F369757

General Info

Members Datasets Scaffolds Average Seq Length
260 156 250 368

Family's Representative Sequence

Representative Sequence 3300044658|Ga0466972_0003919|Ga0466972_0003919_4597_5937
Length 413
Sequence MKTFIKALTTRQNKLTRRNPAFHIPGDAARQLCGKKGGFYVSYRPMNTAHHWFIRYKLYHIPFWLVYHYCWWAAAVGSPAKAAASIFSVYVIKYLFYVVFQALAVYFNLYFLIPRYLEKSRFAEYITYLVLTILIAAACIVPGYYLTTIVSGRSPKELYGVDSFNLYYLYTGSPLSSSVASMTLAMSIKLAKNWLQTRQRHQQLEKEKLETELNFLKYQFNPHFLFNTINSIFFLIHKNPDMASASLAKFSELLRHQLYECNDKQILLSKEIAYLENSIELEKLRQNDNVEVSLQVDQLPFEELGIAPFILMTFVENAFKHVSKETDKRNWIRIRLHLDGRQLDFSVSNSIAPVPTEVMHYGGIGLKNVQRRLDLIYPGQYDLDIKNSNISFEVRLRLQLSGLTMQRPIPRTA

Samples

Sample ID Description Type Environment
1 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
2 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
3 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
4 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
5 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
6 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
7 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
8 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
9 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
10 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
11 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
12 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
13 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
14 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
15 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
16 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
17 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
18 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
19 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
20 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
21 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
22 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
23 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
24 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
25 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
26 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
40 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
41 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
59 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
67 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
70 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
71 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
72 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
73 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
74 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
75 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
77 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
78 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
108 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
109 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
110 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
111 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
112 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
113 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
114 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
115 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
116 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
117 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
118 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
119 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
120 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
121 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
122 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
123 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
124 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
125 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
126 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
127 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
128 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
129 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
130 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
131 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
132 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
133 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
134 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
135 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
136 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
137 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
138 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
139 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
140 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
141 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
142 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
143 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
144 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
145 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
146 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
147 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
148 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
149 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
150 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
151 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
152 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
153 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
154 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
155 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
156 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.15
Metatranscriptomes 0
Isolates 3.85

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.69
Nodule 0
Rhizoplane 0
Rhizosphere 75
Stem 0
Stem Tuber 0
Unclassified 12.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10004600 3300001979 Bacteria 5932
2 JGI25154J39366_1000016 3300002738 Bacteria 255057
3 JGI25157J39369_1006062 3300002741 Bacteria 1887
4 rootH1_10138601 3300003316 Bacteria 5803
5 rootH2_10001944 3300003320 Bacteria 18158
6 rootH2_10002437 3300003320 Bacteria 6611
7 rootH2_10004626 3300003320 Bacteria 9058
8 rootH2_10014180 3300003320 Bacteria 13289
9 rootH2_10076271 3300003320 Bacteria 4282
10 rootL2_10048356 3300003322 Bacteria 3469
11 rootL2_10175446 3300003322 Bacteria 2173
12 rootH1_10017298 3300003323 Bacteria 12898
13 rootH1_10061083 3300003323 Bacteria 11019
14 rootH1_10209329 3300003323 Bacteria 6768
15 rootH1_10222474 3300003323 Bacteria 2017
16 JGI25160J50197_1000835 3300003354 Bacteria 16456
17 JGI25160J50197_1006712 3300003354 Bacteria 4622
18 Ga0055536_1010028 3300003781 Bacteria 3826
19 Ga0055531_10000076 3300003794 Bacteria 106998
20 Ga0065165_1000085 3300005262 Bacteria 154355
21 Ga0065165_1000603 3300005262 Bacteria 52556
22 Ga0065165_1006588 3300005262 Bacteria 6033
23 Ga0065714_10069197 3300005288 Bacteria 4343
24 Ga0065704_10166443 3300005289 Unclassified 1319
25 Ga0070676_10001009 3300005328 Bacteria 13957
26 Ga0070683_100306750 3300005329 Bacteria 1510
27 Ga0068869_100106821 3300005334 Bacteria 2125
28 Ga0068869_100315783 3300005334 Bacteria 1266
29 Ga0070666_10000424 3300005335 Bacteria 26177
30 Ga0070666_10017970 3300005335 Unclassified 4539
31 Ga0070666_10113448 3300005335 Bacteria 1875
32 Ga0068868_100012799 3300005338 Bacteria 6137
33 Ga0070671_100054596 3300005355 Bacteria 3322
34 Ga0070671_100056352 3300005355 Bacteria 3270
35 Ga0070673_100045012 3300005364 Bacteria 3420
36 Ga0070667_100014864 3300005367 Bacteria 6430
37 Ga0070678_100000507 3300005456 Bacteria 18795
38 Ga0068867_100001225 3300005459 Bacteria 17675
39 Ga0068853_100002461 3300005539 Bacteria 13862
40 Ga0068853_100006691 3300005539 Bacteria 9181
41 Ga0070672_100204658 3300005543 Bacteria 1651
42 Ga0070665_100000008 3300005548 Bacteria 606341
43 Ga0070665_100000083 3300005548 Bacteria 181044
44 Ga0068856_100030559 3300005614 Bacteria 5265
45 Ga0068852_100003993 3300005616 Bacteria 10372
46 Ga0068859_100000960 3300005617 Bacteria 29521
47 Ga0068859_100056318 3300005617 Bacteria 3956
48 Ga0068864_100024875 3300005618 Bacteria 5037
49 Ga0068866_10123435 3300005718 Bacteria 1463
50 Ga0068851_10004927 3300005834 Bacteria 6048
51 Ga0068851_10006220 3300005834 Bacteria 5448
52 Ga0068870_10104307 3300005840 Bacteria 1608
53 Ga0068863_100015688 3300005841 Bacteria 7273
54 Ga0068863_100036802 3300005841 Unclassified 4661
55 Ga0068858_100008173 3300005842 Bacteria 10061
56 Ga0068858_100436745 3300005842 Bacteria 1260
57 Ga0068860_100000059 3300005843 Bacteria 196400
58 Ga0068860_100001478 3300005843 Bacteria 25387
59 Ga0068860_100002928 3300005843 Bacteria 17676
60 Ga0068860_100003201 3300005843 Bacteria 16898
61 Ga0075366_10000785 3300006195 Bacteria 15187
62 Ga0097621_100000041 3300006237 Bacteria 66329
63 Ga0097621_100252494 3300006237 Bacteria 1545
64 Ga0068871_100000719 3300006358 Bacteria 22424
65 Ga0068871_100076216 3300006358 Bacteria 2769
66 Ga0068871_100119569 3300006358 Bacteria 2224
67 Ga0068865_100000886 3300006881 Bacteria 16967
68 Ga0097620_100000960 3300006931 Bacteria 29521
69 Ga0097620_100056318 3300006931 Bacteria 3956
70 Ga0105240_10000383 3300009093 Bacteria 83057
71 Ga0105240_10000767 3300009093 Bacteria 58332
72 Ga0105240_10044823 3300009093 Bacteria 5615
73 Ga0105240_10058723 3300009093 Bacteria 4802
74 Ga0105240_10071110 3300009093 Bacteria 4303
75 Ga0105247_10004380 3300009101 Bacteria 9018
76 Ga0105241_10004552 3300009174 Bacteria 10260
77 Ga0105241_10005060 3300009174 Bacteria 9723
78 Ga0105241_10007401 3300009174 Bacteria 8078
79 Ga0105242_10007070 3300009176 Bacteria 8669
80 Ga0105242_10090028 3300009176 Bacteria 2580
81 Ga0105237_10001181 3300009545 Bacteria 34916
82 Ga0105237_10001887 3300009545 Bacteria 26751
83 Ga0105237_10004353 3300009545 Bacteria 16406
84 Ga0105237_10011754 3300009545 Bacteria 9262
85 Ga0105237_10023294 3300009545 Bacteria 6346
86 Ga0105237_10031458 3300009545 Bacteria 5381
87 Ga0105237_10060573 3300009545 Bacteria 3786
88 Ga0105238_10002718 3300009551 Bacteria 17614
89 Ga0105238_10017652 3300009551 Bacteria 7254
90 Ga0105238_10074957 3300009551 Bacteria 3376
91 Ga0105238_10128742 3300009551 Bacteria 2510
92 Ga0105238_10367366 3300009551 Unclassified 1429
93 Ga0105249_10019061 3300009553 Bacteria 6119
94 Ga0105249_10137114 3300009553 Bacteria 2343
95 Ga0105249_10227222 3300009553 Bacteria 1839
96 Ga0105249_10252155 3300009553 Bacteria 1750
97 Ga0105239_10000006 3300010375 Bacteria 442319
98 Ga0105239_10000101 3300010375 Bacteria 119610
99 Ga0105239_10025822 3300010375 Bacteria 6470
100 Ga0105239_10040793 3300010375 Bacteria 5086
101 Ga0105239_10043187 3300010375 Bacteria 4940
102 Ga0105239_10050865 3300010375 Bacteria 4543
103 Ga0105239_10050920 3300010375 Bacteria 4541
104 Ga0105239_10051414 3300010375 Bacteria 4517
105 Ga0105239_10679273 3300010375 Unclassified 1177
106 Ga0105246_10002502 3300011119 Bacteria 11117
107 Ga0105246_10007487 3300011119 Bacteria 6691
108 Ga0157370_10106377 3300013104 Bacteria 2625
109 Ga0157374_10000002 3300013296 Bacteria 1054226
110 Ga0157374_10002328 3300013296 Bacteria 16037
111 Ga0157374_10112964 3300013296 Bacteria 2614
112 Ga0157378_10012008 3300013297 Bacteria 7583
113 Ga0157378_10017997 3300013297 Bacteria 6203
114 Ga0163162_10000068 3300013306 Bacteria 97068
115 Ga0163162_10000164 3300013306 Bacteria 60866
116 Ga0163162_10001433 3300013306 Bacteria 22226
117 Ga0163162_10005562 3300013306 Bacteria 12192
118 Ga0163162_10162565 3300013306 Unclassified 2355
119 Ga0157372_10001255 3300013307 Bacteria 27453
120 Ga0157375_10013831 3300013308 Bacteria 7192
121 Ga0157375_10090357 3300013308 Bacteria 3121
122 Ga0163163_10069755 3300014325 Bacteria 3500
123 Ga0157380_10064499 3300014326 Bacteria 2941
124 Ga0157380_10365843 3300014326 Bacteria 1355
125 Ga0157379_10071678 3300014968 Bacteria 3099
126 Ga0157379_10255476 3300014968 Bacteria 1591
127 Ga0157376_10007195 3300014969 Bacteria 7913
128 Ga0157376_10059771 3300014969 Bacteria 3197
129 Ga0182005_1000876 3300015265 Bacteria 13338
130 Ga0163161_10010871 3300017792 Bacteria 6309
131 Ga0207425_1022418 3300025245 Bacteria 1331
132 Ga0209646_1000003 3300025246 Bacteria 1160860
133 Ga0209026_1000333 3300025250 Bacteria 45722
134 Ga0209129_1009689 3300025258 Bacteria 2500
135 Ga0209676_1000675 3300025292 Bacteria 48431
136 Ga0209676_1000695 3300025292 Bacteria 47271
137 Ga0209758_1015469 3300025297 Bacteria 3945
138 Ga0207426_1000258 3300025302 Bacteria 114759
139 Ga0207426_1000277 3300025302 Bacteria 106036
140 Ga0209257_1000064 3300025304 Bacteria 356803
141 Ga0207656_10023684 3300025321 Bacteria 2475
142 Ga0207642_10059481 3300025899 Bacteria 1767
143 Ga0207710_10005945 3300025900 Bacteria 5234
144 Ga0207680_10000036 3300025903 Bacteria 73025
145 Ga0207680_10017049 3300025903 Unclassified 3829
146 Ga0207647_10060338 3300025904 Bacteria 2318
147 Ga0207645_10004077 3300025907 Bacteria 10880
148 Ga0207654_10000967 3300025911 Bacteria 15770
149 Ga0207654_10005646 3300025911 Bacteria 6324
150 Ga0207695_10000300 3300025913 Bacteria 122104
151 Ga0207695_10000425 3300025913 Bacteria 93523
152 Ga0207695_10038876 3300025913 Bacteria 5117
153 Ga0207695_10045234 3300025913 Unclassified 4674
154 Ga0207695_10089253 3300025913 Bacteria 3100
155 Ga0207695_10098906 3300025913 Bacteria 2916
156 Ga0207671_10003135 3300025914 Bacteria 16794
157 Ga0207671_10003462 3300025914 Bacteria 15713
158 Ga0207671_10004571 3300025914 Bacteria 13146
159 Ga0207671_10008950 3300025914 Bacteria 8424
160 Ga0207671_10015793 3300025914 Bacteria 5893
161 Ga0207671_10020482 3300025914 Bacteria 5033
162 Ga0207644_10025609 3300025931 Bacteria 4057
163 Ga0207706_10090044 3300025933 Bacteria 2697
164 Ga0207686_10058290 3300025934 Bacteria 2434
165 Ga0207704_10000037 3300025938 Bacteria 93990
166 Ga0207691_10219029 3300025940 Bacteria 1651
167 Ga0207667_10043790 3300025949 Bacteria 4748
168 Ga0207712_10041665 3300025961 Bacteria 3157
169 Ga0207712_10182997 3300025961 Unclassified 1647
170 Ga0207677_10038624 3300026023 Bacteria 3132
171 Ga0207703_10007215 3300026035 Bacteria 8841
172 Ga0207703_10267726 3300026035 Bacteria 1547
173 Ga0207639_10013034 3300026041 Bacteria 5804
174 Ga0207702_10078082 3300026078 Bacteria 2865
175 Ga0207641_10035801 3300026088 Bacteria 4139
176 Ga0207641_10067784 3300026088 Bacteria 3058
177 Ga0207648_10000770 3300026089 Bacteria 36093
178 Ga0207676_10006112 3300026095 Bacteria 8499
179 Ga0207675_100034940 3300026118 Bacteria 4687
180 Ga0207683_10002162 3300026121 Bacteria 17271
181 Ga0207698_10001336 3300026142 Bacteria 14370
182 Ga0268266_10000095 3300028379 Bacteria 186169
183 Ga0268264_10000015 3300028381 Bacteria 508501
184 Ga0268264_10001262 3300028381 Bacteria 24026
185 Ga0268264_10001375 3300028381 Bacteria 22770
186 Ga0268264_10007740 3300028381 Bacteria 8946
187 Ga0268264_10070275 3300028381 Bacteria 2964
188 Ga0307517_10005537 3300028786 Bacteria 18980
189 Ga0307515_10000012 3300028794 Bacteria 582232
190 Ga0307515_10000927 3300028794 Bacteria 67260
191 Ga0307515_10003662 3300028794 Bacteria 32273
192 Ga0307515_10061893 3300028794 Bacteria 5298
193 Ga0307515_10062430 3300028794 Bacteria 5260
194 Ga0307511_10027075 3300030521 Bacteria 5242
195 Ga0265327_10000084 3300031251 Bacteria 204433
196 Ga0307405_10003400 3300031731 Bacteria 7306
197 Ga0307405_10077135 3300031731 Bacteria 2164
198 Ga0307412_10139683 3300031911 Bacteria 1772
199 Ga0307414_10063246 3300032004 Bacteria 2630
200 Ga0307414_10191984 3300032004 Bacteria 1653
201 Ga0307510_10002832 3300033180 Bacteria 19916
202 Ga0395899_0027852 3300037312 Bacteria 4257
203 Ga0395900_0004442 3300037418 Bacteria 14859
204 Ga0395905_0000686 3300037471 Bacteria 44822
205 Ga0395901_0017450 3300038443 Bacteria 7325
206 Ga0439431_0003046 3300041997 Bacteria 3678
207 Ga0439455_0024019 3300042012 Bacteria 1472
208 Ga0466972_0000012 3300044658 Bacteria 246338
209 Ga0466972_0003919 3300044658 Bacteria 7420
210 Ga0466982_0045990 3300044672 Bacteria 2659
211 Ga0466964_0058879 3300044706 Bacteria 1594
212 Ga0466957_0003093 3300044842 Bacteria 9056
213 Ga0466957_0154000 3300044842 Bacteria 1488
214 Ga0466959_0008565 3300045049 Bacteria 7239
215 Ga0495650_0016033 3300046471 Bacteria 3815
216 Ga0495585_0000763 3300046492 Bacteria 28491
217 Ga0495616_0009521 3300046513 Bacteria 5674
218 Ga0495609_0007093 3300046538 Bacteria 5639
219 Ga0495633_0000056 3300046558 Bacteria 149334
220 Ga0495668_0000021 3300046616 Bacteria 381308
221 Ga0495625_0000949 3300046660 Bacteria 38756
222 Ga0495625_0007054 3300046660 Bacteria 9874
223 Ga0495625_0033460 3300046660 Bacteria 3802
224 Ga0495658_0026458 3300046683 Bacteria 3110
225 Ga0495672_0036260 3300047320 Bacteria 3029
226 Ga0495683_0056631 3300047323 Bacteria 1950
227 Ga0495687_000004 3300047443 Bacteria 779298
228 Ga0495687_001629 3300047443 Bacteria 20224
229 Ga0495686_0000097 3300047472 Bacteria 183450
230 Ga0496121_0000007 3300048924 Bacteria 942516
231 Ga0496126_0012177 3300048929 Bacteria 8828
232 Ga0495678_025579 3300049459 Bacteria 2533
233 Ga0501044_0062989 3300049823 Bacteria 3790
234 nmdc:mga0k408_293_c1 3300050493 Bacteria 24289
235 Ga0500644_0000202 3300053088 Bacteria 36222
236 Ga0500583_0009292 3300053092 Bacteria 3584
237 Ga0500569_000108 3300053109 Bacteria 12916
238 Ga0500608_000867 3300053122 Bacteria 10918
239 Ga0500608_007041 3300053122 Bacteria 4624
240 Ga0500652_026622 3300053131 Bacteria 2229
241 Ga0500658_0002250 3300053134 Bacteria 7480
242 Ga0500559_0008177 3300053136 Bacteria 4600
243 Ga0500559_0035854 3300053136 Unclassified 2144
244 Ga0500564_026023 3300053138 Bacteria 2689
245 Ga0500568_0001347 3300053139 Bacteria 15992
246 Ga0500568_0009857 3300053139 Bacteria 4514
247 Ga0500616_0028359 3300053153 Bacteria 3085
248 Ga0500622_0000203 3300053156 Bacteria 63042
249 Ga0500633_0013787 3300053160 Bacteria 2276
250 Ga0500637_0103165 3300053178 Bacteria 1654

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009553 Ga0105249_10252155 Ga0105249_102521552 305
2 3300010375 Ga0105239_10679273 Ga0105239_106792731 305
3 3300044842 Ga0466957_0154000 Ga0466957_0154000_17_946 306
4 3300053156 Ga0500622_0000203 Ga0500622_0000203_870_1877 323
5 3300009545 Ga0105237_10001181 Ga0105237_1000118129 325
6 3300005334 Ga0068869_100106821 Ga0068869_1001068212 330
7 3300009176 Ga0105242_10090028 Ga0105242_100900282 330
8 3300028794 Ga0307515_10000012 Ga0307515_10000012491 330
9 3300046471 Ga0495650_0016033 Ga0495650_0016033_2293_3327 330
10 3300028794 Ga0307515_10062430 Ga0307515_100624303 331
11 3300003323 rootH1_10222474 rootH1_102224742 332
12 3300010375 Ga0105239_10043187 Ga0105239_100431872 332
13 3300028786 Ga0307517_10005537 Ga0307517_1000553715 335
14 3300053088 Ga0500644_0000202 Ga0500644_0000202_30889_31968 336
15 3300053160 Ga0500633_0013787 Ga0500633_0013787_924_2003 336
16 3300003316 rootH1_10138601 rootH1_101386016 337
17 3300047320 Ga0495672_0036260 Ga0495672_0036260_832_1845 337
18 3300003354 JGI25160J50197_1006712 JGI25160J50197_10067122 338
19 3300005548 Ga0070665_100000008 Ga0070665_100000008485 338
20 3300015265 Ga0182005_1000876 Ga0182005_100087611 338
21 3300025302 Ga0207426_1000258 Ga0207426_100025857 338
22 3300037312 Ga0395899_0027852 Ga0395899_0027852_660_1724 338
23 3300037418 Ga0395900_0004442 Ga0395900_0004442_13720_14784 338
24 3300037471 Ga0395905_0000686 Ga0395905_0000686_10630_11694 338
25 3300038443 Ga0395901_0017450 Ga0395901_0017450_3499_4563 338
26 3300028794 Ga0307515_10061893 Ga0307515_100618932 339
27 3300041997 Ga0439431_0003046 Ga0439431_0003046_1823_2848 339
28 3300053092 Ga0500583_0009292 Ga0500583_0009292_301_1428 341
29 3300053131 Ga0500652_026622 Ga0500652_026622_1112_2146 341
30 3300005843 Ga0068860_100001478 Ga0068860_1000014781 343
31 3300013296 Ga0157374_10112964 Ga0157374_101129643 343
32 3300013306 Ga0163162_10001433 Ga0163162_1000143310 343
33 3300014326 Ga0157380_10365843 Ga0157380_103658432 343
34 3300028381 Ga0268264_10001375 Ga0268264_1000137515 343
35 3300053122 Ga0500608_000867 Ga0500608_000867_9413_10477 343
36 3300005355 Ga0070671_100056352 Ga0070671_1000563522 344
37 3300009551 Ga0105238_10017652 Ga0105238_100176523 344
38 3300010375 Ga0105239_10051414 Ga0105239_100514143 344
39 3300025931 Ga0207644_10025609 Ga0207644_100256093 344
40 3300044658 Ga0466972_0000012 Ga0466972_0000012_116806_117840 344
41 3300047443 Ga0495687_000004 Ga0495687_000004_642281_643408 347
42 3300032004 Ga0307414_10063246 Ga0307414_100632462 348
43 3300048924 Ga0496121_0000007 Ga0496121_0000007_369541_370611 348
44 iso_pu_bacteria 2522125168 2522551228 348
45 3300005262 Ga0065165_1000603 Ga0065165_100060314 349
46 3300009553 Ga0105249_10227222 Ga0105249_102272222 349
47 3300013308 Ga0157375_10013831 Ga0157375_100138314 349
48 3300025292 Ga0209676_1000675 Ga0209676_100067513 349
49 3300031731 Ga0307405_10003400 Ga0307405_100034002 349
50 3300033180 Ga0307510_10002832 Ga0307510_100028322 349
51 3300042012 Ga0439455_0024019 Ga0439455_0024019_71_1135 349
52 3300047323 Ga0495683_0056631 Ga0495683_0056631_82_1212 349
53 3300047443 Ga0495687_001629 Ga0495687_001629_8802_9866 349
54 3300003323 rootH1_10017298 rootH1_1001729814 350
55 iso_pu_bacteria 2929239360 2929241169 350
56 3300009093 Ga0105240_10000383 Ga0105240_1000038312 351
57 3300009545 Ga0105237_10031458 Ga0105237_100314582 351
58 3300009551 Ga0105238_10367366 Ga0105238_103673662 351
59 3300025913 Ga0207695_10000300 Ga0207695_1000030062 351
60 3300005328 Ga0070676_10001009 Ga0070676_100010098 352
61 3300005334 Ga0068869_100315783 Ga0068869_1003157831 352
62 3300005338 Ga0068868_100012799 Ga0068868_1000127992 352
63 3300005456 Ga0070678_100000507 Ga0070678_10000050711 352
64 3300005459 Ga0068867_100001225 Ga0068867_10000122516 352
65 3300005539 Ga0068853_100006691 Ga0068853_1000066918 352
66 3300005543 Ga0070672_100204658 Ga0070672_1002046582 352
67 3300005614 Ga0068856_100030559 Ga0068856_1000305593 352
68 3300005616 Ga0068852_100003993 Ga0068852_1000039938 352
69 3300005718 Ga0068866_10123435 Ga0068866_101234351 352
70 3300006237 Ga0097621_100000041 Ga0097621_10000004129 352
71 3300006358 Ga0068871_100000719 Ga0068871_10000071923 352
72 3300006881 Ga0068865_100000886 Ga0068865_1000008863 352
73 3300009174 Ga0105241_10005060 Ga0105241_100050607 352
74 3300009176 Ga0105242_10007070 Ga0105242_100070702 352
75 3300010375 Ga0105239_10025822 Ga0105239_100258224 352
76 3300013104 Ga0157370_10106377 Ga0157370_101063772 352
77 3300013296 Ga0157374_10002328 Ga0157374_100023283 352
78 3300013297 Ga0157378_10012008 Ga0157378_100120086 352
79 3300014969 Ga0157376_10059771 Ga0157376_100597713 352
80 3300025899 Ga0207642_10059481 Ga0207642_100594812 352
81 3300025907 Ga0207645_10004077 Ga0207645_100040777 352
82 3300025914 Ga0207671_10015793 Ga0207671_100157935 352
83 3300025934 Ga0207686_10058290 Ga0207686_100582902 352
84 3300025938 Ga0207704_10000037 Ga0207704_1000003727 352
85 3300025940 Ga0207691_10219029 Ga0207691_102190292 352
86 3300025961 Ga0207712_10182997 Ga0207712_101829972 352
87 3300026078 Ga0207702_10078082 Ga0207702_100780823 352
88 3300026089 Ga0207648_10000770 Ga0207648_1000077031 352
89 3300026118 Ga0207675_100034940 Ga0207675_1000349403 352
90 3300026121 Ga0207683_10002162 Ga0207683_100021628 352
91 3300026142 Ga0207698_10001336 Ga0207698_100013368 352
92 3300028381 Ga0268264_10070275 Ga0268264_100702752 352
93 3300053136 Ga0500559_0035854 Ga0500559_0035854_814_1893 352
94 3300009545 Ga0105237_10060573 Ga0105237_100605732 354
95 3300053109 Ga0500569_000108 Ga0500569_000108_10924_12060 354
96 3300053134 Ga0500658_0002250 Ga0500658_0002250_5414_6550 354
97 3300053153 Ga0500616_0028359 Ga0500616_0028359_641_1777 354
98 3300005289 Ga0065704_10166443 Ga0065704_101664431 356
99 3300053136 Ga0500559_0008177 Ga0500559_0008177_73_1179 356
100 iso_pu_bacteria 2818991442 2819575438 356
101 3300003320 rootH2_10014180 rootH2_100141805 357
102 3300005329 Ga0070683_100306750 Ga0070683_1003067501 357
103 3300005539 Ga0068853_100002461 Ga0068853_1000024612 357
104 3300009551 Ga0105238_10074957 Ga0105238_100749573 357
105 3300013307 Ga0157372_10001255 Ga0157372_1000125523 357
106 3300025904 Ga0207647_10060338 Ga0207647_100603382 357
107 3300026041 Ga0207639_10013034 Ga0207639_100130342 357
108 3300044658 Ga0466972_0003919 Ga0466972_0003919_4597_5937 357
109 3300003320 rootH2_10001944 rootH2_1000194413 358
110 3300006358 Ga0068871_100076216 Ga0068871_1000762161 358
111 3300009545 Ga0105237_10023294 Ga0105237_100232945 358
112 3300010375 Ga0105239_10000101 Ga0105239_1000010166 358
113 3300013296 Ga0157374_10000002 Ga0157374_10000002720 358
114 3300014969 Ga0157376_10007195 Ga0157376_100071957 358
115 3300025913 Ga0207695_10045234 Ga0207695_100452345 358
116 3300025914 Ga0207671_10020482 Ga0207671_100204824 358
117 3300025933 Ga0207706_10090044 Ga0207706_100900442 358
118 3300045049 Ga0466959_0008565 Ga0466959_0008565_2457_3560 358
119 3300005262 Ga0065165_1006588 Ga0065165_10065882 360
120 3300005548 Ga0070665_100000083 Ga0070665_10000008339 360
121 3300005840 Ga0068870_10104307 Ga0068870_101043072 360
122 3300009093 Ga0105240_10044823 Ga0105240_100448231 360
123 3300009093 Ga0105240_10071110 Ga0105240_100711102 360
124 3300010375 Ga0105239_10040793 Ga0105239_100407931 360
125 3300013306 Ga0163162_10000068 Ga0163162_1000006838 360
126 3300017792 Ga0163161_10010871 Ga0163161_100108711 360
127 3300025913 Ga0207695_10038876 Ga0207695_100388763 360
128 3300025913 Ga0207695_10089253 Ga0207695_100892532 360
129 3300025914 Ga0207671_10008950 Ga0207671_100089505 360
130 3300025949 Ga0207667_10043790 Ga0207667_100437903 360
131 3300028379 Ga0268266_10000095 Ga0268266_1000009543 360
132 3300053138 Ga0500564_026023 Ga0500564_026023_1507_2661 360
133 iso_pu_bacteria 2929177148 2929180735 360
134 iso_pu_bacteria 2945977869 2945983133 360
135 iso_pu_bacteria 2946013367 2946017475 360
136 3300005367 Ga0070667_100014864 Ga0070667_1000148642 361
137 3300005617 Ga0068859_100056318 Ga0068859_1000563182 361
138 3300005843 Ga0068860_100002928 Ga0068860_1000029282 361
139 3300006931 Ga0097620_100056318 Ga0097620_1000563182 361
140 3300028381 Ga0268264_10007740 Ga0268264_100077402 361
141 3300047472 Ga0495686_0000097 Ga0495686_0000097_53682_54809 361
142 3300003320 rootH2_10002437 rootH2_100024373 362
143 3300003320 rootH2_10004626 rootH2_100046265 362
144 3300003323 rootH1_10061083 rootH1_100610835 362
145 3300003781 Ga0055536_1010028 Ga0055536_10100283 362
146 3300005262 Ga0065165_1000085 Ga0065165_10000857 362
147 3300009545 Ga0105237_10001887 Ga0105237_1000188721 362
148 3300009551 Ga0105238_10128742 Ga0105238_101287423 362
149 3300010375 Ga0105239_10000006 Ga0105239_10000006248 362
150 3300025292 Ga0209676_1000695 Ga0209676_100069523 362
151 3300025914 Ga0207671_10003135 Ga0207671_100031359 362
152 3300031731 Ga0307405_10077135 Ga0307405_100771352 362
153 3300031911 Ga0307412_10139683 Ga0307412_101396832 362
154 3300032004 Ga0307414_10191984 Ga0307414_101919841 362
155 3300053178 Ga0500637_0103165 Ga0500637_0103165_146_1366 362
156 3300005288 Ga0065714_10069197 Ga0065714_100691972 363
157 3300005335 Ga0070666_10000424 Ga0070666_1000042419 363
158 3300005335 Ga0070666_10017970 Ga0070666_100179703 363
159 3300005355 Ga0070671_100054596 Ga0070671_1000545963 363
160 3300005364 Ga0070673_100045012 Ga0070673_1000450124 363
161 3300005617 Ga0068859_100000960 Ga0068859_1000009609 363
162 3300005618 Ga0068864_100024875 Ga0068864_1000248755 363
163 3300005834 Ga0068851_10004927 Ga0068851_100049278 363
164 3300005834 Ga0068851_10006220 Ga0068851_100062203 363
165 3300005841 Ga0068863_100015688 Ga0068863_1000156882 363
166 3300005841 Ga0068863_100036802 Ga0068863_1000368023 363
167 3300005842 Ga0068858_100008173 Ga0068858_1000081736 363
168 3300005842 Ga0068858_100436745 Ga0068858_1004367452 363
169 3300005843 Ga0068860_100000059 Ga0068860_10000005989 363
170 3300005843 Ga0068860_100003201 Ga0068860_10000320110 363
171 3300006195 Ga0075366_10000785 Ga0075366_1000078510 363
172 3300006237 Ga0097621_100252494 Ga0097621_1002524942 363
173 3300006358 Ga0068871_100119569 Ga0068871_1001195692 363
174 3300006931 Ga0097620_100000960 Ga0097620_1000009609 363
175 3300009093 Ga0105240_10000767 Ga0105240_1000076738 363
176 3300009101 Ga0105247_10004380 Ga0105247_100043809 363
177 3300009174 Ga0105241_10004552 Ga0105241_100045522 363
178 3300009174 Ga0105241_10007401 Ga0105241_100074017 363
179 3300009545 Ga0105237_10004353 Ga0105237_100043536 363
180 3300009545 Ga0105237_10011754 Ga0105237_100117542 363
181 3300009551 Ga0105238_10002718 Ga0105238_1000271812 363
182 3300009553 Ga0105249_10019061 Ga0105249_100190615 363
183 3300009553 Ga0105249_10137114 Ga0105249_101371142 363
184 3300010375 Ga0105239_10050865 Ga0105239_100508653 363
185 3300011119 Ga0105246_10002502 Ga0105246_100025024 363
186 3300011119 Ga0105246_10007487 Ga0105246_100074875 363
187 3300013297 Ga0157378_10017997 Ga0157378_100179974 363
188 3300013306 Ga0163162_10000164 Ga0163162_1000016449 363
189 3300013306 Ga0163162_10005562 Ga0163162_100055623 363
190 3300013308 Ga0157375_10090357 Ga0157375_100903572 363
191 3300014325 Ga0163163_10069755 Ga0163163_100697552 363
192 3300014968 Ga0157379_10071678 Ga0157379_100716782 363
193 3300014968 Ga0157379_10255476 Ga0157379_102554762 363
194 3300025321 Ga0207656_10023684 Ga0207656_100236842 363
195 3300025900 Ga0207710_10005945 Ga0207710_100059454 363
196 3300025903 Ga0207680_10000036 Ga0207680_1000003663 363
197 3300025903 Ga0207680_10017049 Ga0207680_100170492 363
198 3300025911 Ga0207654_10000967 Ga0207654_100009676 363
199 3300025911 Ga0207654_10005646 Ga0207654_100056465 363
200 3300025913 Ga0207695_10000425 Ga0207695_1000042534 363
201 3300025914 Ga0207671_10003462 Ga0207671_100034626 363
202 3300025914 Ga0207671_10004571 Ga0207671_1000457111 363
203 3300025961 Ga0207712_10041665 Ga0207712_100416652 363
204 3300026023 Ga0207677_10038624 Ga0207677_100386243 363
205 3300026035 Ga0207703_10007215 Ga0207703_100072155 363
206 3300026088 Ga0207641_10035801 Ga0207641_100358012 363
207 3300026088 Ga0207641_10067784 Ga0207641_100677843 363
208 3300026095 Ga0207676_10006112 Ga0207676_100061125 363
209 3300028381 Ga0268264_10000015 Ga0268264_10000015384 363
210 3300028381 Ga0268264_10001262 Ga0268264_1000126216 363
211 3300028794 Ga0307515_10000927 Ga0307515_1000092743 363
212 3300028794 Ga0307515_10003662 Ga0307515_100036627 363
213 3300030521 Ga0307511_10027075 Ga0307511_100270752 363
214 3300044672 Ga0466982_0045990 Ga0466982_0045990_1304_2473 363
215 3300046492 Ga0495585_0000763 Ga0495585_0000763_20074_21192 363
216 3300046513 Ga0495616_0009521 Ga0495616_0009521_4015_5139 363
217 3300046538 Ga0495609_0007093 Ga0495609_0007093_2803_3921 363
218 3300046558 Ga0495633_0000056 Ga0495633_0000056_9273_10391 363
219 3300046616 Ga0495668_0000021 Ga0495668_0000021_330190_331308 363
220 3300046660 Ga0495625_0000949 Ga0495625_0000949_1391_2509 363
221 3300046660 Ga0495625_0007054 Ga0495625_0007054_8024_9148 363
222 3300046660 Ga0495625_0033460 Ga0495625_0033460_1217_2338 363
223 3300046683 Ga0495658_0026458 Ga0495658_0026458_1214_2332 363
224 3300049459 Ga0495678_025579 Ga0495678_025579_152_1276 363
225 3300050493 nmdc:mga0k408_293_c1 nmdc:mga0k408_293_c1_9463_10581 363
226 3300053122 Ga0500608_007041 Ga0500608_007041_3349_4491 363
227 3300053139 Ga0500568_0009857 Ga0500568_0009857_1166_2293 363
228 iso_pu_bacteria 2522125168 2522553257 363
229 iso_pu_bacteria 2919437846 2919439127 363
230 3300003320 rootH2_10076271 rootH2_100762712 364
231 3300003322 rootL2_10048356 rootL2_100483562 364
232 3300003794 Ga0055531_10000076 Ga0055531_1000007630 364
233 3300005335 Ga0070666_10113448 Ga0070666_101134481 364
234 3300010375 Ga0105239_10050920 Ga0105239_100509204 364
235 3300013306 Ga0163162_10162565 Ga0163162_101625652 364
236 3300025304 Ga0209257_1000064 Ga0209257_100006431 364
237 3300026035 Ga0207703_10267726 Ga0207703_102677261 364
238 3300048929 Ga0496126_0012177 Ga0496126_0012177_1179_2327 364
239 iso_pu_bacteria 2929921140 2929926351 364
240 iso_pu_bacteria 8003151029 8003151773 364
241 3300003322 rootL2_10175446 rootL2_101754462 365
242 3300003323 rootH1_10209329 rootH1_102093296 365
243 3300009093 Ga0105240_10058723 Ga0105240_100587235 365
244 3300014326 Ga0157380_10064499 Ga0157380_100644993 365
245 3300025913 Ga0207695_10098906 Ga0207695_100989062 365
246 3300031251 Ga0265327_10000084 Ga0265327_1000008411 365
247 3300044706 Ga0466964_0058879 Ga0466964_0058879_22_1155 365
248 3300044842 Ga0466957_0003093 Ga0466957_0003093_1372_2535 365
249 3300053139 Ga0500568_0001347 Ga0500568_0001347_7213_8346 365
250 3300001979 JGI24740J21852_10004600 JGI24740J21852_100046003 368
251 3300002738 JGI25154J39366_1000016 JGI25154J39366_1000016168 368
252 3300002741 JGI25157J39369_1006062 JGI25157J39369_10060622 368
253 3300003354 JGI25160J50197_1000835 JGI25160J50197_100083510 368
254 3300025245 Ga0207425_1022418 Ga0207425_10224181 368
255 3300025246 Ga0209646_1000003 Ga0209646_1000003170 368
256 3300025250 Ga0209026_1000333 Ga0209026_10003339 368
257 3300025258 Ga0209129_1009689 Ga0209129_10096892 368
258 3300025297 Ga0209758_1015469 Ga0209758_10154692 368
259 3300025302 Ga0207426_1000277 Ga0207426_100027715 368
260 3300049823 Ga0501044_0062989 Ga0501044_0062989_865_2061 368

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06580

His_kinase

Histidine kinase

211

290

0.92

Feature Viewer

pLDDT pTM Quality
70.07 0.47 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map