F369821

General Info

Members Datasets Scaffolds Average Seq Length
260 177 520 138

Family's Representative Sequence

Representative Sequence 3300046542|Ga0495597_0003067|Ga0495597_0003067_9608_10036
Length 142
Sequence MRQAARTLIVQTRGAGLSEITAEVAAFVAGEAMTTGLLTLFCRHTSASLLIQENADPDVARDIEAYFARLAPESAAYRHQDEGPDDMPAHLRAALTQAQLSIPVVDGRLALGTWQGVWLFEHRARPHRREVVLHLMGDRAGE

Samples

Sample ID Description Type Environment
1 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
2 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
3 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
4 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
7 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
37 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
38 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
39 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
40 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
41 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
42 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
43 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
44 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
47 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
55 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
56 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
59 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
60 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
61 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
62 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
63 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
64 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
65 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
66 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
67 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
68 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
69 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
95 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
96 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
100 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
101 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
102 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
103 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
104 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
105 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
106 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
107 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
108 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
109 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
110 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
111 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
112 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
113 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
114 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
115 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
116 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
117 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
118 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
119 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
120 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
121 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
122 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
123 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
124 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
125 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
126 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
127 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
128 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
129 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
130 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
131 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
132 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
133 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
134 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
135 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
136 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
137 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
138 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
139 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
140 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
141 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
142 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
143 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
144 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
145 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
146 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
147 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
151 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
152 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
153 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
154 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
155 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
156 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
157 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
158 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
159 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
160 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
161 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
162 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
163 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
164 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
165 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
166 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
167 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
168 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
169 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
170 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
171 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
172 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
173 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
174 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
175 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
176 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
177 2738541293 Rhizobium sp. GV031 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.23
Metatranscriptomes 0
Isolates 0.77

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.38
Nodule 0.77
Rhizoplane 7.31
Rhizosphere 57.69
Stem 0
Stem Tuber 0
Unclassified 1.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495597_0003067 3300046542 Bacteria 10050
2 JGI25152J39213_1002936 3300002773 Bacteria 6074
3 JGI25152J39213_1005606 3300002773 Bacteria 3608
4 JGI25150J39212_1000785 3300002774 Bacteria 10860
5 JGI25151J46595_10000201 3300003187 Bacteria 73412
6 JGI25153J46596_10000838 3300003215 Bacteria 18810
7 JGI25160J50197_1005008 3300003354 Bacteria 5608
8 Ga0055526_1031369 3300003771 Bacteria 1525
9 Ga0070658_10088615 3300005327 Bacteria 2548
10 Ga0070670_100000566 3300005331 Bacteria 29318
11 Ga0070670_100005196 3300005331 Bacteria 10957
12 Ga0070666_10148330 3300005335 Bacteria 1636
13 Ga0070680_100282640 3300005336 Bacteria 1406
14 Ga0070668_100002214 3300005347 Bacteria 14281
15 Ga0070668_100010780 3300005347 Bacteria 6797
16 Ga0070668_100025127 3300005347 Bacteria 4516
17 Ga0070669_101351969 3300005353 Bacteria 617
18 Ga0070671_100007293 3300005355 Bacteria 8831
19 Ga0070659_101016864 3300005366 Bacteria 728
20 Ga0070667_100001837 3300005367 Bacteria 18915
21 Ga0070667_100313680 3300005367 Bacteria 1414
22 Ga0070711_100103424 3300005439 Bacteria 2076
23 Ga0070708_100623278 3300005445 Bacteria 1017
24 Ga0070663_100253005 3300005455 Bacteria 1395
25 Ga0070681_10028426 3300005458 Bacteria 5621
26 Ga0070681_10058402 3300005458 Bacteria 3837
27 Ga0070706_100041091 3300005467 Unclassified 4270
28 Ga0070698_102088927 3300005471 Bacteria 520
29 Ga0070679_100734541 3300005530 Bacteria 930
30 Ga0068853_101439256 3300005539 Bacteria 667
31 Ga0070686_100986118 3300005544 Bacteria 690
32 Ga0070665_100002907 3300005548 Bacteria 18504
33 Ga0070665_100109451 3300005548 Bacteria 2765
34 Ga0068855_100099518 3300005563 Bacteria 3349
35 Ga0068855_101373961 3300005563 Bacteria 729
36 Ga0068854_100147496 3300005578 Bacteria 1811
37 Ga0068856_100184849 3300005614 Bacteria 2098
38 Ga0068856_100842955 3300005614 Bacteria 936
39 Ga0068852_100225241 3300005616 Bacteria 1785
40 Ga0068859_100000093 3300005617 Bacteria 82384
41 Ga0068864_100000060 3300005618 Bacteria 124506
42 Ga0068864_102327502 3300005618 Bacteria 542
43 Ga0068863_100000023 3300005841 Bacteria 186490
44 Ga0068863_100002382 3300005841 Bacteria 18687
45 Ga0068858_100001294 3300005842 Bacteria 25828
46 Ga0068862_100038697 3300005844 Bacteria 4047
47 Ga0070717_10127158 3300006028 Bacteria 2189
48 Ga0075368_10001476 3300006042 Bacteria 7533
49 Ga0075364_10002561 3300006051 Bacteria 10185
50 Ga0075367_10009550 3300006178 Bacteria 5075
51 Ga0075366_10023353 3300006195 Bacteria 3602
52 Ga0075370_10454015 3300006353 Bacteria 771
53 Ga0075370_10555881 3300006353 Bacteria 694
54 Ga0075430_100212505 3300006846 Bacteria 1605
55 Ga0075431_100013566 3300006847 Bacteria 8237
56 Ga0075436_100538091 3300006914 Bacteria 857
57 Ga0097620_100000093 3300006931 Bacteria 82384
58 Ga0079104_1021514 3300006946 Bacteria 1754
59 Ga0105251_10031457 3300009011 Bacteria 2655
60 Ga0105251_10380756 3300009011 Bacteria 646
61 Ga0105240_10015148 3300009093 Bacteria 10493
62 Ga0105240_10037234 3300009093 Bacteria 6253
63 Ga0105240_10652794 3300009093 Bacteria 1153
64 Ga0105240_12081951 3300009093 Bacteria 589
65 Ga0105241_10099285 3300009174 Bacteria 2312
66 Ga0105241_10561301 3300009174 Bacteria 1026
67 Ga0105241_11805635 3300009174 Bacteria 597
68 Ga0105248_10006026 3300009177 Bacteria 13309
69 Ga0105248_10050350 3300009177 Bacteria 4671
70 Ga0105248_10666357 3300009177 Bacteria 1174
71 Ga0105238_10012659 3300009551 Bacteria 8514
72 Ga0105238_10122245 3300009551 Bacteria 2583
73 Ga0105238_10802858 3300009551 Bacteria 957
74 Ga0105249_10257282 3300009553 Bacteria 1733
75 Ga0105239_11520401 3300010375 Bacteria 774
76 Ga0105246_10531140 3300011119 Bacteria 1005
77 Ga0157370_10038893 3300013104 Bacteria 4600
78 Ga0163162_10025125 3300013306 Bacteria 5887
79 Ga0163163_10000959 3300014325 Bacteria 24491
80 Ga0163163_11389260 3300014325 Bacteria 764
81 Ga0157379_10000552 3300014968 Bacteria 30177
82 Ga0157379_10202219 3300014968 Bacteria 1796
83 Ga0213876_10011679 3300021384 Bacteria 4689
84 Ga0207425_1000055 3300025245 Bacteria 152820
85 Ga0209129_1000029 3300025258 Bacteria 401149
86 Ga0209129_1007407 3300025258 Bacteria 3277
87 Ga0209673_1002733 3300025273 Bacteria 11626
88 Ga0209673_1003012 3300025273 Bacteria 10452
89 Ga0209130_1025187 3300025284 Bacteria 1290
90 Ga0209025_1000070 3300025294 Bacteria 287776
91 Ga0209025_1005964 3300025294 Bacteria 9693
92 Ga0209564_1021006 3300025295 Bacteria 2368
93 Ga0209758_1000094 3300025297 Bacteria 241068
94 Ga0209256_1016488 3300025299 Bacteria 2514
95 Ga0209256_1019737 3300025299 Bacteria 2132
96 Ga0207426_1006544 3300025302 Bacteria 5038
97 Ga0209257_1001130 3300025304 Bacteria 34283
98 Ga0207680_10207966 3300025903 Bacteria 1337
99 Ga0207680_10679830 3300025903 Bacteria 737
100 Ga0207647_10075711 3300025904 Bacteria 2025
101 Ga0207705_10239480 3300025909 Bacteria 1382
102 Ga0207684_10032616 3300025910 Unclassified 4428
103 Ga0207654_10231713 3300025911 Bacteria 1230
104 Ga0207707_10058065 3300025912 Bacteria 3368
105 Ga0207707_10422497 3300025912 Bacteria 1143
106 Ga0207707_10577725 3300025912 Bacteria 953
107 Ga0207695_10015081 3300025913 Bacteria 9116
108 Ga0207695_11301654 3300025913 Bacteria 607
109 Ga0207681_10090636 3300025923 Bacteria 2182
110 Ga0207694_10112477 3300025924 Bacteria 2167
111 Ga0207694_10361879 3300025924 Bacteria 1202
112 Ga0207694_10612062 3300025924 Bacteria 916
113 Ga0207694_10724292 3300025924 Bacteria 839
114 Ga0207650_10000822 3300025925 Bacteria 23833
115 Ga0207650_10031674 3300025925 Bacteria 3821
116 Ga0207644_10019763 3300025931 Bacteria 4573
117 Ga0207706_10929496 3300025933 Bacteria 734
118 Ga0207711_10029737 3300025941 Bacteria 4609
119 Ga0207711_10037150 3300025941 Bacteria 4135
120 Ga0207711_10197543 3300025941 Bacteria 1835
121 Ga0207711_10334772 3300025941 Bacteria 1400
122 Ga0207667_10080074 3300025949 Bacteria 3385
123 Ga0207667_10547762 3300025949 Bacteria 1170
124 Ga0207667_10703897 3300025949 Bacteria 1012
125 Ga0207712_10670312 3300025961 Bacteria 903
126 Ga0207668_10000018 3300025972 Bacteria 158577
127 Ga0207668_10022736 3300025972 Bacteria 4019
128 Ga0207668_10026106 3300025972 Bacteria 3789
129 Ga0207640_10619935 3300025981 Bacteria 918
130 Ga0207658_10003660 3300025986 Bacteria 10850
131 Ga0207658_10015944 3300025986 Bacteria 5160
132 Ga0207703_10015297 3300026035 Bacteria 5985
133 Ga0207678_10849242 3300026067 Bacteria 807
134 Ga0207702_10289564 3300026078 Bacteria 1551
135 Ga0207641_10000067 3300026088 Bacteria 155379
136 Ga0207641_10008194 3300026088 Bacteria 8638
137 Ga0207676_10000501 3300026095 Bacteria 33019
138 Ga0207676_10106711 3300026095 Bacteria 2334
139 Ga0207698_10262350 3300026142 Bacteria 1588
140 Ga0209281_1018531 3300027111 Bacteria 1390
141 Ga0209813_10046675 3300027866 Bacteria 1339
142 Ga0268266_10002870 3300028379 Bacteria 17920
143 Ga0268266_10477567 3300028379 Bacteria 1188
144 Ga0268265_10006548 3300028380 Bacteria 7886
145 Ga0268265_10084507 3300028380 Bacteria 2516
146 Ga0268264_10034748 3300028381 Bacteria 4148
147 Ga0316578_10169893 3300031728 Unclassified 1314
148 Ga0316578_10734371 3300031728 Unclassified 574
149 Ga0307405_10001463 3300031731 Bacteria 9954
150 Ga0307413_10960801 3300031824 Bacteria 730
151 Ga0307412_10001246 3300031911 Bacteria 14409
152 Ga0307412_10621218 3300031911 Bacteria 918
153 Ga0307411_10104326 3300032005 Bacteria 2013
154 Ga0316583_10102968 3300032133 Bacteria 995
155 Ga0373943_0162674 3300035170 Bacteria 1216
156 Ga0316574_0369680 3300035398 Bacteria 906
157 Ga0373935_0658988 3300035692 Bacteria 768
158 Ga0395899_0140778 3300037312 Bacteria 1716
159 Ga0395900_0842946 3300037418 Bacteria 842
160 Ga0436365_0524433 3300039437 Bacteria 3950
161 Ga0439465_0031595 3300041413 Bacteria 1687
162 Ga0439465_0090106 3300041413 Bacteria 1048
163 Ga0451793_1044184 3300041452 Bacteria 894
164 Ga0439446_0316785 3300042156 Bacteria 550
165 Ga0466959_0462025 3300045049 Bacteria 860
166 Ga0451576_0874556 3300045051 Bacteria 943
167 Ga0495629_0066941 3300046459 Bacteria 2507
168 Ga0495606_0015648 3300046507 Bacteria 5829
169 Ga0495606_0289527 3300046507 Bacteria 892
170 Ga0495620_0057111 3300046515 Bacteria 1639
171 Ga0495632_0004987 3300046519 Bacteria 8895
172 Ga0495643_0065083 3300046522 Bacteria 1925
173 Ga0495642_0380408 3300046528 Bacteria 622
174 Ga0495625_0366130 3300046660 Bacteria 907
175 Ga0495669_0007227 3300046684 Bacteria 4654
176 Ga0496100_0639369 3300048903 Bacteria 828
177 Ga0496101_0084761 3300048904 Bacteria 2347
178 Ga0496101_0116971 3300048904 Bacteria 2012
179 Ga0496101_0162813 3300048904 Bacteria 1712
180 Ga0496101_0322134 3300048904 Bacteria 1213
181 Ga0496103_0098343 3300048906 Bacteria 1850
182 Ga0496103_0124645 3300048906 Bacteria 1642
183 Ga0496104_0005945 3300048907 Bacteria 10684
184 Ga0496105_0021181 3300048908 Bacteria 5259
185 Ga0496106_0093738 3300048909 Bacteria 2321
186 Ga0496106_0432381 3300048909 Bacteria 1058
187 Ga0496107_1363336 3300048910 Bacteria 506
188 Ga0496108_0464340 3300048911 Bacteria 1106
189 Ga0496110_0007653 3300048913 Bacteria 8645
190 Ga0496111_0174762 3300048914 Bacteria 1596
191 Ga0496112_0762666 3300048915 Bacteria 893
192 Ga0496113_0055230 3300048916 Bacteria 2976
193 Ga0496114_0412434 3300048917 Bacteria 1196
194 Ga0496116_0001460 3300048919 Bacteria 26485
195 Ga0496116_0010441 3300048919 Bacteria 7778
196 Ga0496116_0017667 3300048919 Bacteria 5527
197 Ga0496116_0143248 3300048919 Bacteria 1340
198 Ga0496117_0008189 3300048920 Bacteria 9976
199 Ga0496117_0014192 3300048920 Bacteria 6883
200 Ga0496117_0050517 3300048920 Bacteria 2948
201 Ga0496118_0020922 3300048921 Bacteria 5783
202 Ga0496119_0008017 3300048922 Bacteria 9383
203 Ga0496119_0017573 3300048922 Bacteria 5374
204 Ga0496121_0000053 3300048924 Bacteria 312611
205 Ga0496121_0002673 3300048924 Bacteria 26675
206 Ga0496121_0067606 3300048924 Bacteria 2895
207 Ga0496121_0130234 3300048924 Bacteria 1884
208 Ga0496121_0202613 3300048924 Bacteria 1413
209 Ga0496121_0324570 3300048924 Bacteria 1035
210 Ga0496122_0004459 3300048925 Bacteria 17355
211 Ga0496122_0011055 3300048925 Bacteria 9211
212 Ga0496122_0038424 3300048925 Bacteria 3836
213 Ga0496122_0260263 3300048925 Bacteria 963
214 Ga0496123_0002144 3300048926 Bacteria 25227
215 Ga0496123_0030634 3300048926 Bacteria 3935
216 Ga0496123_0039513 3300048926 Bacteria 3299
217 Ga0496123_0052906 3300048926 Bacteria 2688
218 Ga0496124_0004388 3300048927 Bacteria 16491
219 Ga0496124_0023641 3300048927 Bacteria 5606
220 Ga0496124_0037422 3300048927 Bacteria 4220
221 Ga0496124_0327620 3300048927 Bacteria 1093
222 Ga0496124_0437105 3300048927 Bacteria 896
223 Ga0496125_0001577 3300048928 Bacteria 32451
224 Ga0496125_0135712 3300048928 Bacteria 1721
225 Ga0496126_0029903 3300048929 Bacteria 5170
226 Ga0496126_0054462 3300048929 Bacteria 3623
227 Ga0501043_1005856 3300049579 Bacteria 593
228 Ga0501047_0011333 3300049581 Bacteria 8441
229 Ga0501047_0225278 3300049581 Bacteria 1730
230 Ga0501048_0149820 3300049582 Bacteria 1650
231 Ga0501044_1179857 3300049823 Bacteria 634
232 nmdc:mga03n38_119442_c1 3300050490 Bacteria 1293
233 nmdc:mga00v17_1028_c1 3300050491 Bacteria 14886
234 nmdc:mga0k408_715568_c1 3300050493 Bacteria 586
235 nmdc:mga0k408_91315_c1 3300050493 Bacteria 1789
236 nmdc:mga06z11_45523_c1 3300050494 Bacteria 2219
237 nmdc:mga04h51_9836_c1 3300050495 Bacteria 2608
238 nmdc:mga07m45_2104_c2 3300050496 Bacteria 1668
239 nmdc:mga07m45_231401_c2 3300050496 Bacteria 720
240 nmdc:mga0qj67_199986_c1 3300050509 Bacteria 1624
241 nmdc:mga06r32_85319_c1 3300050510 Bacteria 3079
242 Ga0500635_0000673 3300053080 Bacteria 8664
243 Ga0500578_0557746 3300053086 Bacteria 636
244 Ga0500643_028263 3300053087 Bacteria 1736
245 Ga0500569_003709 3300053109 Bacteria 3150
246 Ga0500595_011084 3300053119 Bacteria 3547
247 Ga0500608_011592 3300053122 Bacteria 3832
248 Ga0500618_035020 3300053125 Bacteria 1166
249 Ga0500658_0023224 3300053134 Bacteria 2366
250 Ga0500586_210940 3300053145 Bacteria 631
251 Ga0500590_023130 3300053148 Bacteria 3229
252 Ga0500638_138263 3300053162 Bacteria 1097
253 Ga0500636_0046412 3300053177 Bacteria 2561
254 Ga0500637_0180216 3300053178 Bacteria 1211
255 Ga0500625_037626 3300053729 Bacteria 2287
256 Ga0500645_003630 3300053730 Bacteria 6179
257 Ga0500596_002635 3300053735 Bacteria 3523
258 Ga0500601_008164 3300053737 Bacteria 1163
259 2585843327 2585427594 Bacteria 6180594
260 2738800182 2738541293 Bacteria 7065685
261 Ga0495597_0003067
262 JGI25152J39213_1002936
263 JGI25152J39213_1005606
264 JGI25150J39212_1000785
265 JGI25151J46595_10000201
266 JGI25153J46596_10000838
267 JGI25160J50197_1005008
268 Ga0055526_1031369
269 Ga0070658_10088615
270 Ga0070670_100000566
271 Ga0070670_100005196
272 Ga0070666_10148330
273 Ga0070680_100282640
274 Ga0070668_100002214
275 Ga0070668_100010780
276 Ga0070668_100025127
277 Ga0070669_101351969
278 Ga0070671_100007293
279 Ga0070659_101016864
280 Ga0070667_100001837
281 Ga0070667_100313680
282 Ga0070711_100103424
283 Ga0070708_100623278
284 Ga0070663_100253005
285 Ga0070681_10028426
286 Ga0070681_10058402
287 Ga0070706_100041091
288 Ga0070698_102088927
289 Ga0070679_100734541
290 Ga0068853_101439256
291 Ga0070686_100986118
292 Ga0070665_100002907
293 Ga0070665_100109451
294 Ga0068855_100099518
295 Ga0068855_101373961
296 Ga0068854_100147496
297 Ga0068856_100184849
298 Ga0068856_100842955
299 Ga0068852_100225241
300 Ga0068859_100000093
301 Ga0068864_100000060
302 Ga0068864_102327502
303 Ga0068863_100000023
304 Ga0068863_100002382
305 Ga0068858_100001294
306 Ga0068862_100038697
307 Ga0070717_10127158
308 Ga0075368_10001476
309 Ga0075364_10002561
310 Ga0075367_10009550
311 Ga0075366_10023353
312 Ga0075370_10454015
313 Ga0075370_10555881
314 Ga0075430_100212505
315 Ga0075431_100013566
316 Ga0075436_100538091
317 Ga0097620_100000093
318 Ga0079104_1021514
319 Ga0105251_10031457
320 Ga0105251_10380756
321 Ga0105240_10015148
322 Ga0105240_10037234
323 Ga0105240_10652794
324 Ga0105240_12081951
325 Ga0105241_10099285
326 Ga0105241_10561301
327 Ga0105241_11805635
328 Ga0105248_10006026
329 Ga0105248_10050350
330 Ga0105248_10666357
331 Ga0105238_10012659
332 Ga0105238_10122245
333 Ga0105238_10802858
334 Ga0105249_10257282
335 Ga0105239_11520401
336 Ga0105246_10531140
337 Ga0157370_10038893
338 Ga0163162_10025125
339 Ga0163163_10000959
340 Ga0163163_11389260
341 Ga0157379_10000552
342 Ga0157379_10202219
343 Ga0213876_10011679
344 Ga0207425_1000055
345 Ga0209129_1000029
346 Ga0209129_1007407
347 Ga0209673_1002733
348 Ga0209673_1003012
349 Ga0209130_1025187
350 Ga0209025_1000070
351 Ga0209025_1005964
352 Ga0209564_1021006
353 Ga0209758_1000094
354 Ga0209256_1016488
355 Ga0209256_1019737
356 Ga0207426_1006544
357 Ga0209257_1001130
358 Ga0207680_10207966
359 Ga0207680_10679830
360 Ga0207647_10075711
361 Ga0207705_10239480
362 Ga0207684_10032616
363 Ga0207654_10231713
364 Ga0207707_10058065
365 Ga0207707_10422497
366 Ga0207707_10577725
367 Ga0207695_10015081
368 Ga0207695_11301654
369 Ga0207681_10090636
370 Ga0207694_10112477
371 Ga0207694_10361879
372 Ga0207694_10612062
373 Ga0207694_10724292
374 Ga0207650_10000822
375 Ga0207650_10031674
376 Ga0207644_10019763
377 Ga0207706_10929496
378 Ga0207711_10029737
379 Ga0207711_10037150
380 Ga0207711_10197543
381 Ga0207711_10334772
382 Ga0207667_10080074
383 Ga0207667_10547762
384 Ga0207667_10703897
385 Ga0207712_10670312
386 Ga0207668_10000018
387 Ga0207668_10022736
388 Ga0207668_10026106
389 Ga0207640_10619935
390 Ga0207658_10003660
391 Ga0207658_10015944
392 Ga0207703_10015297
393 Ga0207678_10849242
394 Ga0207702_10289564
395 Ga0207641_10000067
396 Ga0207641_10008194
397 Ga0207676_10000501
398 Ga0207676_10106711
399 Ga0207698_10262350
400 Ga0209281_1018531
401 Ga0209813_10046675
402 Ga0268266_10002870
403 Ga0268266_10477567
404 Ga0268265_10006548
405 Ga0268265_10084507
406 Ga0268264_10034748
407 Ga0316578_10169893
408 Ga0316578_10734371
409 Ga0307405_10001463
410 Ga0307413_10960801
411 Ga0307412_10001246
412 Ga0307412_10621218
413 Ga0307411_10104326
414 Ga0316583_10102968
415 Ga0373943_0162674
416 Ga0316574_0369680
417 Ga0373935_0658988
418 Ga0395899_0140778
419 Ga0395900_0842946
420 Ga0436365_0524433
421 Ga0439465_0031595
422 Ga0439465_0090106
423 Ga0451793_1044184
424 Ga0439446_0316785
425 Ga0466959_0462025
426 Ga0451576_0874556
427 Ga0495629_0066941
428 Ga0495606_0015648
429 Ga0495606_0289527
430 Ga0495620_0057111
431 Ga0495632_0004987
432 Ga0495643_0065083
433 Ga0495642_0380408
434 Ga0495625_0366130
435 Ga0495669_0007227
436 Ga0496100_0639369
437 Ga0496101_0084761
438 Ga0496101_0116971
439 Ga0496101_0162813
440 Ga0496101_0322134
441 Ga0496103_0098343
442 Ga0496103_0124645
443 Ga0496104_0005945
444 Ga0496105_0021181
445 Ga0496106_0093738
446 Ga0496106_0432381
447 Ga0496107_1363336
448 Ga0496108_0464340
449 Ga0496110_0007653
450 Ga0496111_0174762
451 Ga0496112_0762666
452 Ga0496113_0055230
453 Ga0496114_0412434
454 Ga0496116_0001460
455 Ga0496116_0010441
456 Ga0496116_0017667
457 Ga0496116_0143248
458 Ga0496117_0008189
459 Ga0496117_0014192
460 Ga0496117_0050517
461 Ga0496118_0020922
462 Ga0496119_0008017
463 Ga0496119_0017573
464 Ga0496121_0000053
465 Ga0496121_0002673
466 Ga0496121_0067606
467 Ga0496121_0130234
468 Ga0496121_0202613
469 Ga0496121_0324570
470 Ga0496122_0004459
471 Ga0496122_0011055
472 Ga0496122_0038424
473 Ga0496122_0260263
474 Ga0496123_0002144
475 Ga0496123_0030634
476 Ga0496123_0039513
477 Ga0496123_0052906
478 Ga0496124_0004388
479 Ga0496124_0023641
480 Ga0496124_0037422
481 Ga0496124_0327620
482 Ga0496124_0437105
483 Ga0496125_0001577
484 Ga0496125_0135712
485 Ga0496126_0029903
486 Ga0496126_0054462
487 Ga0501043_1005856
488 Ga0501047_0011333
489 Ga0501047_0225278
490 Ga0501048_0149820
491 Ga0501044_1179857
492 nmdc:mga03n38_119442_c1
493 nmdc:mga00v17_1028_c1
494 nmdc:mga0k408_715568_c1
495 nmdc:mga0k408_91315_c1
496 nmdc:mga06z11_45523_c1
497 nmdc:mga04h51_9836_c1
498 nmdc:mga07m45_2104_c2
499 nmdc:mga07m45_231401_c2
500 nmdc:mga0qj67_199986_c1
501 nmdc:mga06r32_85319_c1
502 Ga0500635_0000673
503 Ga0500578_0557746
504 Ga0500643_028263
505 Ga0500569_003709
506 Ga0500595_011084
507 Ga0500608_011592
508 Ga0500618_035020
509 Ga0500658_0023224
510 Ga0500586_210940
511 Ga0500590_023130
512 Ga0500638_138263
513 Ga0500636_0046412
514 Ga0500637_0180216
515 Ga0500625_037626
516 Ga0500645_003630
517 Ga0500596_002635
518 Ga0500601_008164
519 2585843327
520 2738800182

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01894

UPF0047

Uncharacterised protein family UPF0047

19

135

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xbf-assembly1.cif.gz_C x-ray structure northeast structural genomics consortium target car10 from c. acetobutylicum 0.914 2 138
1xbf-assembly1.cif.gz_C x-ray structure northeast structural genomics consortium target car10 from c. acetobutylicum 0.8927 2 138
2p6h-assembly1.cif.gz_A crystal structure of hypothetical protein ape1520 from aeropyrum pernix k1 0.8913 1 140
1vmh-assembly1.cif.gz_A crystal structure of an uncharacterized conserved protein yjbq/upf0047 family, ortholog yugu b.subtilis (ca_c0907) from clostridium acetobutylicum at 1.31 a resolution 0.8843 4 139
2p6h-assembly1.cif.gz_A crystal structure of hypothetical protein ape1520 from aeropyrum pernix k1 0.8789 1 140
ID Description Score Start End Superfamily
af_P9WFP9_1_132_2.60.120.460 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.9019 1 140 2.60.120.460
af_O14155_1_138_2.60.120.460 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.8994 2 140 2.60.120.460
af_P9WFP9_1_132_2.60.120.460 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.8956 1 140 2.60.120.460
2p6hB00 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.8914 1 140 2.60.120.460
2cu5A00 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.8899 3 139 2.60.120.460
ID Description Score Start End GO Terms
AF-A0A7Y0AT87-F1-model_v4 YjbQ family protein 0.9674 2 140
AF-A0A7W6CM83-F1-model_v4 Secondary thiamine-phosphate synthase enzyme 0.9672 1 140
AF-A0A8B0HRL3-F1-model_v4 deleted 0.9631 1 140
AF-A0A0F5FVU4-F1-model_v4 Secondary thiamine-phosphate synthase 0.9626 2 140
AF-A0A1U9YY81-F1-model_v4 Secondary thiamine-phosphate synthase enzyme 0.9624 1 140

Map