F369880

General Info

Members Datasets Scaffolds Average Seq Length
260 159 520 344

Family's Representative Sequence

Representative Sequence 3300049569|Ga0501032_0000880|Ga0501032_0000880_771_1865
Length 364
Sequence MKEPKQEGSKLKKSGQSLSGSRRSFLAGIGTGLGAPLILGAANKSGSKKPIVGQGDHTYEVTHDWGQLPADITYGNTHGVCEDSRGHIYIHHTVGATSEKADSMVVFDHKGKFVKSWGKDFKGGAHGLHIRREGKNEFLYLCDTRRGLVVKTTLDGEEVFTLGYPSESEVYAKPGPDGKKLKYSPTNLAIAPNGDIYVGDGYGSSYVNRYNSKGQYLSTFGGPGKEAGQLSCPHGITVDERGSEPIIVVADRSNKRLQRFTLDGKHIDFIYGTTAPCYFSFYKNGDLVIPDLFARVTLMDRSNKIIAELGEDSQSNYMETRKLSRDHFTPGKFVCPHGACFDHAGNIYVVEWVEVGRVSRLRKV

Samples

Sample ID Description Type Environment
1 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
2 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
9 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
10 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
20 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
21 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
22 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
23 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
24 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
25 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
26 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
27 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
28 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
29 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
31 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
32 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
33 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
34 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
35 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
36 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
38 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
39 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
40 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
41 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
42 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
43 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
44 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
45 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
46 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
47 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
48 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
50 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
51 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
52 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
53 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
54 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300022734 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 Metagenome Rhizosphere
56 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
57 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
81 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
82 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
83 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
84 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
85 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
86 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
87 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
88 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
89 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
90 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
91 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
92 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
93 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
94 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
95 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
96 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
97 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
98 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
99 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
100 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
101 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
102 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
103 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
104 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
105 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
106 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
107 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
108 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
109 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
110 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
111 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
112 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
113 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
114 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
115 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
116 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
117 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
118 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
119 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
120 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
121 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
122 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
123 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
124 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
125 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
126 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
127 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
128 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
129 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
130 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
139 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
140 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
141 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
142 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
143 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
144 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
145 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
146 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
147 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
148 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
150 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
151 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
152 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
153 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
154 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
155 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
156 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
157 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
158 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
159 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.69
Metatranscriptomes 2.31
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.69
Nodule 0
Rhizoplane 3.08
Rhizosphere 88.85
Stem 0
Stem Tuber 0
Unclassified 21.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501032_0000880 3300049569 Bacteria 24364
2 Ga0058861_11404563 3300004800 Bacteria 1209
3 Ga0070683_100000063 3300005329 Bacteria 79423
4 Ga0070683_100008488 3300005329 Bacteria 8728
5 Ga0070680_100193306 3300005336 Bacteria 1715
6 Ga0070660_100003430 3300005339 Bacteria 10903
7 Ga0070660_100075740 3300005339 Bacteria 2635
8 Ga0070661_100087151 3300005344 Bacteria 2309
9 Ga0070661_100120723 3300005344 Unclassified 1963
10 Ga0070661_100172537 3300005344 Bacteria 1643
11 Ga0070671_100033454 3300005355 Bacteria 4252
12 Ga0070673_100160186 3300005364 Bacteria 1913
13 Ga0070688_100260460 3300005365 Bacteria 1238
14 Ga0070710_10025973 3300005437 Unclassified 3107
15 Ga0070711_100000146 3300005439 Bacteria 37986
16 Ga0070711_100102719 3300005439 Unclassified 2082
17 Ga0070681_10053753 3300005458 Bacteria 4013
18 Ga0070681_10088057 3300005458 Bacteria 3057
19 Ga0070681_10321771 3300005458 Unclassified 1456
20 Ga0070706_100447029 3300005467 Unclassified 1203
21 Ga0070679_100098976 3300005530 Bacteria 2903
22 Ga0070679_100170688 3300005530 Bacteria 2148
23 Ga0070679_100211424 3300005530 Unclassified 1904
24 Ga0070679_100311243 3300005530 Bacteria 1525
25 Ga0070684_100000126 3300005535 Bacteria 50767
26 Ga0070684_100335675 3300005535 Bacteria 1389
27 Ga0068853_100028931 3300005539 Bacteria 4664
28 Ga0068853_100172745 3300005539 Bacteria 1956
29 Ga0070665_100091231 3300005548 Unclassified 3052
30 Ga0070665_100301247 3300005548 Unclassified 1606
31 Ga0068855_100059961 3300005563 Bacteria 4451
32 Ga0068855_100125871 3300005563 Bacteria 2930
33 Ga0068856_100010339 3300005614 Bacteria 9066
34 Ga0068856_100018343 3300005614 Bacteria 6783
35 Ga0068852_100099540 3300005616 Bacteria 2621
36 Ga0068852_100100598 3300005616 Bacteria 2608
37 Ga0068858_100423722 3300005842 Bacteria 1280
38 Ga0081540_1001744 3300005983 Bacteria 18301
39 Ga0081539_10023400 3300005985 Unclassified 4048
40 Ga0070717_10013402 3300006028 Bacteria 6282
41 Ga0075364_10003233 3300006051 Bacteria 9228
42 Ga0070715_10005537 3300006163 Unclassified 4218
43 Ga0070712_100126394 3300006175 Bacteria 1932
44 Ga0075367_10002304 3300006178 Bacteria 8670
45 Ga0097621_100020372 3300006237 Bacteria 5109
46 Ga0097621_100145780 3300006237 Bacteria 2027
47 Ga0068871_100001651 3300006358 Bacteria 14999
48 Ga0068871_100219335 3300006358 Bacteria 1647
49 Ga0075428_100067893 3300006844 Bacteria 3902
50 Ga0075430_100042818 3300006846 Unclassified 3828
51 Ga0075436_100013923 3300006914 Bacteria 5508
52 Ga0075436_100039876 3300006914 Bacteria 3240
53 Ga0105240_10000855 3300009093 Bacteria 54907
54 Ga0105240_10011514 3300009093 Bacteria 12311
55 Ga0105240_10011895 3300009093 Bacteria 12071
56 Ga0105240_10033079 3300009093 Bacteria 6685
57 Ga0105240_10124540 3300009093 Unclassified 3099
58 Ga0105240_10130373 3300009093 Unclassified 3017
59 Ga0105240_10326143 3300009093 Unclassified 1748
60 Ga0105247_10174940 3300009101 Unclassified 1429
61 Ga0114129_10350937 3300009147 Bacteria 1954
62 Ga0105241_10237677 3300009174 Bacteria 1539
63 Ga0105248_10012435 3300009177 Bacteria 9389
64 Ga0105248_10015080 3300009177 Bacteria 8510
65 Ga0105248_10024848 3300009177 Bacteria 6659
66 Ga0105248_10057609 3300009177 Bacteria 4362
67 Ga0105248_10163260 3300009177 Bacteria 2512
68 Ga0105237_10000802 3300009545 Bacteria 42922
69 Ga0105237_10021749 3300009545 Bacteria 6589
70 Ga0105237_10075180 3300009545 Unclassified 3370
71 Ga0105237_10372244 3300009545 Bacteria 1433
72 Ga0105238_10031811 3300009551 Bacteria 5369
73 Ga0105238_10040538 3300009551 Bacteria 4718
74 Ga0105238_10583832 3300009551 Bacteria 1124
75 Ga0157370_10001926 3300013104 Bacteria 25531
76 Ga0157370_10109384 3300013104 Bacteria 2584
77 Ga0157370_10184424 3300013104 Unclassified 1938
78 Ga0157370_10263650 3300013104 Unclassified 1592
79 Ga0157369_10001887 3300013105 Bacteria 25280
80 Ga0157369_10008570 3300013105 Bacteria 11728
81 Ga0157369_10079507 3300013105 Bacteria 3512
82 Ga0157369_10318392 3300013105 Bacteria 1617
83 Ga0157374_10003856 3300013296 Bacteria 12601
84 Ga0157378_10060942 3300013297 Unclassified 3366
85 Ga0157378_10128504 3300013297 Unclassified 2343
86 Ga0157378_10511441 3300013297 Bacteria 1201
87 Ga0163162_10004300 3300013306 Bacteria 13709
88 Ga0163162_10182398 3300013306 Unclassified 2225
89 Ga0157372_10125367 3300013307 Bacteria 2952
90 Ga0157372_10140610 3300013307 Bacteria 2780
91 Ga0157372_10193867 3300013307 Bacteria 2353
92 Ga0157372_10537828 3300013307 Bacteria 1362
93 Ga0163163_10032117 3300014325 Bacteria 5071
94 Ga0163163_10126927 3300014325 Bacteria 2589
95 Ga0163163_10446845 3300014325 Bacteria 1353
96 Ga0197907_11429768 3300020069 Unclassified 1844
97 Ga0206352_10879403 3300020078 Unclassified 1501
98 Ga0206350_10476651 3300020080 Bacteria 1703
99 Ga0213872_10000533 3300021361 Bacteria 29824
100 Ga0213875_10000008 3300021388 Bacteria 533344
101 Ga0213875_10000041 3300021388 Bacteria 155792
102 Ga0213875_10029680 3300021388 Unclassified 2593
103 Ga0213871_10038559 3300021441 Bacteria 1276
104 Ga0224712_10059663 3300022467 Unclassified 1515
105 Ga0224571_100554 3300022734 Bacteria 2100
106 Ga0224572_1005247 3300024225 Bacteria 2301
107 Ga0207692_10040330 3300025898 Unclassified 2303
108 Ga0207707_10053912 3300025912 Bacteria 3501
109 Ga0207707_10136913 3300025912 Bacteria 2141
110 Ga0207695_10017886 3300025913 Bacteria 8213
111 Ga0207695_10033617 3300025913 Bacteria 5590
112 Ga0207695_10058861 3300025913 Unclassified 3987
113 Ga0207695_10132234 3300025913 Bacteria 2452
114 Ga0207671_10005575 3300025914 Bacteria 11557
115 Ga0207693_10000173 3300025915 Bacteria 58862
116 Ga0207693_10296813 3300025915 Bacteria 1266
117 Ga0207663_10056402 3300025916 Bacteria 2470
118 Ga0207663_10085032 3300025916 Unclassified 2082
119 Ga0207660_10016144 3300025917 Unclassified 4939
120 Ga0207660_10092429 3300025917 Bacteria 2246
121 Ga0207649_10064487 3300025920 Bacteria 2316
122 Ga0207649_10125092 3300025920 Unclassified 1739
123 Ga0207652_10136643 3300025921 Bacteria 2189
124 Ga0207652_10140316 3300025921 Unclassified 2161
125 Ga0207694_10089488 3300025924 Bacteria 2428
126 Ga0207694_10325603 3300025924 Bacteria 1269
127 Ga0207687_10231981 3300025927 Unclassified 1458
128 Ga0207664_10277976 3300025929 Bacteria 1469
129 Ga0207664_10331797 3300025929 Unclassified 1344
130 Ga0207644_10056824 3300025931 Unclassified 2825
131 Ga0207711_10201370 3300025941 Bacteria 1817
132 Ga0207661_10000020 3300025944 Bacteria 216011
133 Ga0207661_10061684 3300025944 Bacteria 3030
134 Ga0207667_10049066 3300025949 Bacteria 4461
135 Ga0207651_10119562 3300025960 Bacteria 1995
136 Ga0207677_10423415 3300026023 Unclassified 1135
137 Ga0207639_10020552 3300026041 Bacteria 4727
138 Ga0207639_10144098 3300026041 Unclassified 1988
139 Ga0207702_10013921 3300026078 Bacteria 6682
140 Ga0207702_10089717 3300026078 Unclassified 2689
141 Ga0207702_10482636 3300026078 Unclassified 1206
142 Ga0207641_10140833 3300026088 Unclassified 2176
143 Ga0207698_10072125 3300026142 Unclassified 2744
144 Ga0207698_10207174 3300026142 Bacteria 1761
145 Ga0207698_10231165 3300026142 Unclassified 1679
146 Ga0268266_10170889 3300028379 Unclassified 1973
147 Ga0265338_10055530 3300028800 Bacteria 3522
148 Ga0265760_10000408 3300031090 Bacteria 12026
149 Ga0307408_100310645 3300031548 Bacteria 1324
150 Ga0265314_10172264 3300031711 Bacteria 1305
151 Ga0265342_10058548 3300031712 Bacteria 2277
152 Ga0307413_10220110 3300031824 Bacteria 1386
153 Ga0307414_10251562 3300032004 Unclassified 1469
154 Ga0373926_0000965 3300035083 Bacteria 8340
155 Ga0373944_0010536 3300035089 Bacteria 2522
156 Ga0373953_0024423 3300035117 Unclassified 2298
157 Ga0373956_0114952 3300035119 Unclassified 1254
158 Ga0373935_0111563 3300035692 Bacteria 1816
159 Ga0373927_0001708 3300035695 Bacteria 16403
160 Ga0373933_0038432 3300035724 Unclassified 2812
161 Ga0373947_0004631 3300035725 Bacteria 8068
162 Ga0373925_0001654 3300037068 Bacteria 18798
163 Ga0373925_0030783 3300037068 Unclassified 3940
164 Ga0373925_0049594 3300037068 Bacteria 3130
165 Ga0373925_0074305 3300037068 Unclassified 2575
166 Ga0395905_0373806 3300037471 Unclassified 1319
167 Ga0436364_0278567 3300037853 Bacteria 2013
168 Ga0436364_0376159 3300037853 Unclassified 4548
169 Ga0436364_0535318 3300037853 Bacteria 3108
170 Ga0436364_0749502 3300037853 Bacteria 105484
171 Ga0436364_0932536 3300037853 Bacteria 4441
172 Ga0436364_1108153 3300037853 Unclassified 3512
173 Ga0436364_1352145 3300037853 Bacteria 2298
174 Ga0436364_1415525 3300037853 Bacteria 425173
175 Ga0436365_0107208 3300039437 Bacteria 28932
176 Ga0436365_0739766 3300039437 Bacteria 6525
177 Ga0436360_0386033 3300039438 Bacteria 17898
178 Ga0436361_0829065 3300039447 Bacteria 1300
179 Ga0436361_1097729 3300039447 Bacteria 95612
180 Ga0436363_0816377 3300039450 Bacteria 3493
181 Ga0436362_0482283 3300039453 Bacteria 3778
182 Ga0450896_009792 3300042133 Unclassified 1339
183 Ga0466966_0053620 3300044684 Bacteria 2558
184 Ga0451576_0017774 3300045051 Bacteria 7813
185 Ga0495638_0044117 3300046460 Bacteria 2810
186 Ga0495651_0003366 3300046462 Bacteria 12270
187 Ga0495651_0078170 3300046462 Unclassified 2503
188 Ga0495653_0149101 3300046463 Bacteria 1636
189 Ga0495580_0009120 3300046472 Bacteria 7824
190 Ga0495639_0162119 3300046475 Bacteria 1083
191 Ga0495664_0001274 3300046477 Bacteria 13217
192 Ga0495628_0003981 3300046516 Bacteria 13159
193 Ga0495652_0044504 3300046529 Bacteria 3822
194 Ga0495640_0025966 3300046533 Bacteria 4242
195 Ga0495587_0016517 3300046536 Bacteria 4591
196 Ga0495587_0129801 3300046536 Unclassified 1441
197 Ga0495645_0003823 3300046543 Bacteria 10242
198 Ga0495645_0014053 3300046543 Bacteria 5675
199 Ga0495667_0013651 3300046559 Bacteria 5492
200 Ga0495667_0096514 3300046559 Bacteria 1913
201 Ga0495599_0014375 3300046678 Bacteria 4901
202 Ga0495674_0029093 3300047319 Bacteria 5033
203 Ga0495674_0122868 3300047319 Bacteria 2192
204 Ga0495675_0040554 3300047444 Bacteria 2967
205 Ga0495675_0072076 3300047444 Bacteria 2180
206 Ga0495602_0006973 3300048088 Bacteria 11867
207 Ga0495602_0016677 3300048088 Bacteria 7382
208 Ga0496100_0009469 3300048903 Bacteria 5474
209 Ga0496101_0008507 3300048904 Bacteria 6707
210 Ga0496102_0021213 3300048905 Bacteria 5744
211 Ga0496103_0013090 3300048906 Unclassified 4918
212 Ga0496106_0025900 3300048909 Unclassified 4364
213 Ga0496112_0071899 3300048915 Bacteria 3419
214 Ga0496114_0069674 3300048917 Unclassified 2953
215 Ga0496115_0077023 3300048918 Bacteria 2711
216 Ga0501033_0021766 3300049570 Bacteria 4838
217 Ga0501034_0025034 3300049571 Bacteria 6072
218 Ga0501034_0049335 3300049571 Bacteria 4248
219 Ga0501034_0270513 3300049571 Bacteria 1640
220 Ga0501036_0002737 3300049572 Bacteria 13939
221 Ga0501037_0003163 3300049573 Bacteria 11957
222 Ga0501037_0146970 3300049573 Bacteria 1686
223 Ga0501038_0006420 3300049574 Bacteria 10883
224 Ga0501038_0106080 3300049574 Bacteria 2333
225 Ga0501043_0002896 3300049579 Bacteria 14332
226 Ga0501046_0018367 3300049580 Bacteria 5820
227 Ga0501047_0013215 3300049581 Bacteria 7817
228 Ga0501047_0014774 3300049581 Bacteria 7431
229 Ga0501067_0008260 3300049583 Bacteria 5782
230 Ga0501068_0002361 3300049584 Bacteria 10040
231 Ga0501070_0026841 3300049586 Bacteria 4830
232 Ga0501070_0116931 3300049586 Bacteria 2202
233 Ga0501070_0130677 3300049586 Bacteria 2074
234 Ga0501072_0004708 3300049588 Bacteria 10399
235 Ga0501073_0001753 3300049589 Bacteria 16105
236 Ga0501073_0134576 3300049589 Bacteria 1713
237 Ga0501074_0004180 3300049590 Bacteria 10315
238 Ga0501249_001047 3300049679 Bacteria 5894
239 Ga0501079_0016998 3300049741 Bacteria 5556
240 Ga0501080_0000247 3300049742 Bacteria 40664
241 Ga0501080_0258440 3300049742 Bacteria 1587
242 Ga0501083_0045007 3300049744 Bacteria 2986
243 Ga0501035_0004937 3300049822 Bacteria 12652
244 Ga0501035_0040042 3300049822 Bacteria 4236
245 Ga0501044_0001227 3300049823 Bacteria 30468
246 Ga0501044_0017686 3300049823 Bacteria 7646
247 Ga0501044_0078244 3300049823 Bacteria 3351
248 nmdc:mga08x19_1430_c1 3300050514 Bacteria 14754
249 nmdc:mga08x19_2890_c1 3300050514 Bacteria 10338
250 Ga0495601_0017049 3300053077 Bacteria 4406
251 Ga0495619_0018669 3300053085 Bacteria 4401
252 Ga0500555_000560 3300053103 Bacteria 14765
253 Ga0500592_008674 3300053116 Bacteria 1615
254 Ga0500568_0001922 3300053139 Bacteria 12743
255 Ga0500616_0000468 3300053153 Bacteria 52556
256 Ga0500645_000103 3300053730 Bacteria 67414
257 Ga0501084_0006960 3300054114 Bacteria 9315
258 Ga0501082_0000186 3300060353 Bacteria 53655
259 Ga0501082_0001609 3300060353 Bacteria 19889
260 Ga0501082_0388344 3300060353 Bacteria 1218
261 Ga0501032_0000880
262 Ga0058861_11404563
263 Ga0070683_100000063
264 Ga0070683_100008488
265 Ga0070680_100193306
266 Ga0070660_100003430
267 Ga0070660_100075740
268 Ga0070661_100087151
269 Ga0070661_100120723
270 Ga0070661_100172537
271 Ga0070671_100033454
272 Ga0070673_100160186
273 Ga0070688_100260460
274 Ga0070710_10025973
275 Ga0070711_100000146
276 Ga0070711_100102719
277 Ga0070681_10053753
278 Ga0070681_10088057
279 Ga0070681_10321771
280 Ga0070706_100447029
281 Ga0070679_100098976
282 Ga0070679_100170688
283 Ga0070679_100211424
284 Ga0070679_100311243
285 Ga0070684_100000126
286 Ga0070684_100335675
287 Ga0068853_100028931
288 Ga0068853_100172745
289 Ga0070665_100091231
290 Ga0070665_100301247
291 Ga0068855_100059961
292 Ga0068855_100125871
293 Ga0068856_100010339
294 Ga0068856_100018343
295 Ga0068852_100099540
296 Ga0068852_100100598
297 Ga0068858_100423722
298 Ga0081540_1001744
299 Ga0081539_10023400
300 Ga0070717_10013402
301 Ga0075364_10003233
302 Ga0070715_10005537
303 Ga0070712_100126394
304 Ga0075367_10002304
305 Ga0097621_100020372
306 Ga0097621_100145780
307 Ga0068871_100001651
308 Ga0068871_100219335
309 Ga0075428_100067893
310 Ga0075430_100042818
311 Ga0075436_100013923
312 Ga0075436_100039876
313 Ga0105240_10000855
314 Ga0105240_10011514
315 Ga0105240_10011895
316 Ga0105240_10033079
317 Ga0105240_10124540
318 Ga0105240_10130373
319 Ga0105240_10326143
320 Ga0105247_10174940
321 Ga0114129_10350937
322 Ga0105241_10237677
323 Ga0105248_10012435
324 Ga0105248_10015080
325 Ga0105248_10024848
326 Ga0105248_10057609
327 Ga0105248_10163260
328 Ga0105237_10000802
329 Ga0105237_10021749
330 Ga0105237_10075180
331 Ga0105237_10372244
332 Ga0105238_10031811
333 Ga0105238_10040538
334 Ga0105238_10583832
335 Ga0157370_10001926
336 Ga0157370_10109384
337 Ga0157370_10184424
338 Ga0157370_10263650
339 Ga0157369_10001887
340 Ga0157369_10008570
341 Ga0157369_10079507
342 Ga0157369_10318392
343 Ga0157374_10003856
344 Ga0157378_10060942
345 Ga0157378_10128504
346 Ga0157378_10511441
347 Ga0163162_10004300
348 Ga0163162_10182398
349 Ga0157372_10125367
350 Ga0157372_10140610
351 Ga0157372_10193867
352 Ga0157372_10537828
353 Ga0163163_10032117
354 Ga0163163_10126927
355 Ga0163163_10446845
356 Ga0197907_11429768
357 Ga0206352_10879403
358 Ga0206350_10476651
359 Ga0213872_10000533
360 Ga0213875_10000008
361 Ga0213875_10000041
362 Ga0213875_10029680
363 Ga0213871_10038559
364 Ga0224712_10059663
365 Ga0224571_100554
366 Ga0224572_1005247
367 Ga0207692_10040330
368 Ga0207707_10053912
369 Ga0207707_10136913
370 Ga0207695_10017886
371 Ga0207695_10033617
372 Ga0207695_10058861
373 Ga0207695_10132234
374 Ga0207671_10005575
375 Ga0207693_10000173
376 Ga0207693_10296813
377 Ga0207663_10056402
378 Ga0207663_10085032
379 Ga0207660_10016144
380 Ga0207660_10092429
381 Ga0207649_10064487
382 Ga0207649_10125092
383 Ga0207652_10136643
384 Ga0207652_10140316
385 Ga0207694_10089488
386 Ga0207694_10325603
387 Ga0207687_10231981
388 Ga0207664_10277976
389 Ga0207664_10331797
390 Ga0207644_10056824
391 Ga0207711_10201370
392 Ga0207661_10000020
393 Ga0207661_10061684
394 Ga0207667_10049066
395 Ga0207651_10119562
396 Ga0207677_10423415
397 Ga0207639_10020552
398 Ga0207639_10144098
399 Ga0207702_10013921
400 Ga0207702_10089717
401 Ga0207702_10482636
402 Ga0207641_10140833
403 Ga0207698_10072125
404 Ga0207698_10207174
405 Ga0207698_10231165
406 Ga0268266_10170889
407 Ga0265338_10055530
408 Ga0265760_10000408
409 Ga0307408_100310645
410 Ga0265314_10172264
411 Ga0265342_10058548
412 Ga0307413_10220110
413 Ga0307414_10251562
414 Ga0373926_0000965
415 Ga0373944_0010536
416 Ga0373953_0024423
417 Ga0373956_0114952
418 Ga0373935_0111563
419 Ga0373927_0001708
420 Ga0373933_0038432
421 Ga0373947_0004631
422 Ga0373925_0001654
423 Ga0373925_0030783
424 Ga0373925_0049594
425 Ga0373925_0074305
426 Ga0395905_0373806
427 Ga0436364_0278567
428 Ga0436364_0376159
429 Ga0436364_0535318
430 Ga0436364_0749502
431 Ga0436364_0932536
432 Ga0436364_1108153
433 Ga0436364_1352145
434 Ga0436364_1415525
435 Ga0436365_0107208
436 Ga0436365_0739766
437 Ga0436360_0386033
438 Ga0436361_0829065
439 Ga0436361_1097729
440 Ga0436363_0816377
441 Ga0436362_0482283
442 Ga0450896_009792
443 Ga0466966_0053620
444 Ga0451576_0017774
445 Ga0495638_0044117
446 Ga0495651_0003366
447 Ga0495651_0078170
448 Ga0495653_0149101
449 Ga0495580_0009120
450 Ga0495639_0162119
451 Ga0495664_0001274
452 Ga0495628_0003981
453 Ga0495652_0044504
454 Ga0495640_0025966
455 Ga0495587_0016517
456 Ga0495587_0129801
457 Ga0495645_0003823
458 Ga0495645_0014053
459 Ga0495667_0013651
460 Ga0495667_0096514
461 Ga0495599_0014375
462 Ga0495674_0029093
463 Ga0495674_0122868
464 Ga0495675_0040554
465 Ga0495675_0072076
466 Ga0495602_0006973
467 Ga0495602_0016677
468 Ga0496100_0009469
469 Ga0496101_0008507
470 Ga0496102_0021213
471 Ga0496103_0013090
472 Ga0496106_0025900
473 Ga0496112_0071899
474 Ga0496114_0069674
475 Ga0496115_0077023
476 Ga0501033_0021766
477 Ga0501034_0025034
478 Ga0501034_0049335
479 Ga0501034_0270513
480 Ga0501036_0002737
481 Ga0501037_0003163
482 Ga0501037_0146970
483 Ga0501038_0006420
484 Ga0501038_0106080
485 Ga0501043_0002896
486 Ga0501046_0018367
487 Ga0501047_0013215
488 Ga0501047_0014774
489 Ga0501067_0008260
490 Ga0501068_0002361
491 Ga0501070_0026841
492 Ga0501070_0116931
493 Ga0501070_0130677
494 Ga0501072_0004708
495 Ga0501073_0001753
496 Ga0501073_0134576
497 Ga0501074_0004180
498 Ga0501249_001047
499 Ga0501079_0016998
500 Ga0501080_0000247
501 Ga0501080_0258440
502 Ga0501083_0045007
503 Ga0501035_0004937
504 Ga0501035_0040042
505 Ga0501044_0001227
506 Ga0501044_0017686
507 Ga0501044_0078244
508 nmdc:mga08x19_1430_c1
509 nmdc:mga08x19_2890_c1
510 Ga0495601_0017049
511 Ga0495619_0018669
512 Ga0500555_000560
513 Ga0500592_008674
514 Ga0500568_0001922
515 Ga0500616_0000468
516 Ga0500645_000103
517 Ga0501084_0006960
518 Ga0501082_0000186
519 Ga0501082_0001609
520 Ga0501082_0388344

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6xg7-assembly1.cif.gz_A 1.3 a resolution structure of the of the nhl repeat region of d. melanogaster thin 0.8049 44 341
7qrw-assembly1.cif.gz_A crystal structure of nhl domain of trim3 0.7942 44 345
8ey4-assembly1.cif.gz_A contact-dependent growth inhibition toxin-immunity protein complex from e. coli o32:h37 0.7942 170 202
7qrx-assembly2.cif.gz_B crystal structure of nhl domain of trim71 0.7895 47 341
6fpt-assembly2.cif.gz_B crystal structure of danio rerio lin41 filamin-nhl domains 0.7895 35 341
ID Description Score Start End Superfamily
af_Q03601_890_974_2.40.10.500 Mainly Beta;Beta Barrel;Thrombin, subunit H; 0.9179 162 242 2.40.10.500
af_B7YZK8_1231_1339_2.40.10.500 Mainly Beta;Beta Barrel;Thrombin, subunit H; 0.9026 160 251 2.40.10.500
af_B7YZK8_1340_1431_2.40.10.500 Mainly Beta;Beta Barrel;Thrombin, subunit H; 0.8993 164 250 2.40.10.500
af_D3ZVM4_770_855_2.40.10.500 Mainly Beta;Beta Barrel;Thrombin, subunit H; 0.8759 160 242 2.40.10.500
af_F4JD91_235_354_2.120.10.30 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.8489 177 244 2.120.10.30
ID Description Score Start End GO Terms
AF-A0A6B1CEQ5-F1-model_v4 deleted 0.9766 29 345
AF-A0A6B1CEQ5-F1-model_v4 deleted 0.9675 29 345
AF-A0A7X3W6M5-F1-model_v4 deleted 0.9627 29 289
AF-A0A7C7WUL0-F1-model_v4 Peptidase 0.9584 202 345 GO:0000209
GO:0043161
GO:0061630
AF-A0A3N5HXN5-F1-model_v4 6-bladed beta-propeller 0.9557 170 345 GO:0005576

Map