451804_0356831
405 Ga0451853_3725642
406 Ga0466969_0246724
407 Ga0466972_0110610
408 Ga0466972_0309380
409 Ga0466965_0033739
410 Ga0466965_0125955
411 Ga0466966_0028706
412 Ga0466963_0021493
413 Ga0466957_0063258
414 Ga0466960_0018985
415 Ga0466960_0133359
416 Ga0466959_0038696
417 Ga0466967_0021160
418 Ga0466967_0022773
419 Ga0466967_0921847
420 Ga0495677_0304451
421 Ga0496102_0482641
422 Ga0496108_0826111
423 Ga0496109_0032620
424 Ga0496109_0541099
425 Ga0496110_0079478
426 Ga0496110_0127964
427 Ga0496110_0387081
428 Ga0496111_0528138
429 Ga0496114_0058307
430 Ga0496114_0125909
431 Ga0496114_1400312
432 Ga0501031_0005383
433 Ga0501031_0055019
434 Ga0501033_0036157
435 Ga0501036_0030483
436 Ga0501038_0175612
437 Ga0501038_0480359
438 Ga0501038_0807775
439 Ga0501039_0013136
440 Ga0501039_0050826
441 Ga0501040_0006621
442 Ga0501040_0007068
443 Ga0501041_0009045
444 Ga0501041_0020404
445 Ga0501041_0105322
446 Ga0501041_0223754
447 Ga0501042_0005774
448 Ga0501043_0106067
449 Ga0501043_0797077
450 Ga0501046_0038031
451 Ga0501046_0120791
452 Ga0501048_0058578
453 Ga0501048_1026966
454 Ga0501067_0071989
455 Ga0501068_0008819
456 Ga0501068_0032129
457 Ga0501068_0343340
458 Ga0501068_0461305
459 Ga0501070_0483177
460 Ga0501070_0484616
461 Ga0501071_0002621
462 Ga0501071_0056945
463 Ga0501071_0346803
464 Ga0501071_1021608
465 Ga0501072_0002981
466 Ga0501072_0004851
467 Ga0501072_0037594
468 Ga0501073_0106768
469 Ga0501074_0015509
470 Ga0501075_0000413
471 Ga0501075_0091804
472 Ga0501076_0010783
473 Ga0501076_0047561
474 Ga0501076_0272615
475 Ga0501076_0631565
476 Ga0501076_0851214
477 Ga0501077_0003862
478 Ga0501077_0039826
479 Ga0501077_0784354
480 Ga0501079_0012791
481 Ga0501079_0039234
482 Ga0501080_0019881
483 Ga0501080_0401333
484 Ga0501081_0001867
485 Ga0501083_0079794
486 Ga0501083_0387921
487 Ga0501035_0045483
488 Ga0501035_0591776
489 Ga0501044_0078755
490 Ga0501045_0011860
491 nmdc:mga03683_273292_c1
492 nmdc:mga03n38_201254_c1
493 nmdc:mga03n38_42894_c1
494 nmdc:mga03n38_67488_c1
495 nmdc:mga00v17_397302_c1
496 nmdc:mga0yw44_14854_c1
497 nmdc:mga0yw44_362859_c1
498 nmdc:mga06z11_58604_c1
499 nmdc:mga07m45_113637_c1
500 nmdc:mga08y16_37267_c1
501 Ga0495601_0375661
502 Ga0495612_0198802
503 Ga0500643_001646
504 Ga0501084_0000803
505 Ga0501084_0093229
506 Ga0501082_0029736
507 Ga0501082_0046035
508 Ga0501082_0485323
509 Ga0466962_0576425
510 Ga0530510_0039573
511 Ga0530510_0065955
512 Ga0530510_0198302
513 Ga0530510_0800515
514 2643891320
515 2643960368
516 2644036210
517 2676473314
518 2740169051
519 2827628549
520 3001890632

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00484

Pro_CA

Carbonic anhydrase

52

181

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
6jqd-assembly1.cif.gz_B the structural basis of the beta-carbonic anhydrase cafc (l25g and l78g mutant) of the filamentous fungus aspergillus fumigatus 0.8703 2 165
6jqc-assembly1.cif.gz_B the structural basis of the beta-carbonic anhydrase cafc (wild type) of the filamentous fungus aspergillus fumigatus 0.8673 2 165
6y04-assembly1.cif.gz_B crystal structure of beta-carbonic anhydrase isoform i (tvaca1) from the trichomonas vaginalis protozoan. 0.8543 2 163
3las-assembly1.cif.gz_B crystal structure of carbonic anhydrase from streptococcus mutans to 1.4 angstrom resolution 0.8534 1 163
6jqd-assembly1.cif.gz_B the structural basis of the beta-carbonic anhydrase cafc (l25g and l78g mutant) of the filamentous fungus aspergillus fumigatus 0.8511 2 165
ID Description Score Start End Superfamily
af_Q5A207_1_162_3.40.1050.10 Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase 0.8593 6 163 3.40.1050.10
3lasB00 Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase 0.8534 1 163 3.40.1050.10
1g5cD00 Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase 0.8504 31 163 3.40.1050.10
3lasB00 Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase 0.8395 1 163 3.40.1050.10
1ylkA00 Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase 0.8337 2 165 3.40.1050.10
ID Description Score Start End GO Terms
AF-A0A0S9QBD2-F1-model_v4 Carbonic anhydrase 0.9937 10 165 GO:0004089
GO:0008270
AF-A0A7V9F6I8-F1-model_v4 Carbonic anhydrase 0.9882 1 165 GO:0004089
GO:0008270
AF-A0A838KN49-F1-model_v4 Carbonic anhydrase 0.9866 1 165 GO:0004089
GO:0008270
AF-A0A7V9F6I8-F1-model_v4 Carbonic anhydrase 0.9823 1 165 GO:0004089
GO:0008270
AF-A0A0S9QBD2-F1-model_v4 Carbonic anhydrase 0.9812 10 165 GO:0004089
GO:0008270

Map