F369761

General Info

Members Datasets Scaffolds Average Seq Length
260 162 520 199

Family's Representative Sequence

Representative Sequence 3300044683|Ga0466965_0046367|Ga0466965_0046367_1254_1904
Length 216
Sequence MTAAGAVGLNGGMEDDHPDLTDLPWPLSGADALRDELLAAYADPSRGHHGTRHLAEVLRRLDELAAAGATYERTPVLLAAWFHDAVYDGERDAEERSATWAEDALPAHADAATVAEVARLVRLTEHHRPEPADANGCALSDADLSILAAPRERYDEYVAAVRAEYAHLADDVFAAGRAEVLRALTDTPTLFRTAHGRSTWEQAARDNVTRELAGLP

Samples

Sample ID Description Type Environment
1 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
28 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
29 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
33 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
34 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
35 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
36 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
37 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
38 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
39 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
40 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
43 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
46 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
47 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
48 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
49 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
50 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
51 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
52 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
53 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
54 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
55 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
56 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
89 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
90 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
91 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
92 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
93 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
94 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
95 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
96 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
97 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
98 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
99 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
100 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
101 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
102 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
103 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
104 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
105 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
106 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
107 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
108 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
109 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
110 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
111 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
112 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
113 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
114 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
115 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
116 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
127 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
128 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
129 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
130 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
131 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
132 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
133 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
134 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
135 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
136 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
137 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
138 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
139 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
142 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
143 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
144 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
145 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
146 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
147 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
148 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
149 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
150 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
151 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
152 2643221576 Nocardioides sp. Root614 Isolate Unclassified
153 2643221590 Nocardioides sp. Root682 Isolate Unclassified
154 2643221604 Nocardioides sp. Root190 Isolate Unclassified
155 2643221617 Nocardioides sp. Root79 Isolate Unclassified
156 2643221620 Nocardioides sp. Root240 Isolate Unclassified
157 2738541305 Nocardioides sp. CF167 Isolate Unclassified
158 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
159 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
160 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
161 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
162 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.77
Metatranscriptomes 0
Isolates 4.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.46
Nodule 0
Rhizoplane 5
Rhizosphere 71.15
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466965_0046367 3300044683 Bacteria 2151
2 JGI24740J21852_10065066 3300001979 Bacteria 993
3 JGI24737J22298_10041009 3300001990 Bacteria 1420
4 Ga0070658_10043518 3300005327 Bacteria 3627
5 Ga0070658_10045669 3300005327 Bacteria 3542
6 Ga0070683_100011149 3300005329 Bacteria 7755
7 Ga0070683_100016797 3300005329 Bacteria 6456
8 Ga0070683_100096559 3300005329 Bacteria 2780
9 Ga0070666_10232520 3300005335 Bacteria 1302
10 Ga0070680_100420680 3300005336 Bacteria 1140
11 Ga0070682_100019148 3300005337 Bacteria 4011
12 Ga0070682_100487464 3300005337 Bacteria 952
13 Ga0068868_100148161 3300005338 Bacteria 1931
14 Ga0068868_101011038 3300005338 Bacteria 761
15 Ga0070660_100007397 3300005339 Bacteria 7648
16 Ga0070660_100040478 3300005339 Bacteria 3547
17 Ga0070660_100468641 3300005339 Bacteria 1046
18 Ga0070659_100093294 3300005366 Bacteria 2415
19 Ga0070667_100104369 3300005367 Bacteria 2452
20 Ga0070700_100145700 3300005441 Bacteria 1614
21 Ga0070694_100695567 3300005444 Bacteria 826
22 Ga0070678_100399958 3300005456 Bacteria 1193
23 Ga0070681_10222875 3300005458 Bacteria 1801
24 Ga0070679_100026372 3300005530 Bacteria 5708
25 Ga0070684_100015966 3300005535 Bacteria 6132
26 Ga0070684_100098688 3300005535 Bacteria 2606
27 Ga0070684_100324607 3300005535 Bacteria 1414
28 Ga0068853_100076812 3300005539 Bacteria 2917
29 Ga0070693_100148737 3300005547 Bacteria 1481
30 Ga0070665_100006294 3300005548 Bacteria 12125
31 Ga0068855_100525865 3300005563 Bacteria 1283
32 Ga0070664_100856243 3300005564 Bacteria 851
33 Ga0068857_100029148 3300005577 Bacteria 4871
34 Ga0068856_100024270 3300005614 Bacteria 5900
35 Ga0068852_100171156 3300005616 Bacteria 2036
36 Ga0068864_100009379 3300005618 Bacteria 8075
37 Ga0068866_10182989 3300005718 Bacteria 1239
38 Ga0068861_100097881 3300005719 Bacteria 2328
39 Ga0068861_100277506 3300005719 Bacteria 1442
40 Ga0068858_100022773 3300005842 Bacteria 5842
41 Ga0068860_100000393 3300005843 Bacteria 57188
42 Ga0068860_100233735 3300005843 Bacteria 1787
43 Ga0068860_100417911 3300005843 Bacteria 1329
44 Ga0075365_10001344 3300006038 Bacteria 11023
45 Ga0075365_10002668 3300006038 Bacteria 8865
46 Ga0075365_10011302 3300006038 Bacteria 5245
47 Ga0075365_10056941 3300006038 Bacteria 2600
48 Ga0075365_10059617 3300006038 Bacteria 2544
49 Ga0075365_10197552 3300006038 Bacteria 1409
50 Ga0075368_10012198 3300006042 Bacteria 3138
51 Ga0075368_10259302 3300006042 Bacteria 744
52 Ga0075363_100001511 3300006048 Bacteria 8880
53 Ga0075363_100021929 3300006048 Bacteria 3224
54 Ga0075363_100040035 3300006048 Bacteria 2469
55 Ga0075363_100050377 3300006048 Bacteria 2219
56 Ga0075364_10037173 3300006051 Bacteria 3151
57 Ga0075364_10061521 3300006051 Bacteria 2463
58 Ga0075364_10061545 3300006051 Bacteria 2463
59 Ga0075364_10099729 3300006051 Bacteria 1933
60 Ga0075364_10200986 3300006051 Bacteria 1351
61 Ga0075367_10105243 3300006178 Bacteria 1728
62 Ga0075367_10136107 3300006178 Bacteria 1520
63 Ga0075367_10145873 3300006178 Bacteria 1468
64 Ga0075370_10037360 3300006353 Bacteria 2730
65 Ga0075370_10053704 3300006353 Bacteria 2287
66 Ga0075370_10103097 3300006353 Bacteria 1653
67 Ga0075370_10154484 3300006353 Bacteria 1345
68 Ga0075428_100470910 3300006844 Bacteria 1345
69 Ga0075434_100830262 3300006871 Bacteria 940
70 Ga0068865_100299252 3300006881 Bacteria 1287
71 Ga0068865_100341037 3300006881 Bacteria 1211
72 Ga0105245_10017794 3300009098 Bacteria 6203
73 Ga0105243_10075804 3300009148 Bacteria 2731
74 Ga0105243_10174314 3300009148 Bacteria 1865
75 Ga0105242_10358276 3300009176 Bacteria 1349
76 Ga0105238_10246178 3300009551 Bacteria 1765
77 Ga0105249_10074334 3300009553 Bacteria 3146
78 Ga0105246_10016736 3300011119 Bacteria 4648
79 Ga0157369_10096758 3300013105 Bacteria 3149
80 Ga0157372_10003355 3300013307 Bacteria 17290
81 Ga0157375_10062597 3300013308 Bacteria 3698
82 Ga0163163_11540337 3300014325 Bacteria 726
83 Ga0182008_10177520 3300014497 Bacteria 1077
84 Ga0157377_10116116 3300014745 Bacteria 1616
85 Ga0157379_10036572 3300014968 Bacteria 4377
86 Ga0163161_10121654 3300017792 Bacteria 1962
87 Ga0213876_10133791 3300021384 Bacteria 1318
88 Ga0207688_10124204 3300025901 Bacteria 1508
89 Ga0207680_10196872 3300025903 Bacteria 1371
90 Ga0207647_10031793 3300025904 Bacteria 3395
91 Ga0207647_10063507 3300025904 Bacteria 2246
92 Ga0207705_10200745 3300025909 Bacteria 1511
93 Ga0207705_10765124 3300025909 Bacteria 750
94 Ga0207707_10188218 3300025912 Bacteria 1801
95 Ga0207671_10657936 3300025914 Bacteria 834
96 Ga0207660_10362486 3300025917 Bacteria 1163
97 Ga0207657_10027371 3300025919 Bacteria 5223
98 Ga0207657_10237476 3300025919 Bacteria 1456
99 Ga0207652_10016360 3300025921 Bacteria 6055
100 Ga0207694_10492403 3300025924 Bacteria 1026
101 Ga0207659_10194055 3300025926 Bacteria 1617
102 Ga0207690_10144059 3300025932 Bacteria 1759
103 Ga0207686_10033351 3300025934 Bacteria 3073
104 Ga0207709_10142230 3300025935 Bacteria 1650
105 Ga0207709_10418519 3300025935 Bacteria 1029
106 Ga0207704_10102582 3300025938 Bacteria 1911
107 Ga0207704_10269477 3300025938 Bacteria 1288
108 Ga0207711_11076633 3300025941 Bacteria 744
109 Ga0207661_10065881 3300025944 Bacteria 2941
110 Ga0207661_10139890 3300025944 Bacteria 2082
111 Ga0207679_10661240 3300025945 Bacteria 946
112 Ga0207667_10413857 3300025949 Bacteria 1372
113 Ga0207712_10042190 3300025961 Bacteria 3140
114 Ga0207658_10214613 3300025986 Bacteria 1615
115 Ga0207677_10123331 3300026023 Bacteria 1953
116 Ga0207677_10309888 3300026023 Bacteria 1307
117 Ga0207639_10131198 3300026041 Bacteria 2075
118 Ga0207708_10022118 3300026075 Bacteria 4802
119 Ga0207702_10224616 3300026078 Bacteria 1751
120 Ga0207702_10262787 3300026078 Bacteria 1626
121 Ga0207676_10014910 3300026095 Bacteria 5599
122 Ga0207674_10100813 3300026116 Bacteria 2868
123 Ga0207675_100176787 3300026118 Bacteria 2042
124 Ga0207675_100315518 3300026118 Bacteria 1525
125 Ga0207683_10383655 3300026121 Bacteria 1292
126 Ga0207698_10170011 3300026142 Bacteria 1918
127 Ga0268266_10001692 3300028379 Bacteria 25320
128 Ga0268266_10793823 3300028379 Bacteria 914
129 Ga0268266_10825443 3300028379 Bacteria 896
130 Ga0268264_10000468 3300028381 Bacteria 54851
131 Ga0268264_10027966 3300028381 Bacteria 4611
132 Ga0268264_10650813 3300028381 Bacteria 1043
133 Ga0307408_100666695 3300031548 Bacteria 932
134 Ga0307410_10155438 3300031852 Bacteria 1708
135 Ga0307410_10183746 3300031852 Bacteria 1585
136 Ga0307406_10341866 3300031901 Bacteria 1166
137 Ga0307409_100499070 3300031995 Bacteria 1185
138 Ga0307416_100420198 3300032002 Bacteria 1381
139 Ga0307415_100554268 3300032126 Bacteria 1015
140 Ga0395900_0818438 3300037418 Bacteria 858
141 Ga0395898_0546115 3300037466 Bacteria 1101
142 Ga0395905_0042912 3300037471 Bacteria 4244
143 Ga0395905_0884545 3300037471 Bacteria 796
144 Ga0395901_0409489 3300038443 Bacteria 1392
145 Ga0436365_0452602 3300039437 Bacteria 1720
146 Ga0451837_1030905 3300041494 Bacteria 1118
147 Ga0450907_012530 3300042146 Bacteria 1412
148 Ga0466972_0042430 3300044658 Bacteria 2212
149 Ga0466972_0145607 3300044658 Bacteria 1115
150 Ga0466965_0033323 3300044683 Bacteria 2517
151 Ga0466965_0094138 3300044683 Bacteria 1526
152 Ga0466963_0007128 3300044694 Bacteria 6661
153 Ga0466963_0137897 3300044694 Bacteria 1689
154 Ga0466963_0397551 3300044694 Bacteria 972
155 Ga0466964_0026868 3300044706 Bacteria 2255
156 Ga0466964_0041751 3300044706 Bacteria 1856
157 Ga0466970_0006755 3300044765 Bacteria 5742
158 Ga0466970_0025485 3300044765 Bacteria 3097
159 Ga0466957_0160028 3300044842 Bacteria 1462
160 Ga0466960_0035817 3300044901 Bacteria 2321
161 Ga0466960_0352099 3300044901 Bacteria 840
162 Ga0466967_0032351 3300045976 Bacteria 4415
163 Ga0466967_0066504 3300045976 Bacteria 3212
164 Ga0466967_0141627 3300045976 Bacteria 2240
165 Ga0466967_0157737 3300045976 Bacteria 2127
166 Ga0466967_0200190 3300045976 Bacteria 1891
167 Ga0466967_0224003 3300045976 Bacteria 1788
168 Ga0466967_0302078 3300045976 Bacteria 1540
169 Ga0466967_0349471 3300045976 Bacteria 1431
170 Ga0496101_0192060 3300048904 Bacteria 1576
171 Ga0496106_0156012 3300048909 Bacteria 1803
172 Ga0496107_0132332 3300048910 Bacteria 1842
173 Ga0496109_0069805 3300048912 Bacteria 3223
174 Ga0496109_0080868 3300048912 Bacteria 2994
175 Ga0496109_0798226 3300048912 Bacteria 882
176 Ga0496110_0004386 3300048913 Bacteria 10930
177 Ga0496110_0255911 3300048913 Bacteria 1594
178 Ga0496111_0000126 3300048914 Bacteria 33612
179 Ga0496111_0404036 3300048914 Bacteria 1009
180 Ga0496113_0620020 3300048916 Bacteria 866
181 Ga0496114_0032402 3300048917 Bacteria 4302
182 Ga0496114_1122563 3300048917 Bacteria 671
183 Ga0501032_0104053 3300049569 Bacteria 1881
184 Ga0501032_0443278 3300049569 Bacteria 832
185 Ga0501037_0413247 3300049573 Bacteria 924
186 Ga0501038_0281275 3300049574 Bacteria 1310
187 Ga0501038_0514468 3300049574 Bacteria 914
188 Ga0501039_0191554 3300049575 Bacteria 1608
189 Ga0501040_0372321 3300049576 Bacteria 1024
190 Ga0501040_0372666 3300049576 Bacteria 1024
191 Ga0501041_0081161 3300049577 Bacteria 1997
192 Ga0501042_0137644 3300049578 Bacteria 1760
193 Ga0501043_0137267 3300049579 Bacteria 1916
194 Ga0501047_0112257 3300049581 Bacteria 2608
195 Ga0501047_0809940 3300049581 Bacteria 751
196 Ga0501048_0391088 3300049582 Bacteria 993
197 Ga0501067_0004476 3300049583 Bacteria 7707
198 Ga0501068_0102660 3300049584 Bacteria 1773
199 Ga0501069_0109936 3300049585 Bacteria 1569
200 Ga0501069_0170738 3300049585 Bacteria 1255
201 Ga0501069_0228372 3300049585 Bacteria 1083
202 Ga0501070_0009626 3300049586 Bacteria 8166
203 Ga0501070_0107578 3300049586 Bacteria 2304
204 Ga0501070_0158954 3300049586 Bacteria 1863
205 Ga0501071_0003814 3300049587 Bacteria 9479
206 Ga0501071_0229515 3300049587 Bacteria 1398
207 Ga0501072_0206559 3300049588 Bacteria 1566
208 Ga0501072_0747246 3300049588 Bacteria 767
209 Ga0501073_0016263 3300049589 Bacteria 5391
210 Ga0501074_0392029 3300049590 Bacteria 985
211 Ga0501076_0252898 3300049592 Bacteria 1442
212 Ga0501077_0227893 3300049593 Bacteria 1184
213 Ga0501079_0103177 3300049741 Bacteria 2212
214 Ga0501080_0076784 3300049742 Bacteria 3106
215 Ga0501080_0678715 3300049742 Bacteria 910
216 Ga0501080_1099648 3300049742 Bacteria 686
217 Ga0501083_0233261 3300049744 Bacteria 1198
218 Ga0501035_0219244 3300049822 Bacteria 1625
219 Ga0501044_0252566 3300049823 Bacteria 1704
220 Ga0501045_0219353 3300049824 Bacteria 1416
221 Ga0501045_0219951 3300049824 Bacteria 1414
222 nmdc:mga03n38_18958_c1 3300050490 Bacteria 2724
223 nmdc:mga03n38_83879_c1 3300050490 Bacteria 1503
224 nmdc:mga00v17_152624_c1 3300050491 Bacteria 1484
225 nmdc:mga00v17_156823_c1 3300050491 Bacteria 1464
226 nmdc:mga00v17_170984_c1 3300050491 Bacteria 1401
227 nmdc:mga00v17_212056_c1 3300050491 Bacteria 1253
228 nmdc:mga00v17_45071_c1 3300050491 Bacteria 2663
229 nmdc:mga00v17_76395_c1 3300050491 Bacteria 2084
230 nmdc:mga0yw44_103079_c2 3300050492 Bacteria 805
231 nmdc:mga0yw44_236785_c1 3300050492 Bacteria 1213
232 nmdc:mga0yw44_270381_c1 3300050492 Bacteria 1134
233 nmdc:mga0yw44_30736_c1 3300050492 Bacteria 3116
234 nmdc:mga0yw44_488277_c1 3300050492 Bacteria 835
235 nmdc:mga0yw44_70917_c1 3300050492 Bacteria 2162
236 nmdc:mga0yw44_7926_c1 3300050492 Bacteria 5262
237 nmdc:mga0yw44_80377_c1 3300050492 Bacteria 2042
238 nmdc:mga0yw44_90902_c1 3300050492 Bacteria 1929
239 nmdc:mga06z11_14915_c1 3300050494 Bacteria 3455
240 nmdc:mga06z11_48479_c1 3300050494 Bacteria 2162
241 nmdc:mga07m45_100296_c1 3300050496 Bacteria 1662
242 nmdc:mga07m45_76409_c1 3300050496 Bacteria 1909
243 nmdc:mga0n895_482859_c1 3300050512 Bacteria 1249
244 Ga0500644_0001106 3300053088 Bacteria 7945
245 Ga0500644_0062892 3300053088 Bacteria 1313
246 Ga0500573_0097610 3300053140 Bacteria 1655
247 Ga0501084_0202420 3300054114 Bacteria 1675
248 Ga0501084_0259022 3300054114 Bacteria 1468
249 Ga0530510_0212625 3300061734 Bacteria 1437
250 2643890274 2643221576 Bacteria 5214352
251 2643959330 2643221590 Bacteria 5214697
252 2644033216 2643221604 Bacteria 5014917
253 2644098264 2643221617 Bacteria 5139111
254 2644119009 2643221620 Bacteria 5134593
255 2738869960 2738541305 Bacteria 4910150
256 2774396339 2773857762 Bacteria 5971770
257 2809197994 2808606439 Bacteria 5952208
258 2812334522 2811994874 Bacteria 5367947
259 2812353316 2811994878 Bacteria 5992952
260 2891969062 2891968417 Bacteria 5821697
261 Ga0466965_0046367
262 JGI24740J21852_10065066
263 JGI24737J22298_10041009
264 Ga0070658_10043518
265 Ga0070658_10045669
266 Ga0070683_100011149
267 Ga0070683_100016797
268 Ga0070683_100096559
269 Ga0070666_10232520
270 Ga0070680_100420680
271 Ga0070682_100019148
272 Ga0070682_100487464
273 Ga0068868_100148161
274 Ga0068868_101011038
275 Ga0070660_100007397
276 Ga0070660_100040478
277 Ga0070660_100468641
278 Ga0070659_100093294
279 Ga0070667_100104369
280 Ga0070700_100145700
281 Ga0070694_100695567
282 Ga0070678_100399958
283 Ga0070681_10222875
284 Ga0070679_100026372
285 Ga0070684_100015966
286 Ga0070684_100098688
287 Ga0070684_100324607
288 Ga0068853_100076812
289 Ga0070693_100148737
290 Ga0070665_100006294
291 Ga0068855_100525865
292 Ga0070664_100856243
293 Ga0068857_100029148
294 Ga0068856_100024270
295 Ga0068852_100171156
296 Ga0068864_100009379
297 Ga0068866_10182989
298 Ga0068861_100097881
299 Ga0068861_100277506
300 Ga0068858_100022773
301 Ga0068860_100000393
302 Ga0068860_100233735
303 Ga0068860_100417911
304 Ga0075365_10001344
305 Ga0075365_10002668
306 Ga0075365_10011302
307 Ga0075365_10056941
308 Ga0075365_10059617
309 Ga0075365_10197552
310 Ga0075368_10012198
311 Ga0075368_10259302
312 Ga0075363_100001511
313 Ga0075363_100021929
314 Ga0075363_100040035
315 Ga0075363_100050377
316 Ga0075364_10037173
317 Ga0075364_10061521
318 Ga0075364_10061545
319 Ga0075364_10099729
320 Ga0075364_10200986
321 Ga0075367_10105243
322 Ga0075367_10136107
323 Ga0075367_10145873
324 Ga0075370_10037360
325 Ga0075370_10053704
326 Ga0075370_10103097
327 Ga0075370_10154484
328 Ga0075428_100470910
329 Ga0075434_100830262
330 Ga0068865_100299252
331 Ga0068865_100341037
332 Ga0105245_10017794
333 Ga0105243_10075804
334 Ga0105243_10174314
335 Ga0105242_10358276
336 Ga0105238_10246178
337 Ga0105249_10074334
338 Ga0105246_10016736
339 Ga0157369_10096758
340 Ga0157372_10003355
341 Ga0157375_10062597
342 Ga0163163_11540337
343 Ga0182008_10177520
344 Ga0157377_10116116
345 Ga0157379_10036572
346 Ga0163161_10121654
347 Ga0213876_10133791
348 Ga0207688_10124204
349 Ga0207680_10196872
350 Ga0207647_10031793
351 Ga0207647_10063507
352 Ga0207705_10200745
353 Ga0207705_10765124
354 Ga0207707_10188218
355 Ga0207671_10657936
356 Ga0207660_10362486
357 Ga0207657_10027371
358 Ga0207657_10237476
359 Ga0207652_10016360
360 Ga0207694_10492403
361 Ga0207659_10194055
362 Ga0207690_10144059
363 Ga0207686_10033351
364 Ga0207709_10142230
365 Ga0207709_10418519
366 Ga0207704_10102582
367 Ga0207704_10269477
368 Ga0207711_11076633
369 Ga0207661_10065881
370 Ga0207661_10139890
371 Ga0207679_10661240
372 Ga0207667_10413857
373 Ga0207712_10042190
374 Ga0207658_10214613
375 Ga0207677_10123331
376 Ga0207677_10309888
377 Ga0207639_10131198
378 Ga0207708_10022118
379 Ga0207702_10224616
380 Ga0207702_10262787
381 Ga0207676_10014910
382 Ga0207674_10100813
383 Ga0207675_100176787
384 Ga0207675_100315518
385 Ga0207683_10383655
386 Ga0207698_10170011
387 Ga0268266_10001692
388 Ga0268266_10793823
389 Ga0268266_10825443
390 Ga0268264_10000468
391 Ga0268264_10027966
392 Ga0268264_10650813
393 Ga0307408_100666695
394 Ga0307410_10155438
395 Ga0307410_10183746
396 Ga0307406_10341866
397 Ga0307409_100499070
398 Ga0307416_100420198
399 Ga0307415_100554268
400 Ga0395900_0818438
401 Ga0395898_0546115
402 Ga0395905_0042912
403 Ga0395905_0884545
404 Ga0395901_0409489
405 Ga0436365_0452602
406 Ga0451837_1030905
407 Ga0450907_012530
408 Ga0466972_0042430
409 Ga0466972_0145607
410 Ga0466965_0033323
411 Ga0466965_0094138
412 Ga0466963_0007128
413 Ga0466963_0137897
414 Ga0466963_0397551
415 Ga0466964_0026868
416 Ga0466964_0041751
417 Ga0466970_0006755
418 Ga0466970_0025485
419 Ga0466957_0160028
420 Ga0466960_0035817
421 Ga0466960_0352099
422 Ga0466967_0032351
423 Ga0466967_0066504
424 Ga0466967_0141627
425 Ga0466967_0157737
426 Ga0466967_0200190
427 Ga0466967_0224003
428 Ga0466967_0302078
429 Ga0466967_0349471
430 Ga0496101_0192060
431 Ga0496106_0156012
432 Ga0496107_0132332
433 Ga0496109_0069805
434 Ga0496109_0080868
435 Ga0496109_0798226
436 Ga0496110_0004386
437 Ga0496110_0255911
438 Ga0496111_0000126
439 Ga0496111_0404036
440 Ga0496113_0620020
441 Ga0496114_0032402
442 Ga0496114_1122563
443 Ga0501032_0104053
444 Ga0501032_0443278
445 Ga0501037_0413247
446 Ga0501038_0281275
447 Ga0501038_0514468
448 Ga0501039_0191554
449 Ga0501040_0372321
450 Ga0501040_0372666
451 Ga0501041_0081161
452 Ga0501042_0137644
453 Ga0501043_0137267
454 Ga0501047_0112257
455 Ga0501047_0809940
456 Ga0501048_0391088
457 Ga0501067_0004476
458 Ga0501068_0102660
459 Ga0501069_0109936
460 Ga0501069_0170738
461 Ga0501069_0228372
462 Ga0501070_0009626
463 Ga0501070_0107578
464 Ga0501070_0158954
465 Ga0501071_0003814
466 Ga0501071_0229515
467 Ga0501072_0206559
468 Ga0501072_0747246
469 Ga0501073_0016263
470 Ga0501074_0392029
471 Ga0501076_0252898
472 Ga0501077_0227893
473 Ga0501079_0103177
474 Ga0501080_0076784
475 Ga0501080_0678715
476 Ga0501080_1099648
477 Ga0501083_0233261
478 Ga0501035_0219244
479 Ga0501044_0252566
480 Ga0501045_0219353
481 Ga0501045_0219951
482 nmdc:mga03n38_18958_c1
483 nmdc:mga03n38_83879_c1
484 nmdc:mga00v17_152624_c1
485 nmdc:mga00v17_156823_c1
486 nmdc:mga00v17_170984_c1
487 nmdc:mga00v17_212056_c1
488 nmdc:mga00v17_45071_c1
489 nmdc:mga00v17_76395_c1
490 nmdc:mga0yw44_103079_c2
491 nmdc:mga0yw44_236785_c1
492 nmdc:mga0yw44_270381_c1
493 nmdc:mga0yw44_30736_c1
494 nmdc:mga0yw44_488277_c1
495 nmdc:mga0yw44_70917_c1
496 nmdc:mga0yw44_7926_c1
497 nmdc:mga0yw44_80377_c1
498 nmdc:mga0yw44_90902_c1
499 nmdc:mga06z11_14915_c1
500 nmdc:mga06z11_48479_c1
501 nmdc:mga07m45_100296_c1
502 nmdc:mga07m45_76409_c1
503 nmdc:mga0n895_482859_c1
504 Ga0500644_0001106
505 Ga0500644_0062892
506 Ga0500573_0097610
507 Ga0501084_0202420
508 Ga0501084_0259022
509 Ga0530510_0212625
510 2643890274
511 2643959330
512 2644033216
513 2644098264
514 2644119009
515 2738869960
516 2774396339
517 2809197994
518 2812334522
519 2812353316
520 2891969062

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2pq7-assembly1.cif.gz_A-2 crystal structure of predicted hd superfamily hydrolase (104161995) from uncultured thermotogales bacterium at 1.45 a resolution 0.6612 14 201
6pc1-assembly2.cif.gz_D crystal structure of helicobacter pylori ppx/gppa (e143a) in complex with ppgpp 0.6522 20 125
4g2w-assembly1.cif.gz_A crystal structure of pde5a in complex with its inhibitor 0.6514 19 197
5edi-assembly2.cif.gz_B crystal structure of human phosphodiesterase 10 in complex with c2(c(n1nc(nc1c(c2)c)ccc3nc(nn3c)n4cccc4)c)cl, micromolar ic50=0.000279 0.6495 18 204
5dqw-assembly1.cif.gz_A the crystal structure of bacillus subtilis ypgq in complex with adp 0.6403 2 195
ID Description Score Start End Superfamily
af_Q4D8L8_47_257_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.8587 17 160 1.10.3210.10
af_Q54GY3_13_181_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.8375 6 161 1.10.3210.10
af_Q54GY3_13_181_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.7745 6 161 1.10.3210.10
af_Q9W136_10_170_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.7499 14 160 1.10.3210.10
af_P9WN29_336_562_1.10.3090.10 Mainly Alpha;Orthogonal Bundle;cca-adding enzyme, domain 2;cca-adding enzyme, domain 2 0.6934 12 124 1.10.3090.10
ID Description Score Start End GO Terms
AF-A0A2C9ZJM6-F1-model_v4 Metal-dependent phosphohydrolase 0.992 15 196
AF-A0A7J5DRI6-F1-model_v4 Metal-dependent phosphohydrolase 0.9859 22 198
AF-A0A542SDQ6-F1-model_v4 Putative metal-dependent HD superfamily phosphohydrolase 0.9824 8 195 GO:0016787
AF-A0A3A9WAE7-F1-model_v4 Metal-dependent phosphohydrolase 0.9819 5 195 GO:0016787
AF-A0A849ZAV6-F1-model_v4 Uncharacterized protein 0.9811 126 196

Map