F369757
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 260 | 156 | 250 | 368 |
Family's Representative Sequence
| Representative Sequence | 3300044658|Ga0466972_0003919|Ga0466972_0003919_4597_5937 |
| Length | 413 |
| Sequence | MKTFIKALTTRQNKLTRRNPAFHIPGDAARQLCGKKGGFYVSYRPMNTAHHWFIRYKLYHIPFWLVYHYCWWAAAVGSPAKAAASIFSVYVIKYLFYVVFQALAVYFNLYFLIPRYLEKSRFAEYITYLVLTILIAAACIVPGYYLTTIVSGRSPKELYGVDSFNLYYLYTGSPLSSSVASMTLAMSIKLAKNWLQTRQRHQQLEKEKLETELNFLKYQFNPHFLFNTINSIFFLIHKNPDMASASLAKFSELLRHQLYECNDKQILLSKEIAYLENSIELEKLRQNDNVEVSLQVDQLPFEELGIAPFILMTFVENAFKHVSKETDKRNWIRIRLHLDGRQLDFSVSNSIAPVPTEVMHYGGIGLKNVQRRLDLIYPGQYDLDIKNSNISFEVRLRLQLSGLTMQRPIPRTA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2522125168 | Dyadobacter beijingensis DSM 21582 | Isolate | Rhizosphere |
| 2 | 2818991442 | Chitinophaga pinensis 1204 | Isolate | Unclassified |
| 3 | 2919437846 | Mucilaginibacter pocheonensis 3262 | Isolate | Rhizosphere |
| 4 | 2929177148 | Chitinophaga sp. R-72269 Hybrid assembly | Isolate | Unclassified |
| 5 | 2929239360 | Chitinophaga sp. R-73072 Hybrid assembly | Isolate | Unclassified |
| 6 | 2929921140 | Chitinophaga sp. R-72609 Hybrid assembly | Isolate | Unclassified |
| 7 | 2945977869 | Chitinophaga sp. W2I13 | Isolate | Rhizosphere |
| 8 | 2946013367 | Chitinophaga sp. W3I9 | Isolate | Rhizosphere |
| 9 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 10 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 11 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 12 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 13 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 14 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 15 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 16 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 17 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 18 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 19 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 20 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 21 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 22 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 25 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 27 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 32 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 33 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 36 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 37 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 38 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 39 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 40 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 41 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 42 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 43 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 44 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 45 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 46 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 48 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 49 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 70 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 72 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 73 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 74 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 75 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 76 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 77 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 78 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 79 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 108 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 109 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 110 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 111 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 112 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 113 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 114 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 115 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 116 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 117 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 118 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 119 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 120 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 121 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 122 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 123 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 124 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 125 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 126 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 139 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 140 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 142 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 143 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 144 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 145 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 146 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 147 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 148 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 149 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 150 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 151 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 152 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 153 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 154 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 155 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 156 | 8003151029 | Chitinophaga sp. GbtcB8 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.15 |
| Metatranscriptomes | 0 |
| Isolates | 3.85 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.69 |
| Nodule | 0 |
| Rhizoplane | 0 |
| Rhizosphere | 75 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12.31 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10004600 | 3300001979 | Bacteria | 5932 |
| 2 | JGI25154J39366_1000016 | 3300002738 | Bacteria | 255057 |
| 3 | JGI25157J39369_1006062 | 3300002741 | Bacteria | 1887 |
| 4 | rootH1_10138601 | 3300003316 | Bacteria | 5803 |
| 5 | rootH2_10001944 | 3300003320 | Bacteria | 18158 |
| 6 | rootH2_10002437 | 3300003320 | Bacteria | 6611 |
| 7 | rootH2_10004626 | 3300003320 | Bacteria | 9058 |
| 8 | rootH2_10014180 | 3300003320 | Bacteria | 13289 |
| 9 | rootH2_10076271 | 3300003320 | Bacteria | 4282 |
| 10 | rootL2_10048356 | 3300003322 | Bacteria | 3469 |
| 11 | rootL2_10175446 | 3300003322 | Bacteria | 2173 |
| 12 | rootH1_10017298 | 3300003323 | Bacteria | 12898 |
| 13 | rootH1_10061083 | 3300003323 | Bacteria | 11019 |
| 14 | rootH1_10209329 | 3300003323 | Bacteria | 6768 |
| 15 | rootH1_10222474 | 3300003323 | Bacteria | 2017 |
| 16 | JGI25160J50197_1000835 | 3300003354 | Bacteria | 16456 |
| 17 | JGI25160J50197_1006712 | 3300003354 | Bacteria | 4622 |
| 18 | Ga0055536_1010028 | 3300003781 | Bacteria | 3826 |
| 19 | Ga0055531_10000076 | 3300003794 | Bacteria | 106998 |
| 20 | Ga0065165_1000085 | 3300005262 | Bacteria | 154355 |
| 21 | Ga0065165_1000603 | 3300005262 | Bacteria | 52556 |
| 22 | Ga0065165_1006588 | 3300005262 | Bacteria | 6033 |
| 23 | Ga0065714_10069197 | 3300005288 | Bacteria | 4343 |
| 24 | Ga0065704_10166443 | 3300005289 | Unclassified | 1319 |
| 25 | Ga0070676_10001009 | 3300005328 | Bacteria | 13957 |
| 26 | Ga0070683_100306750 | 3300005329 | Bacteria | 1510 |
| 27 | Ga0068869_100106821 | 3300005334 | Bacteria | 2125 |
| 28 | Ga0068869_100315783 | 3300005334 | Bacteria | 1266 |
| 29 | Ga0070666_10000424 | 3300005335 | Bacteria | 26177 |
| 30 | Ga0070666_10017970 | 3300005335 | Unclassified | 4539 |
| 31 | Ga0070666_10113448 | 3300005335 | Bacteria | 1875 |
| 32 | Ga0068868_100012799 | 3300005338 | Bacteria | 6137 |
| 33 | Ga0070671_100054596 | 3300005355 | Bacteria | 3322 |
| 34 | Ga0070671_100056352 | 3300005355 | Bacteria | 3270 |
| 35 | Ga0070673_100045012 | 3300005364 | Bacteria | 3420 |
| 36 | Ga0070667_100014864 | 3300005367 | Bacteria | 6430 |
| 37 | Ga0070678_100000507 | 3300005456 | Bacteria | 18795 |
| 38 | Ga0068867_100001225 | 3300005459 | Bacteria | 17675 |
| 39 | Ga0068853_100002461 | 3300005539 | Bacteria | 13862 |
| 40 | Ga0068853_100006691 | 3300005539 | Bacteria | 9181 |
| 41 | Ga0070672_100204658 | 3300005543 | Bacteria | 1651 |
| 42 | Ga0070665_100000008 | 3300005548 | Bacteria | 606341 |
| 43 | Ga0070665_100000083 | 3300005548 | Bacteria | 181044 |
| 44 | Ga0068856_100030559 | 3300005614 | Bacteria | 5265 |
| 45 | Ga0068852_100003993 | 3300005616 | Bacteria | 10372 |
| 46 | Ga0068859_100000960 | 3300005617 | Bacteria | 29521 |
| 47 | Ga0068859_100056318 | 3300005617 | Bacteria | 3956 |
| 48 | Ga0068864_100024875 | 3300005618 | Bacteria | 5037 |
| 49 | Ga0068866_10123435 | 3300005718 | Bacteria | 1463 |
| 50 | Ga0068851_10004927 | 3300005834 | Bacteria | 6048 |
| 51 | Ga0068851_10006220 | 3300005834 | Bacteria | 5448 |
| 52 | Ga0068870_10104307 | 3300005840 | Bacteria | 1608 |
| 53 | Ga0068863_100015688 | 3300005841 | Bacteria | 7273 |
| 54 | Ga0068863_100036802 | 3300005841 | Unclassified | 4661 |
| 55 | Ga0068858_100008173 | 3300005842 | Bacteria | 10061 |
| 56 | Ga0068858_100436745 | 3300005842 | Bacteria | 1260 |
| 57 | Ga0068860_100000059 | 3300005843 | Bacteria | 196400 |
| 58 | Ga0068860_100001478 | 3300005843 | Bacteria | 25387 |
| 59 | Ga0068860_100002928 | 3300005843 | Bacteria | 17676 |
| 60 | Ga0068860_100003201 | 3300005843 | Bacteria | 16898 |
| 61 | Ga0075366_10000785 | 3300006195 | Bacteria | 15187 |
| 62 | Ga0097621_100000041 | 3300006237 | Bacteria | 66329 |
| 63 | Ga0097621_100252494 | 3300006237 | Bacteria | 1545 |
| 64 | Ga0068871_100000719 | 3300006358 | Bacteria | 22424 |
| 65 | Ga0068871_100076216 | 3300006358 | Bacteria | 2769 |
| 66 | Ga0068871_100119569 | 3300006358 | Bacteria | 2224 |
| 67 | Ga0068865_100000886 | 3300006881 | Bacteria | 16967 |
| 68 | Ga0097620_100000960 | 3300006931 | Bacteria | 29521 |
| 69 | Ga0097620_100056318 | 3300006931 | Bacteria | 3956 |
| 70 | Ga0105240_10000383 | 3300009093 | Bacteria | 83057 |
| 71 | Ga0105240_10000767 | 3300009093 | Bacteria | 58332 |
| 72 | Ga0105240_10044823 | 3300009093 | Bacteria | 5615 |
| 73 | Ga0105240_10058723 | 3300009093 | Bacteria | 4802 |
| 74 | Ga0105240_10071110 | 3300009093 | Bacteria | 4303 |
| 75 | Ga0105247_10004380 | 3300009101 | Bacteria | 9018 |
| 76 | Ga0105241_10004552 | 3300009174 | Bacteria | 10260 |
| 77 | Ga0105241_10005060 | 3300009174 | Bacteria | 9723 |
| 78 | Ga0105241_10007401 | 3300009174 | Bacteria | 8078 |
| 79 | Ga0105242_10007070 | 3300009176 | Bacteria | 8669 |
| 80 | Ga0105242_10090028 | 3300009176 | Bacteria | 2580 |
| 81 | Ga0105237_10001181 | 3300009545 | Bacteria | 34916 |
| 82 | Ga0105237_10001887 | 3300009545 | Bacteria | 26751 |
| 83 | Ga0105237_10004353 | 3300009545 | Bacteria | 16406 |
| 84 | Ga0105237_10011754 | 3300009545 | Bacteria | 9262 |
| 85 | Ga0105237_10023294 | 3300009545 | Bacteria | 6346 |
| 86 | Ga0105237_10031458 | 3300009545 | Bacteria | 5381 |
| 87 | Ga0105237_10060573 | 3300009545 | Bacteria | 3786 |
| 88 | Ga0105238_10002718 | 3300009551 | Bacteria | 17614 |
| 89 | Ga0105238_10017652 | 3300009551 | Bacteria | 7254 |
| 90 | Ga0105238_10074957 | 3300009551 | Bacteria | 3376 |
| 91 | Ga0105238_10128742 | 3300009551 | Bacteria | 2510 |
| 92 | Ga0105238_10367366 | 3300009551 | Unclassified | 1429 |
| 93 | Ga0105249_10019061 | 3300009553 | Bacteria | 6119 |
| 94 | Ga0105249_10137114 | 3300009553 | Bacteria | 2343 |
| 95 | Ga0105249_10227222 | 3300009553 | Bacteria | 1839 |
| 96 | Ga0105249_10252155 | 3300009553 | Bacteria | 1750 |
| 97 | Ga0105239_10000006 | 3300010375 | Bacteria | 442319 |
| 98 | Ga0105239_10000101 | 3300010375 | Bacteria | 119610 |
| 99 | Ga0105239_10025822 | 3300010375 | Bacteria | 6470 |
| 100 | Ga0105239_10040793 | 3300010375 | Bacteria | 5086 |
| 101 | Ga0105239_10043187 | 3300010375 | Bacteria | 4940 |
| 102 | Ga0105239_10050865 | 3300010375 | Bacteria | 4543 |
| 103 | Ga0105239_10050920 | 3300010375 | Bacteria | 4541 |
| 104 | Ga0105239_10051414 | 3300010375 | Bacteria | 4517 |
| 105 | Ga0105239_10679273 | 3300010375 | Unclassified | 1177 |
| 106 | Ga0105246_10002502 | 3300011119 | Bacteria | 11117 |
| 107 | Ga0105246_10007487 | 3300011119 | Bacteria | 6691 |
| 108 | Ga0157370_10106377 | 3300013104 | Bacteria | 2625 |
| 109 | Ga0157374_10000002 | 3300013296 | Bacteria | 1054226 |
| 110 | Ga0157374_10002328 | 3300013296 | Bacteria | 16037 |
| 111 | Ga0157374_10112964 | 3300013296 | Bacteria | 2614 |
| 112 | Ga0157378_10012008 | 3300013297 | Bacteria | 7583 |
| 113 | Ga0157378_10017997 | 3300013297 | Bacteria | 6203 |
| 114 | Ga0163162_10000068 | 3300013306 | Bacteria | 97068 |
| 115 | Ga0163162_10000164 | 3300013306 | Bacteria | 60866 |
| 116 | Ga0163162_10001433 | 3300013306 | Bacteria | 22226 |
| 117 | Ga0163162_10005562 | 3300013306 | Bacteria | 12192 |
| 118 | Ga0163162_10162565 | 3300013306 | Unclassified | 2355 |
| 119 | Ga0157372_10001255 | 3300013307 | Bacteria | 27453 |
| 120 | Ga0157375_10013831 | 3300013308 | Bacteria | 7192 |
| 121 | Ga0157375_10090357 | 3300013308 | Bacteria | 3121 |
| 122 | Ga0163163_10069755 | 3300014325 | Bacteria | 3500 |
| 123 | Ga0157380_10064499 | 3300014326 | Bacteria | 2941 |
| 124 | Ga0157380_10365843 | 3300014326 | Bacteria | 1355 |
| 125 | Ga0157379_10071678 | 3300014968 | Bacteria | 3099 |
| 126 | Ga0157379_10255476 | 3300014968 | Bacteria | 1591 |
| 127 | Ga0157376_10007195 | 3300014969 | Bacteria | 7913 |
| 128 | Ga0157376_10059771 | 3300014969 | Bacteria | 3197 |
| 129 | Ga0182005_1000876 | 3300015265 | Bacteria | 13338 |
| 130 | Ga0163161_10010871 | 3300017792 | Bacteria | 6309 |
| 131 | Ga0207425_1022418 | 3300025245 | Bacteria | 1331 |
| 132 | Ga0209646_1000003 | 3300025246 | Bacteria | 1160860 |
| 133 | Ga0209026_1000333 | 3300025250 | Bacteria | 45722 |
| 134 | Ga0209129_1009689 | 3300025258 | Bacteria | 2500 |
| 135 | Ga0209676_1000675 | 3300025292 | Bacteria | 48431 |
| 136 | Ga0209676_1000695 | 3300025292 | Bacteria | 47271 |
| 137 | Ga0209758_1015469 | 3300025297 | Bacteria | 3945 |
| 138 | Ga0207426_1000258 | 3300025302 | Bacteria | 114759 |
| 139 | Ga0207426_1000277 | 3300025302 | Bacteria | 106036 |
| 140 | Ga0209257_1000064 | 3300025304 | Bacteria | 356803 |
| 141 | Ga0207656_10023684 | 3300025321 | Bacteria | 2475 |
| 142 | Ga0207642_10059481 | 3300025899 | Bacteria | 1767 |
| 143 | Ga0207710_10005945 | 3300025900 | Bacteria | 5234 |
| 144 | Ga0207680_10000036 | 3300025903 | Bacteria | 73025 |
| 145 | Ga0207680_10017049 | 3300025903 | Unclassified | 3829 |
| 146 | Ga0207647_10060338 | 3300025904 | Bacteria | 2318 |
| 147 | Ga0207645_10004077 | 3300025907 | Bacteria | 10880 |
| 148 | Ga0207654_10000967 | 3300025911 | Bacteria | 15770 |
| 149 | Ga0207654_10005646 | 3300025911 | Bacteria | 6324 |
| 150 | Ga0207695_10000300 | 3300025913 | Bacteria | 122104 |
| 151 | Ga0207695_10000425 | 3300025913 | Bacteria | 93523 |
| 152 | Ga0207695_10038876 | 3300025913 | Bacteria | 5117 |
| 153 | Ga0207695_10045234 | 3300025913 | Unclassified | 4674 |
| 154 | Ga0207695_10089253 | 3300025913 | Bacteria | 3100 |
| 155 | Ga0207695_10098906 | 3300025913 | Bacteria | 2916 |
| 156 | Ga0207671_10003135 | 3300025914 | Bacteria | 16794 |
| 157 | Ga0207671_10003462 | 3300025914 | Bacteria | 15713 |
| 158 | Ga0207671_10004571 | 3300025914 | Bacteria | 13146 |
| 159 | Ga0207671_10008950 | 3300025914 | Bacteria | 8424 |
| 160 | Ga0207671_10015793 | 3300025914 | Bacteria | 5893 |
| 161 | Ga0207671_10020482 | 3300025914 | Bacteria | 5033 |
| 162 | Ga0207644_10025609 | 3300025931 | Bacteria | 4057 |
| 163 | Ga0207706_10090044 | 3300025933 | Bacteria | 2697 |
| 164 | Ga0207686_10058290 | 3300025934 | Bacteria | 2434 |
| 165 | Ga0207704_10000037 | 3300025938 | Bacteria | 93990 |
| 166 | Ga0207691_10219029 | 3300025940 | Bacteria | 1651 |
| 167 | Ga0207667_10043790 | 3300025949 | Bacteria | 4748 |
| 168 | Ga0207712_10041665 | 3300025961 | Bacteria | 3157 |
| 169 | Ga0207712_10182997 | 3300025961 | Unclassified | 1647 |
| 170 | Ga0207677_10038624 | 3300026023 | Bacteria | 3132 |
| 171 | Ga0207703_10007215 | 3300026035 | Bacteria | 8841 |
| 172 | Ga0207703_10267726 | 3300026035 | Bacteria | 1547 |
| 173 | Ga0207639_10013034 | 3300026041 | Bacteria | 5804 |
| 174 | Ga0207702_10078082 | 3300026078 | Bacteria | 2865 |
| 175 | Ga0207641_10035801 | 3300026088 | Bacteria | 4139 |
| 176 | Ga0207641_10067784 | 3300026088 | Bacteria | 3058 |
| 177 | Ga0207648_10000770 | 3300026089 | Bacteria | 36093 |
| 178 | Ga0207676_10006112 | 3300026095 | Bacteria | 8499 |
| 179 | Ga0207675_100034940 | 3300026118 | Bacteria | 4687 |
| 180 | Ga0207683_10002162 | 3300026121 | Bacteria | 17271 |
| 181 | Ga0207698_10001336 | 3300026142 | Bacteria | 14370 |
| 182 | Ga0268266_10000095 | 3300028379 | Bacteria | 186169 |
| 183 | Ga0268264_10000015 | 3300028381 | Bacteria | 508501 |
| 184 | Ga0268264_10001262 | 3300028381 | Bacteria | 24026 |
| 185 | Ga0268264_10001375 | 3300028381 | Bacteria | 22770 |
| 186 | Ga0268264_10007740 | 3300028381 | Bacteria | 8946 |
| 187 | Ga0268264_10070275 | 3300028381 | Bacteria | 2964 |
| 188 | Ga0307517_10005537 | 3300028786 | Bacteria | 18980 |
| 189 | Ga0307515_10000012 | 3300028794 | Bacteria | 582232 |
| 190 | Ga0307515_10000927 | 3300028794 | Bacteria | 67260 |
| 191 | Ga0307515_10003662 | 3300028794 | Bacteria | 32273 |
| 192 | Ga0307515_10061893 | 3300028794 | Bacteria | 5298 |
| 193 | Ga0307515_10062430 | 3300028794 | Bacteria | 5260 |
| 194 | Ga0307511_10027075 | 3300030521 | Bacteria | 5242 |
| 195 | Ga0265327_10000084 | 3300031251 | Bacteria | 204433 |
| 196 | Ga0307405_10003400 | 3300031731 | Bacteria | 7306 |
| 197 | Ga0307405_10077135 | 3300031731 | Bacteria | 2164 |
| 198 | Ga0307412_10139683 | 3300031911 | Bacteria | 1772 |
| 199 | Ga0307414_10063246 | 3300032004 | Bacteria | 2630 |
| 200 | Ga0307414_10191984 | 3300032004 | Bacteria | 1653 |
| 201 | Ga0307510_10002832 | 3300033180 | Bacteria | 19916 |
| 202 | Ga0395899_0027852 | 3300037312 | Bacteria | 4257 |
| 203 | Ga0395900_0004442 | 3300037418 | Bacteria | 14859 |
| 204 | Ga0395905_0000686 | 3300037471 | Bacteria | 44822 |
| 205 | Ga0395901_0017450 | 3300038443 | Bacteria | 7325 |
| 206 | Ga0439431_0003046 | 3300041997 | Bacteria | 3678 |
| 207 | Ga0439455_0024019 | 3300042012 | Bacteria | 1472 |
| 208 | Ga0466972_0000012 | 3300044658 | Bacteria | 246338 |
| 209 | Ga0466972_0003919 | 3300044658 | Bacteria | 7420 |
| 210 | Ga0466982_0045990 | 3300044672 | Bacteria | 2659 |
| 211 | Ga0466964_0058879 | 3300044706 | Bacteria | 1594 |
| 212 | Ga0466957_0003093 | 3300044842 | Bacteria | 9056 |
| 213 | Ga0466957_0154000 | 3300044842 | Bacteria | 1488 |
| 214 | Ga0466959_0008565 | 3300045049 | Bacteria | 7239 |
| 215 | Ga0495650_0016033 | 3300046471 | Bacteria | 3815 |
| 216 | Ga0495585_0000763 | 3300046492 | Bacteria | 28491 |
| 217 | Ga0495616_0009521 | 3300046513 | Bacteria | 5674 |
| 218 | Ga0495609_0007093 | 3300046538 | Bacteria | 5639 |
| 219 | Ga0495633_0000056 | 3300046558 | Bacteria | 149334 |
| 220 | Ga0495668_0000021 | 3300046616 | Bacteria | 381308 |
| 221 | Ga0495625_0000949 | 3300046660 | Bacteria | 38756 |
| 222 | Ga0495625_0007054 | 3300046660 | Bacteria | 9874 |
| 223 | Ga0495625_0033460 | 3300046660 | Bacteria | 3802 |
| 224 | Ga0495658_0026458 | 3300046683 | Bacteria | 3110 |
| 225 | Ga0495672_0036260 | 3300047320 | Bacteria | 3029 |
| 226 | Ga0495683_0056631 | 3300047323 | Bacteria | 1950 |
| 227 | Ga0495687_000004 | 3300047443 | Bacteria | 779298 |
| 228 | Ga0495687_001629 | 3300047443 | Bacteria | 20224 |
| 229 | Ga0495686_0000097 | 3300047472 | Bacteria | 183450 |
| 230 | Ga0496121_0000007 | 3300048924 | Bacteria | 942516 |
| 231 | Ga0496126_0012177 | 3300048929 | Bacteria | 8828 |
| 232 | Ga0495678_025579 | 3300049459 | Bacteria | 2533 |
| 233 | Ga0501044_0062989 | 3300049823 | Bacteria | 3790 |
| 234 | nmdc:mga0k408_293_c1 | 3300050493 | Bacteria | 24289 |
| 235 | Ga0500644_0000202 | 3300053088 | Bacteria | 36222 |
| 236 | Ga0500583_0009292 | 3300053092 | Bacteria | 3584 |
| 237 | Ga0500569_000108 | 3300053109 | Bacteria | 12916 |
| 238 | Ga0500608_000867 | 3300053122 | Bacteria | 10918 |
| 239 | Ga0500608_007041 | 3300053122 | Bacteria | 4624 |
| 240 | Ga0500652_026622 | 3300053131 | Bacteria | 2229 |
| 241 | Ga0500658_0002250 | 3300053134 | Bacteria | 7480 |
| 242 | Ga0500559_0008177 | 3300053136 | Bacteria | 4600 |
| 243 | Ga0500559_0035854 | 3300053136 | Unclassified | 2144 |
| 244 | Ga0500564_026023 | 3300053138 | Bacteria | 2689 |
| 245 | Ga0500568_0001347 | 3300053139 | Bacteria | 15992 |
| 246 | Ga0500568_0009857 | 3300053139 | Bacteria | 4514 |
| 247 | Ga0500616_0028359 | 3300053153 | Bacteria | 3085 |
| 248 | Ga0500622_0000203 | 3300053156 | Bacteria | 63042 |
| 249 | Ga0500633_0013787 | 3300053160 | Bacteria | 2276 |
| 250 | Ga0500637_0103165 | 3300053178 | Bacteria | 1654 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009553 | Ga0105249_10252155 | Ga0105249_102521552 | 305 |
| 2 | 3300010375 | Ga0105239_10679273 | Ga0105239_106792731 | 305 |
| 3 | 3300044842 | Ga0466957_0154000 | Ga0466957_0154000_17_946 | 306 |
| 4 | 3300053156 | Ga0500622_0000203 | Ga0500622_0000203_870_1877 | 323 |
| 5 | 3300009545 | Ga0105237_10001181 | Ga0105237_1000118129 | 325 |
| 6 | 3300005334 | Ga0068869_100106821 | Ga0068869_1001068212 | 330 |
| 7 | 3300009176 | Ga0105242_10090028 | Ga0105242_100900282 | 330 |
| 8 | 3300028794 | Ga0307515_10000012 | Ga0307515_10000012491 | 330 |
| 9 | 3300046471 | Ga0495650_0016033 | Ga0495650_0016033_2293_3327 | 330 |
| 10 | 3300028794 | Ga0307515_10062430 | Ga0307515_100624303 | 331 |
| 11 | 3300003323 | rootH1_10222474 | rootH1_102224742 | 332 |
| 12 | 3300010375 | Ga0105239_10043187 | Ga0105239_100431872 | 332 |
| 13 | 3300028786 | Ga0307517_10005537 | Ga0307517_1000553715 | 335 |
| 14 | 3300053088 | Ga0500644_0000202 | Ga0500644_0000202_30889_31968 | 336 |
| 15 | 3300053160 | Ga0500633_0013787 | Ga0500633_0013787_924_2003 | 336 |
| 16 | 3300003316 | rootH1_10138601 | rootH1_101386016 | 337 |
| 17 | 3300047320 | Ga0495672_0036260 | Ga0495672_0036260_832_1845 | 337 |
| 18 | 3300003354 | JGI25160J50197_1006712 | JGI25160J50197_10067122 | 338 |
| 19 | 3300005548 | Ga0070665_100000008 | Ga0070665_100000008485 | 338 |
| 20 | 3300015265 | Ga0182005_1000876 | Ga0182005_100087611 | 338 |
| 21 | 3300025302 | Ga0207426_1000258 | Ga0207426_100025857 | 338 |
| 22 | 3300037312 | Ga0395899_0027852 | Ga0395899_0027852_660_1724 | 338 |
| 23 | 3300037418 | Ga0395900_0004442 | Ga0395900_0004442_13720_14784 | 338 |
| 24 | 3300037471 | Ga0395905_0000686 | Ga0395905_0000686_10630_11694 | 338 |
| 25 | 3300038443 | Ga0395901_0017450 | Ga0395901_0017450_3499_4563 | 338 |
| 26 | 3300028794 | Ga0307515_10061893 | Ga0307515_100618932 | 339 |
| 27 | 3300041997 | Ga0439431_0003046 | Ga0439431_0003046_1823_2848 | 339 |
| 28 | 3300053092 | Ga0500583_0009292 | Ga0500583_0009292_301_1428 | 341 |
| 29 | 3300053131 | Ga0500652_026622 | Ga0500652_026622_1112_2146 | 341 |
| 30 | 3300005843 | Ga0068860_100001478 | Ga0068860_1000014781 | 343 |
| 31 | 3300013296 | Ga0157374_10112964 | Ga0157374_101129643 | 343 |
| 32 | 3300013306 | Ga0163162_10001433 | Ga0163162_1000143310 | 343 |
| 33 | 3300014326 | Ga0157380_10365843 | Ga0157380_103658432 | 343 |
| 34 | 3300028381 | Ga0268264_10001375 | Ga0268264_1000137515 | 343 |
| 35 | 3300053122 | Ga0500608_000867 | Ga0500608_000867_9413_10477 | 343 |
| 36 | 3300005355 | Ga0070671_100056352 | Ga0070671_1000563522 | 344 |
| 37 | 3300009551 | Ga0105238_10017652 | Ga0105238_100176523 | 344 |
| 38 | 3300010375 | Ga0105239_10051414 | Ga0105239_100514143 | 344 |
| 39 | 3300025931 | Ga0207644_10025609 | Ga0207644_100256093 | 344 |
| 40 | 3300044658 | Ga0466972_0000012 | Ga0466972_0000012_116806_117840 | 344 |
| 41 | 3300047443 | Ga0495687_000004 | Ga0495687_000004_642281_643408 | 347 |
| 42 | 3300032004 | Ga0307414_10063246 | Ga0307414_100632462 | 348 |
| 43 | 3300048924 | Ga0496121_0000007 | Ga0496121_0000007_369541_370611 | 348 |
| 44 | iso_pu_bacteria | 2522125168 | 2522551228 | 348 |
| 45 | 3300005262 | Ga0065165_1000603 | Ga0065165_100060314 | 349 |
| 46 | 3300009553 | Ga0105249_10227222 | Ga0105249_102272222 | 349 |
| 47 | 3300013308 | Ga0157375_10013831 | Ga0157375_100138314 | 349 |
| 48 | 3300025292 | Ga0209676_1000675 | Ga0209676_100067513 | 349 |
| 49 | 3300031731 | Ga0307405_10003400 | Ga0307405_100034002 | 349 |
| 50 | 3300033180 | Ga0307510_10002832 | Ga0307510_100028322 | 349 |
| 51 | 3300042012 | Ga0439455_0024019 | Ga0439455_0024019_71_1135 | 349 |
| 52 | 3300047323 | Ga0495683_0056631 | Ga0495683_0056631_82_1212 | 349 |
| 53 | 3300047443 | Ga0495687_001629 | Ga0495687_001629_8802_9866 | 349 |
| 54 | 3300003323 | rootH1_10017298 | rootH1_1001729814 | 350 |
| 55 | iso_pu_bacteria | 2929239360 | 2929241169 | 350 |
| 56 | 3300009093 | Ga0105240_10000383 | Ga0105240_1000038312 | 351 |
| 57 | 3300009545 | Ga0105237_10031458 | Ga0105237_100314582 | 351 |
| 58 | 3300009551 | Ga0105238_10367366 | Ga0105238_103673662 | 351 |
| 59 | 3300025913 | Ga0207695_10000300 | Ga0207695_1000030062 | 351 |
| 60 | 3300005328 | Ga0070676_10001009 | Ga0070676_100010098 | 352 |
| 61 | 3300005334 | Ga0068869_100315783 | Ga0068869_1003157831 | 352 |
| 62 | 3300005338 | Ga0068868_100012799 | Ga0068868_1000127992 | 352 |
| 63 | 3300005456 | Ga0070678_100000507 | Ga0070678_10000050711 | 352 |
| 64 | 3300005459 | Ga0068867_100001225 | Ga0068867_10000122516 | 352 |
| 65 | 3300005539 | Ga0068853_100006691 | Ga0068853_1000066918 | 352 |
| 66 | 3300005543 | Ga0070672_100204658 | Ga0070672_1002046582 | 352 |
| 67 | 3300005614 | Ga0068856_100030559 | Ga0068856_1000305593 | 352 |
| 68 | 3300005616 | Ga0068852_100003993 | Ga0068852_1000039938 | 352 |
| 69 | 3300005718 | Ga0068866_10123435 | Ga0068866_101234351 | 352 |
| 70 | 3300006237 | Ga0097621_100000041 | Ga0097621_10000004129 | 352 |
| 71 | 3300006358 | Ga0068871_100000719 | Ga0068871_10000071923 | 352 |
| 72 | 3300006881 | Ga0068865_100000886 | Ga0068865_1000008863 | 352 |
| 73 | 3300009174 | Ga0105241_10005060 | Ga0105241_100050607 | 352 |
| 74 | 3300009176 | Ga0105242_10007070 | Ga0105242_100070702 | 352 |
| 75 | 3300010375 | Ga0105239_10025822 | Ga0105239_100258224 | 352 |
| 76 | 3300013104 | Ga0157370_10106377 | Ga0157370_101063772 | 352 |
| 77 | 3300013296 | Ga0157374_10002328 | Ga0157374_100023283 | 352 |
| 78 | 3300013297 | Ga0157378_10012008 | Ga0157378_100120086 | 352 |
| 79 | 3300014969 | Ga0157376_10059771 | Ga0157376_100597713 | 352 |
| 80 | 3300025899 | Ga0207642_10059481 | Ga0207642_100594812 | 352 |
| 81 | 3300025907 | Ga0207645_10004077 | Ga0207645_100040777 | 352 |
| 82 | 3300025914 | Ga0207671_10015793 | Ga0207671_100157935 | 352 |
| 83 | 3300025934 | Ga0207686_10058290 | Ga0207686_100582902 | 352 |
| 84 | 3300025938 | Ga0207704_10000037 | Ga0207704_1000003727 | 352 |
| 85 | 3300025940 | Ga0207691_10219029 | Ga0207691_102190292 | 352 |
| 86 | 3300025961 | Ga0207712_10182997 | Ga0207712_101829972 | 352 |
| 87 | 3300026078 | Ga0207702_10078082 | Ga0207702_100780823 | 352 |
| 88 | 3300026089 | Ga0207648_10000770 | Ga0207648_1000077031 | 352 |
| 89 | 3300026118 | Ga0207675_100034940 | Ga0207675_1000349403 | 352 |
| 90 | 3300026121 | Ga0207683_10002162 | Ga0207683_100021628 | 352 |
| 91 | 3300026142 | Ga0207698_10001336 | Ga0207698_100013368 | 352 |
| 92 | 3300028381 | Ga0268264_10070275 | Ga0268264_100702752 | 352 |
| 93 | 3300053136 | Ga0500559_0035854 | Ga0500559_0035854_814_1893 | 352 |
| 94 | 3300009545 | Ga0105237_10060573 | Ga0105237_100605732 | 354 |
| 95 | 3300053109 | Ga0500569_000108 | Ga0500569_000108_10924_12060 | 354 |
| 96 | 3300053134 | Ga0500658_0002250 | Ga0500658_0002250_5414_6550 | 354 |
| 97 | 3300053153 | Ga0500616_0028359 | Ga0500616_0028359_641_1777 | 354 |
| 98 | 3300005289 | Ga0065704_10166443 | Ga0065704_101664431 | 356 |
| 99 | 3300053136 | Ga0500559_0008177 | Ga0500559_0008177_73_1179 | 356 |
| 100 | iso_pu_bacteria | 2818991442 | 2819575438 | 356 |
| 101 | 3300003320 | rootH2_10014180 | rootH2_100141805 | 357 |
| 102 | 3300005329 | Ga0070683_100306750 | Ga0070683_1003067501 | 357 |
| 103 | 3300005539 | Ga0068853_100002461 | Ga0068853_1000024612 | 357 |
| 104 | 3300009551 | Ga0105238_10074957 | Ga0105238_100749573 | 357 |
| 105 | 3300013307 | Ga0157372_10001255 | Ga0157372_1000125523 | 357 |
| 106 | 3300025904 | Ga0207647_10060338 | Ga0207647_100603382 | 357 |
| 107 | 3300026041 | Ga0207639_10013034 | Ga0207639_100130342 | 357 |
| 108 | 3300044658 | Ga0466972_0003919 | Ga0466972_0003919_4597_5937 | 357 |
| 109 | 3300003320 | rootH2_10001944 | rootH2_1000194413 | 358 |
| 110 | 3300006358 | Ga0068871_100076216 | Ga0068871_1000762161 | 358 |
| 111 | 3300009545 | Ga0105237_10023294 | Ga0105237_100232945 | 358 |
| 112 | 3300010375 | Ga0105239_10000101 | Ga0105239_1000010166 | 358 |
| 113 | 3300013296 | Ga0157374_10000002 | Ga0157374_10000002720 | 358 |
| 114 | 3300014969 | Ga0157376_10007195 | Ga0157376_100071957 | 358 |
| 115 | 3300025913 | Ga0207695_10045234 | Ga0207695_100452345 | 358 |
| 116 | 3300025914 | Ga0207671_10020482 | Ga0207671_100204824 | 358 |
| 117 | 3300025933 | Ga0207706_10090044 | Ga0207706_100900442 | 358 |
| 118 | 3300045049 | Ga0466959_0008565 | Ga0466959_0008565_2457_3560 | 358 |
| 119 | 3300005262 | Ga0065165_1006588 | Ga0065165_10065882 | 360 |
| 120 | 3300005548 | Ga0070665_100000083 | Ga0070665_10000008339 | 360 |
| 121 | 3300005840 | Ga0068870_10104307 | Ga0068870_101043072 | 360 |
| 122 | 3300009093 | Ga0105240_10044823 | Ga0105240_100448231 | 360 |
| 123 | 3300009093 | Ga0105240_10071110 | Ga0105240_100711102 | 360 |
| 124 | 3300010375 | Ga0105239_10040793 | Ga0105239_100407931 | 360 |
| 125 | 3300013306 | Ga0163162_10000068 | Ga0163162_1000006838 | 360 |
| 126 | 3300017792 | Ga0163161_10010871 | Ga0163161_100108711 | 360 |
| 127 | 3300025913 | Ga0207695_10038876 | Ga0207695_100388763 | 360 |
| 128 | 3300025913 | Ga0207695_10089253 | Ga0207695_100892532 | 360 |
| 129 | 3300025914 | Ga0207671_10008950 | Ga0207671_100089505 | 360 |
| 130 | 3300025949 | Ga0207667_10043790 | Ga0207667_100437903 | 360 |
| 131 | 3300028379 | Ga0268266_10000095 | Ga0268266_1000009543 | 360 |
| 132 | 3300053138 | Ga0500564_026023 | Ga0500564_026023_1507_2661 | 360 |
| 133 | iso_pu_bacteria | 2929177148 | 2929180735 | 360 |
| 134 | iso_pu_bacteria | 2945977869 | 2945983133 | 360 |
| 135 | iso_pu_bacteria | 2946013367 | 2946017475 | 360 |
| 136 | 3300005367 | Ga0070667_100014864 | Ga0070667_1000148642 | 361 |
| 137 | 3300005617 | Ga0068859_100056318 | Ga0068859_1000563182 | 361 |
| 138 | 3300005843 | Ga0068860_100002928 | Ga0068860_1000029282 | 361 |
| 139 | 3300006931 | Ga0097620_100056318 | Ga0097620_1000563182 | 361 |
| 140 | 3300028381 | Ga0268264_10007740 | Ga0268264_100077402 | 361 |
| 141 | 3300047472 | Ga0495686_0000097 | Ga0495686_0000097_53682_54809 | 361 |
| 142 | 3300003320 | rootH2_10002437 | rootH2_100024373 | 362 |
| 143 | 3300003320 | rootH2_10004626 | rootH2_100046265 | 362 |
| 144 | 3300003323 | rootH1_10061083 | rootH1_100610835 | 362 |
| 145 | 3300003781 | Ga0055536_1010028 | Ga0055536_10100283 | 362 |
| 146 | 3300005262 | Ga0065165_1000085 | Ga0065165_10000857 | 362 |
| 147 | 3300009545 | Ga0105237_10001887 | Ga0105237_1000188721 | 362 |
| 148 | 3300009551 | Ga0105238_10128742 | Ga0105238_101287423 | 362 |
| 149 | 3300010375 | Ga0105239_10000006 | Ga0105239_10000006248 | 362 |
| 150 | 3300025292 | Ga0209676_1000695 | Ga0209676_100069523 | 362 |
| 151 | 3300025914 | Ga0207671_10003135 | Ga0207671_100031359 | 362 |
| 152 | 3300031731 | Ga0307405_10077135 | Ga0307405_100771352 | 362 |
| 153 | 3300031911 | Ga0307412_10139683 | Ga0307412_101396832 | 362 |
| 154 | 3300032004 | Ga0307414_10191984 | Ga0307414_101919841 | 362 |
| 155 | 3300053178 | Ga0500637_0103165 | Ga0500637_0103165_146_1366 | 362 |
| 156 | 3300005288 | Ga0065714_10069197 | Ga0065714_100691972 | 363 |
| 157 | 3300005335 | Ga0070666_10000424 | Ga0070666_1000042419 | 363 |
| 158 | 3300005335 | Ga0070666_10017970 | Ga0070666_100179703 | 363 |
| 159 | 3300005355 | Ga0070671_100054596 | Ga0070671_1000545963 | 363 |
| 160 | 3300005364 | Ga0070673_100045012 | Ga0070673_1000450124 | 363 |
| 161 | 3300005617 | Ga0068859_100000960 | Ga0068859_1000009609 | 363 |
| 162 | 3300005618 | Ga0068864_100024875 | Ga0068864_1000248755 | 363 |
| 163 | 3300005834 | Ga0068851_10004927 | Ga0068851_100049278 | 363 |
| 164 | 3300005834 | Ga0068851_10006220 | Ga0068851_100062203 | 363 |
| 165 | 3300005841 | Ga0068863_100015688 | Ga0068863_1000156882 | 363 |
| 166 | 3300005841 | Ga0068863_100036802 | Ga0068863_1000368023 | 363 |
| 167 | 3300005842 | Ga0068858_100008173 | Ga0068858_1000081736 | 363 |
| 168 | 3300005842 | Ga0068858_100436745 | Ga0068858_1004367452 | 363 |
| 169 | 3300005843 | Ga0068860_100000059 | Ga0068860_10000005989 | 363 |
| 170 | 3300005843 | Ga0068860_100003201 | Ga0068860_10000320110 | 363 |
| 171 | 3300006195 | Ga0075366_10000785 | Ga0075366_1000078510 | 363 |
| 172 | 3300006237 | Ga0097621_100252494 | Ga0097621_1002524942 | 363 |
| 173 | 3300006358 | Ga0068871_100119569 | Ga0068871_1001195692 | 363 |
| 174 | 3300006931 | Ga0097620_100000960 | Ga0097620_1000009609 | 363 |
| 175 | 3300009093 | Ga0105240_10000767 | Ga0105240_1000076738 | 363 |
| 176 | 3300009101 | Ga0105247_10004380 | Ga0105247_100043809 | 363 |
| 177 | 3300009174 | Ga0105241_10004552 | Ga0105241_100045522 | 363 |
| 178 | 3300009174 | Ga0105241_10007401 | Ga0105241_100074017 | 363 |
| 179 | 3300009545 | Ga0105237_10004353 | Ga0105237_100043536 | 363 |
| 180 | 3300009545 | Ga0105237_10011754 | Ga0105237_100117542 | 363 |
| 181 | 3300009551 | Ga0105238_10002718 | Ga0105238_1000271812 | 363 |
| 182 | 3300009553 | Ga0105249_10019061 | Ga0105249_100190615 | 363 |
| 183 | 3300009553 | Ga0105249_10137114 | Ga0105249_101371142 | 363 |
| 184 | 3300010375 | Ga0105239_10050865 | Ga0105239_100508653 | 363 |
| 185 | 3300011119 | Ga0105246_10002502 | Ga0105246_100025024 | 363 |
| 186 | 3300011119 | Ga0105246_10007487 | Ga0105246_100074875 | 363 |
| 187 | 3300013297 | Ga0157378_10017997 | Ga0157378_100179974 | 363 |
| 188 | 3300013306 | Ga0163162_10000164 | Ga0163162_1000016449 | 363 |
| 189 | 3300013306 | Ga0163162_10005562 | Ga0163162_100055623 | 363 |
| 190 | 3300013308 | Ga0157375_10090357 | Ga0157375_100903572 | 363 |
| 191 | 3300014325 | Ga0163163_10069755 | Ga0163163_100697552 | 363 |
| 192 | 3300014968 | Ga0157379_10071678 | Ga0157379_100716782 | 363 |
| 193 | 3300014968 | Ga0157379_10255476 | Ga0157379_102554762 | 363 |
| 194 | 3300025321 | Ga0207656_10023684 | Ga0207656_100236842 | 363 |
| 195 | 3300025900 | Ga0207710_10005945 | Ga0207710_100059454 | 363 |
| 196 | 3300025903 | Ga0207680_10000036 | Ga0207680_1000003663 | 363 |
| 197 | 3300025903 | Ga0207680_10017049 | Ga0207680_100170492 | 363 |
| 198 | 3300025911 | Ga0207654_10000967 | Ga0207654_100009676 | 363 |
| 199 | 3300025911 | Ga0207654_10005646 | Ga0207654_100056465 | 363 |
| 200 | 3300025913 | Ga0207695_10000425 | Ga0207695_1000042534 | 363 |
| 201 | 3300025914 | Ga0207671_10003462 | Ga0207671_100034626 | 363 |
| 202 | 3300025914 | Ga0207671_10004571 | Ga0207671_1000457111 | 363 |
| 203 | 3300025961 | Ga0207712_10041665 | Ga0207712_100416652 | 363 |
| 204 | 3300026023 | Ga0207677_10038624 | Ga0207677_100386243 | 363 |
| 205 | 3300026035 | Ga0207703_10007215 | Ga0207703_100072155 | 363 |
| 206 | 3300026088 | Ga0207641_10035801 | Ga0207641_100358012 | 363 |
| 207 | 3300026088 | Ga0207641_10067784 | Ga0207641_100677843 | 363 |
| 208 | 3300026095 | Ga0207676_10006112 | Ga0207676_100061125 | 363 |
| 209 | 3300028381 | Ga0268264_10000015 | Ga0268264_10000015384 | 363 |
| 210 | 3300028381 | Ga0268264_10001262 | Ga0268264_1000126216 | 363 |
| 211 | 3300028794 | Ga0307515_10000927 | Ga0307515_1000092743 | 363 |
| 212 | 3300028794 | Ga0307515_10003662 | Ga0307515_100036627 | 363 |
| 213 | 3300030521 | Ga0307511_10027075 | Ga0307511_100270752 | 363 |
| 214 | 3300044672 | Ga0466982_0045990 | Ga0466982_0045990_1304_2473 | 363 |
| 215 | 3300046492 | Ga0495585_0000763 | Ga0495585_0000763_20074_21192 | 363 |
| 216 | 3300046513 | Ga0495616_0009521 | Ga0495616_0009521_4015_5139 | 363 |
| 217 | 3300046538 | Ga0495609_0007093 | Ga0495609_0007093_2803_3921 | 363 |
| 218 | 3300046558 | Ga0495633_0000056 | Ga0495633_0000056_9273_10391 | 363 |
| 219 | 3300046616 | Ga0495668_0000021 | Ga0495668_0000021_330190_331308 | 363 |
| 220 | 3300046660 | Ga0495625_0000949 | Ga0495625_0000949_1391_2509 | 363 |
| 221 | 3300046660 | Ga0495625_0007054 | Ga0495625_0007054_8024_9148 | 363 |
| 222 | 3300046660 | Ga0495625_0033460 | Ga0495625_0033460_1217_2338 | 363 |
| 223 | 3300046683 | Ga0495658_0026458 | Ga0495658_0026458_1214_2332 | 363 |
| 224 | 3300049459 | Ga0495678_025579 | Ga0495678_025579_152_1276 | 363 |
| 225 | 3300050493 | nmdc:mga0k408_293_c1 | nmdc:mga0k408_293_c1_9463_10581 | 363 |
| 226 | 3300053122 | Ga0500608_007041 | Ga0500608_007041_3349_4491 | 363 |
| 227 | 3300053139 | Ga0500568_0009857 | Ga0500568_0009857_1166_2293 | 363 |
| 228 | iso_pu_bacteria | 2522125168 | 2522553257 | 363 |
| 229 | iso_pu_bacteria | 2919437846 | 2919439127 | 363 |
| 230 | 3300003320 | rootH2_10076271 | rootH2_100762712 | 364 |
| 231 | 3300003322 | rootL2_10048356 | rootL2_100483562 | 364 |
| 232 | 3300003794 | Ga0055531_10000076 | Ga0055531_1000007630 | 364 |
| 233 | 3300005335 | Ga0070666_10113448 | Ga0070666_101134481 | 364 |
| 234 | 3300010375 | Ga0105239_10050920 | Ga0105239_100509204 | 364 |
| 235 | 3300013306 | Ga0163162_10162565 | Ga0163162_101625652 | 364 |
| 236 | 3300025304 | Ga0209257_1000064 | Ga0209257_100006431 | 364 |
| 237 | 3300026035 | Ga0207703_10267726 | Ga0207703_102677261 | 364 |
| 238 | 3300048929 | Ga0496126_0012177 | Ga0496126_0012177_1179_2327 | 364 |
| 239 | iso_pu_bacteria | 2929921140 | 2929926351 | 364 |
| 240 | iso_pu_bacteria | 8003151029 | 8003151773 | 364 |
| 241 | 3300003322 | rootL2_10175446 | rootL2_101754462 | 365 |
| 242 | 3300003323 | rootH1_10209329 | rootH1_102093296 | 365 |
| 243 | 3300009093 | Ga0105240_10058723 | Ga0105240_100587235 | 365 |
| 244 | 3300014326 | Ga0157380_10064499 | Ga0157380_100644993 | 365 |
| 245 | 3300025913 | Ga0207695_10098906 | Ga0207695_100989062 | 365 |
| 246 | 3300031251 | Ga0265327_10000084 | Ga0265327_1000008411 | 365 |
| 247 | 3300044706 | Ga0466964_0058879 | Ga0466964_0058879_22_1155 | 365 |
| 248 | 3300044842 | Ga0466957_0003093 | Ga0466957_0003093_1372_2535 | 365 |
| 249 | 3300053139 | Ga0500568_0001347 | Ga0500568_0001347_7213_8346 | 365 |
| 250 | 3300001979 | JGI24740J21852_10004600 | JGI24740J21852_100046003 | 368 |
| 251 | 3300002738 | JGI25154J39366_1000016 | JGI25154J39366_1000016168 | 368 |
| 252 | 3300002741 | JGI25157J39369_1006062 | JGI25157J39369_10060622 | 368 |
| 253 | 3300003354 | JGI25160J50197_1000835 | JGI25160J50197_100083510 | 368 |
| 254 | 3300025245 | Ga0207425_1022418 | Ga0207425_10224181 | 368 |
| 255 | 3300025246 | Ga0209646_1000003 | Ga0209646_1000003170 | 368 |
| 256 | 3300025250 | Ga0209026_1000333 | Ga0209026_10003339 | 368 |
| 257 | 3300025258 | Ga0209129_1009689 | Ga0209129_10096892 | 368 |
| 258 | 3300025297 | Ga0209758_1015469 | Ga0209758_10154692 | 368 |
| 259 | 3300025302 | Ga0207426_1000277 | Ga0207426_100027715 | 368 |
| 260 | 3300049823 | Ga0501044_0062989 | Ga0501044_0062989_865_2061 | 368 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar