F369741
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 260 | 185 | 237 | 310 |
Family's Representative Sequence
| Representative Sequence | 3300041511|Ga0451855_0942538|Ga0451855_0942538_854_1870 |
| Length | 338 |
| Sequence | VVAPFHRNWHDVMEPEMNKHDYALSRRGFCLCCLGGATFATTGGWLTPAEVFAAAKSLVVQIREAAAAADITTTKLRGGISALSGSGGNMGVLVGEDGKLLVDAGITATRPRIEKALADLGPQPIKHLINSHWHFDHTDGNEWLNSEGAVIMAHPNSLKHLTVATRVEDWDFDFPASPKGALPTMLMKGDEEALKHNGQTVALKYYGPAHTDSDISVFFQEANVVHVADTFWNGVYPFIDYSTGGSIDGQIQAAEANVKMVDDQTIVIPGHGEIGNKKDLIAWRDMLVGIRENVAKLKKDGRSVEETIAAKPTAKWDPVFGNWAISPALFTRLAYEGV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513237146 | Rhizobium mongolense USDA 1844 (Illumina) | Isolate | Nodule |
| 2 | 2515154113 | Rhizobium ruizarguesonis Vc2 | Isolate | Nodule |
| 3 | 2515154114 | Rhizobium ruizarguesonis Vh3 | Isolate | Nodule |
| 4 | 2534681796 | Rhizobium grahamii CCGE 502 | Isolate | Nodule |
| 5 | 2582581308 | Rhizobium sp. OK494 | Isolate | Rhizosphere |
| 6 | 2585427527 | Rhizobium lusitanum YR374 | Isolate | Rhizosphere |
| 7 | 2599185170 | Rhizobium mongolense USDA 1844 (PacBio) | Isolate | Nodule |
| 8 | 2643221643 | Rhizobium sp. Root1220 | Isolate | Unclassified |
| 9 | 2738541293 | Rhizobium sp. GV031 | Isolate | Unclassified |
| 10 | 2821123053 | Rhizobium cellulosilyticum 1193 | Isolate | Unclassified |
| 11 | 2821443989 | Inquilinus ginsengisoli 584 | Isolate | Unclassified |
| 12 | 2838035591 | Rhizobium mongolense SEMIA 4087 | Isolate | Nodule |
| 13 | 2842110456 | Rhizobium esperanzae SEMIA 414 | Isolate | Nodule |
| 14 | 2844533157 | Inquilinus sp. R-72501 v. 2 | Isolate | Unclassified |
| 15 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 16 | 2852387548 | Rhizobium jaguaris CCGE525 | Isolate | Unclassified |
| 17 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 18 | 2933586486 | Rhizobium leguminosarum SEMIA 4039 | Isolate | Nodule |
| 19 | 2977942078 | Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 | Isolate | Nodule |
| 20 | 3005445848 | Rhizobium sp. WYJ-E13 | Isolate | Unclassified |
| 21 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 22 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 23 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 24 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 25 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 26 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 27 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 28 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 29 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 30 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 42 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 43 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 44 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 45 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 47 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 59 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 60 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 61 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 62 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 63 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 64 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 65 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 66 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 67 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 68 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 69 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 70 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 71 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 72 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 73 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 90 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 91 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 92 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 93 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 94 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 95 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 96 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 97 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 98 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 99 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 100 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 101 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 102 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 103 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 104 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 141 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 142 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 143 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 144 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 145 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 146 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 147 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 148 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 149 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 150 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 151 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 152 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 153 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 154 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 155 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 156 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 157 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 158 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 159 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 160 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 161 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 162 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 163 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 164 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 165 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 166 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 167 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 168 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 169 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 170 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 171 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 172 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 173 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 174 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 175 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 176 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 177 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 178 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 179 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 180 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 181 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 182 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 183 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 184 | 8005542996 | Rhizobium grahamii CCGM3 | Isolate | Unclassified |
| 185 | 8024486573 | Rhizobium tubonense CCBAU 85046 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 91.15 |
| Metatranscriptomes | 0 |
| Isolates | 8.85 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 20.38 |
| Nodule | 4.62 |
| Rhizoplane | 6.54 |
| Rhizosphere | 41.54 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 26.92 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25152J39213_1006787 | 3300002773 | Bacteria | 3044 |
| 2 | JGI25165J46597_1001928 | 3300003214 | Bacteria | 8228 |
| 3 | rootH1_10088588 | 3300003323 | Bacteria | 2167 |
| 4 | JGI25160J50197_1005015 | 3300003354 | Bacteria | 5601 |
| 5 | JGI25160J50197_1005480 | 3300003354 | Bacteria | 5275 |
| 6 | Ga0055539_1003689 | 3300003752 | Bacteria | 2100 |
| 7 | Ga0055524_1009924 | 3300003775 | Bacteria | 3828 |
| 8 | Ga0055528_1000039 | 3300003790 | Bacteria | 112899 |
| 9 | Ga0055528_1002356 | 3300003790 | Bacteria | 10222 |
| 10 | Ga0055528_1007327 | 3300003790 | Bacteria | 4895 |
| 11 | Ga0065165_1002335 | 3300005262 | Bacteria | 16541 |
| 12 | Ga0065165_1018992 | 3300005262 | Bacteria | 2469 |
| 13 | Ga0068868_100157350 | 3300005338 | Bacteria | 1874 |
| 14 | Ga0070689_100035397 | 3300005340 | Bacteria | 3816 |
| 15 | Ga0070711_100009465 | 3300005439 | Bacteria | 6005 |
| 16 | Ga0070708_100098967 | 3300005445 | Unclassified | 2667 |
| 17 | Ga0070663_100025243 | 3300005455 | Bacteria | 4010 |
| 18 | Ga0070663_100061744 | 3300005455 | Bacteria | 2699 |
| 19 | Ga0070662_100447930 | 3300005457 | Bacteria | 1071 |
| 20 | Ga0070706_100219095 | 3300005467 | Unclassified | 1776 |
| 21 | Ga0070707_100060328 | 3300005468 | Bacteria | 3638 |
| 22 | Ga0070698_100183670 | 3300005471 | Bacteria | 2029 |
| 23 | Ga0070699_100104071 | 3300005518 | Bacteria | 2490 |
| 24 | Ga0070697_100141927 | 3300005536 | Unclassified | 2020 |
| 25 | Ga0070665_100073397 | 3300005548 | Bacteria | 3427 |
| 26 | Ga0068855_100180321 | 3300005563 | Bacteria | 2388 |
| 27 | Ga0068856_100522848 | 3300005614 | Bacteria | 1208 |
| 28 | Ga0068852_100172739 | 3300005616 | Bacteria | 2027 |
| 29 | Ga0075365_10078845 | 3300006038 | Bacteria | 2228 |
| 30 | Ga0070715_10060466 | 3300006163 | Bacteria | 1661 |
| 31 | Ga0099794_10134168 | 3300007265 | Bacteria | 1251 |
| 32 | Ga0105240_10000255 | 3300009093 | Bacteria | 105565 |
| 33 | Ga0105247_10074368 | 3300009101 | Bacteria | 2131 |
| 34 | Ga0105248_10144529 | 3300009177 | Bacteria | 2684 |
| 35 | Ga0105237_10001144 | 3300009545 | Bacteria | 35671 |
| 36 | Ga0105249_10726207 | 3300009553 | Bacteria | 1055 |
| 37 | Ga0105239_10000932 | 3300010375 | Bacteria | 41400 |
| 38 | Ga0105239_10078725 | 3300010375 | Bacteria | 3627 |
| 39 | Ga0105246_10436886 | 3300011119 | Bacteria | 1096 |
| 40 | Ga0157369_10016648 | 3300013105 | Bacteria | 8266 |
| 41 | Ga0163162_10113407 | 3300013306 | Bacteria | 2809 |
| 42 | Ga0163162_10345502 | 3300013306 | Bacteria | 1620 |
| 43 | Ga0163162_10682561 | 3300013306 | Bacteria | 1149 |
| 44 | Ga0157375_10038494 | 3300013308 | Bacteria | 4592 |
| 45 | Ga0163163_10131011 | 3300014325 | Bacteria | 2548 |
| 46 | Ga0182005_1004760 | 3300015265 | Bacteria | 4330 |
| 47 | Ga0213874_10009839 | 3300021377 | Bacteria | 2377 |
| 48 | Ga0213876_10054247 | 3300021384 | Bacteria | 2116 |
| 49 | Ga0213875_10022131 | 3300021388 | Bacteria | 3042 |
| 50 | Ga0213871_10003523 | 3300021441 | Bacteria | 3028 |
| 51 | Ga0209563_102897 | 3300025230 | Bacteria | 3714 |
| 52 | Ga0209677_100272 | 3300025253 | Bacteria | 34642 |
| 53 | Ga0209129_1000237 | 3300025258 | Bacteria | 60205 |
| 54 | Ga0209233_1000282 | 3300025261 | Bacteria | 70340 |
| 55 | Ga0209673_1000132 | 3300025273 | Bacteria | 162349 |
| 56 | Ga0209673_1000161 | 3300025273 | Bacteria | 142073 |
| 57 | Ga0209673_1000554 | 3300025273 | Bacteria | 60073 |
| 58 | Ga0209673_1034712 | 3300025273 | Bacteria | 1519 |
| 59 | Ga0209025_1006818 | 3300025294 | Bacteria | 8718 |
| 60 | Ga0209564_1001841 | 3300025295 | Bacteria | 19383 |
| 61 | Ga0209564_1004757 | 3300025295 | Bacteria | 8119 |
| 62 | Ga0209564_1031985 | 3300025295 | Bacteria | 1594 |
| 63 | Ga0209758_1011849 | 3300025297 | Bacteria | 4975 |
| 64 | Ga0209256_1000292 | 3300025299 | Bacteria | 88135 |
| 65 | Ga0209256_1000479 | 3300025299 | Bacteria | 59572 |
| 66 | Ga0207426_1000354 | 3300025302 | Bacteria | 83734 |
| 67 | Ga0207710_10012394 | 3300025900 | Bacteria | 3588 |
| 68 | Ga0207684_10035008 | 3300025910 | Bacteria | 4265 |
| 69 | Ga0207695_10000352 | 3300025913 | Bacteria | 105524 |
| 70 | Ga0207671_10000534 | 3300025914 | Bacteria | 51293 |
| 71 | Ga0207663_10002917 | 3300025916 | Bacteria | 8268 |
| 72 | Ga0207706_10214131 | 3300025933 | Bacteria | 1688 |
| 73 | Ga0207670_10015478 | 3300025936 | Bacteria | 4559 |
| 74 | Ga0207665_10051098 | 3300025939 | Bacteria | 2781 |
| 75 | Ga0207667_10263912 | 3300025949 | Bacteria | 1761 |
| 76 | Ga0207640_10042144 | 3300025981 | Bacteria | 2909 |
| 77 | Ga0207677_10185406 | 3300026023 | Bacteria | 1641 |
| 78 | Ga0207678_10021956 | 3300026067 | Bacteria | 5595 |
| 79 | Ga0207678_10092069 | 3300026067 | Bacteria | 2591 |
| 80 | Ga0207708_10289320 | 3300026075 | Bacteria | 1330 |
| 81 | Ga0207702_10387049 | 3300026078 | Bacteria | 1346 |
| 82 | Ga0207698_10148141 | 3300026142 | Bacteria | 2033 |
| 83 | Ga0268265_10483820 | 3300028380 | Bacteria | 1163 |
| 84 | Ga0307517_10000008 | 3300028786 | Bacteria | 243202 |
| 85 | Ga0307509_10157905 | 3300031507 | Bacteria | 2171 |
| 86 | Ga0307405_10003912 | 3300031731 | Bacteria | 6955 |
| 87 | Ga0307510_10035866 | 3300033180 | Bacteria | 5530 |
| 88 | Ga0373936_0072504 | 3300035113 | Bacteria | 1422 |
| 89 | Ga0395905_0050446 | 3300037471 | Bacteria | 3898 |
| 90 | Ga0436364_0053036 | 3300037853 | Bacteria | 3247 |
| 91 | Ga0436364_0413544 | 3300037853 | Bacteria | 2408 |
| 92 | Ga0436365_0025836 | 3300039437 | Bacteria | 6124 |
| 93 | Ga0436360_0222245 | 3300039438 | Bacteria | 5330 |
| 94 | Ga0436363_0291218 | 3300039450 | Bacteria | 15657 |
| 95 | Ga0436363_0448408 | 3300039450 | Bacteria | 2797 |
| 96 | Ga0451793_0371502 | 3300041452 | Bacteria | 1431 |
| 97 | Ga0451841_0221433 | 3300041498 | Bacteria | 2959 |
| 98 | Ga0451851_0421712 | 3300041507 | Bacteria | 21588 |
| 99 | Ga0451855_0942538 | 3300041511 | Bacteria | 10911 |
| 100 | Ga0451853_0844562 | 3300041512 | Bacteria | 2073 |
| 101 | Ga0495592_0019818 | 3300046454 | Bacteria | 5114 |
| 102 | Ga0495638_0004161 | 3300046460 | Bacteria | 11032 |
| 103 | Ga0495651_0044298 | 3300046462 | Bacteria | 3449 |
| 104 | Ga0495651_0217851 | 3300046462 | Bacteria | 1323 |
| 105 | Ga0495653_0164224 | 3300046463 | Bacteria | 1539 |
| 106 | Ga0495605_0038581 | 3300046474 | Bacteria | 2396 |
| 107 | Ga0495664_0035019 | 3300046477 | Bacteria | 2955 |
| 108 | Ga0495664_0214151 | 3300046477 | Bacteria | 1167 |
| 109 | Ga0495585_0197268 | 3300046492 | Bacteria | 1027 |
| 110 | Ga0495606_0107362 | 3300046507 | Bacteria | 1689 |
| 111 | Ga0495608_0003835 | 3300046511 | Bacteria | 10806 |
| 112 | Ga0495610_0004246 | 3300046512 | Bacteria | 10671 |
| 113 | Ga0495610_0047338 | 3300046512 | Bacteria | 2116 |
| 114 | Ga0495628_0072061 | 3300046516 | Bacteria | 2692 |
| 115 | Ga0495632_0000703 | 3300046519 | Bacteria | 30486 |
| 116 | Ga0495632_0004024 | 3300046519 | Bacteria | 10159 |
| 117 | Ga0495652_0015106 | 3300046529 | Bacteria | 6917 |
| 118 | Ga0495652_0029484 | 3300046529 | Bacteria | 4820 |
| 119 | Ga0495652_0237366 | 3300046529 | Bacteria | 1359 |
| 120 | Ga0495652_0263812 | 3300046529 | Bacteria | 1270 |
| 121 | Ga0495640_0035251 | 3300046533 | Bacteria | 3542 |
| 122 | Ga0495640_0041523 | 3300046533 | Bacteria | 3214 |
| 123 | Ga0495587_0045361 | 3300046536 | Bacteria | 2613 |
| 124 | Ga0495622_0019678 | 3300046557 | Bacteria | 3143 |
| 125 | Ga0495622_0148642 | 3300046557 | Bacteria | 1061 |
| 126 | Ga0495667_0003327 | 3300046559 | Bacteria | 10762 |
| 127 | Ga0495634_0040362 | 3300046642 | Bacteria | 3175 |
| 128 | Ga0495634_0207804 | 3300046642 | Bacteria | 1213 |
| 129 | Ga0495635_0042909 | 3300046663 | Bacteria | 3122 |
| 130 | Ga0495661_0102853 | 3300046665 | Bacteria | 1605 |
| 131 | Ga0495588_0005368 | 3300046674 | Bacteria | 5699 |
| 132 | Ga0495657_0033529 | 3300046675 | Bacteria | 3574 |
| 133 | Ga0495599_0040860 | 3300046678 | Bacteria | 2912 |
| 134 | Ga0495623_0006484 | 3300046679 | Bacteria | 7617 |
| 135 | Ga0495646_0135210 | 3300046680 | Bacteria | 1384 |
| 136 | Ga0495613_0098755 | 3300046689 | Bacteria | 2110 |
| 137 | Ga0495649_0021576 | 3300046694 | Bacteria | 3608 |
| 138 | Ga0495600_0063666 | 3300046809 | Bacteria | 2410 |
| 139 | Ga0495604_0003922 | 3300047317 | Bacteria | 11848 |
| 140 | Ga0495604_0009181 | 3300047317 | Bacteria | 7826 |
| 141 | Ga0495674_0010755 | 3300047319 | Bacteria | 8656 |
| 142 | Ga0495676_0076320 | 3300047321 | Bacteria | 2559 |
| 143 | Ga0495676_0091192 | 3300047321 | Bacteria | 2279 |
| 144 | Ga0495680_0027328 | 3300047322 | Bacteria | 4690 |
| 145 | Ga0495675_0042270 | 3300047444 | Bacteria | 2903 |
| 146 | Ga0495673_0019753 | 3300047469 | Bacteria | 3371 |
| 147 | Ga0495686_0093511 | 3300047472 | Bacteria | 1823 |
| 148 | Ga0495686_0101457 | 3300047472 | Bacteria | 1735 |
| 149 | Ga0495602_0014951 | 3300048088 | Bacteria | 7851 |
| 150 | Ga0495602_0134866 | 3300048088 | Bacteria | 1963 |
| 151 | Ga0496100_0000274 | 3300048903 | Bacteria | 26128 |
| 152 | Ga0496100_0051632 | 3300048903 | Bacteria | 2670 |
| 153 | Ga0496101_0090074 | 3300048904 | Bacteria | 2281 |
| 154 | Ga0496102_0075244 | 3300048905 | Bacteria | 3104 |
| 155 | Ga0496103_0099494 | 3300048906 | Bacteria | 1840 |
| 156 | Ga0496104_0007795 | 3300048907 | Bacteria | 9490 |
| 157 | Ga0496105_0012683 | 3300048908 | Bacteria | 6675 |
| 158 | Ga0496105_0032593 | 3300048908 | Bacteria | 4278 |
| 159 | Ga0496105_0056155 | 3300048908 | Bacteria | 3250 |
| 160 | Ga0496106_0419493 | 3300048909 | Bacteria | 1075 |
| 161 | Ga0496110_0115116 | 3300048913 | Bacteria | 2420 |
| 162 | Ga0496110_0293391 | 3300048913 | Bacteria | 1481 |
| 163 | Ga0496113_0012492 | 3300048916 | Bacteria | 5709 |
| 164 | Ga0496113_0027970 | 3300048916 | Bacteria | 4049 |
| 165 | Ga0496114_0494198 | 3300048917 | Bacteria | 1082 |
| 166 | Ga0496115_0298967 | 3300048918 | Bacteria | 1319 |
| 167 | Ga0496116_0000810 | 3300048919 | Bacteria | 39564 |
| 168 | Ga0496116_0009812 | 3300048919 | Bacteria | 8114 |
| 169 | Ga0496116_0011617 | 3300048919 | Bacteria | 7266 |
| 170 | Ga0496116_0027566 | 3300048919 | Bacteria | 4135 |
| 171 | Ga0496116_0027586 | 3300048919 | Bacteria | 4133 |
| 172 | Ga0496116_0039648 | 3300048919 | Bacteria | 3254 |
| 173 | Ga0496116_0050073 | 3300048919 | Bacteria | 2786 |
| 174 | Ga0496117_0001702 | 3300048920 | Bacteria | 30477 |
| 175 | Ga0496118_0001874 | 3300048921 | Bacteria | 30042 |
| 176 | Ga0496118_0007702 | 3300048921 | Bacteria | 11323 |
| 177 | Ga0496118_0023229 | 3300048921 | Bacteria | 5392 |
| 178 | Ga0496118_0072059 | 3300048921 | Bacteria | 2484 |
| 179 | Ga0496119_0001423 | 3300048922 | Bacteria | 28946 |
| 180 | Ga0496119_0006335 | 3300048922 | Bacteria | 11012 |
| 181 | Ga0496119_0015908 | 3300048922 | Bacteria | 5759 |
| 182 | Ga0496119_0067562 | 3300048922 | Bacteria | 2108 |
| 183 | Ga0496120_0000931 | 3300048923 | Bacteria | 40425 |
| 184 | Ga0496120_0015141 | 3300048923 | Bacteria | 5101 |
| 185 | Ga0496121_0002373 | 3300048924 | Bacteria | 28961 |
| 186 | Ga0496121_0006136 | 3300048924 | Bacteria | 15088 |
| 187 | Ga0496121_0008253 | 3300048924 | Bacteria | 12325 |
| 188 | Ga0496121_0020584 | 3300048924 | Bacteria | 6516 |
| 189 | Ga0496121_0044703 | 3300048924 | Bacteria | 3815 |
| 190 | Ga0496121_0119582 | 3300048924 | Bacteria | 1992 |
| 191 | Ga0496121_0121833 | 3300048924 | Bacteria | 1968 |
| 192 | Ga0496121_0162798 | 3300048924 | Bacteria | 1629 |
| 193 | Ga0496122_0001469 | 3300048925 | Bacteria | 37960 |
| 194 | Ga0496122_0004098 | 3300048925 | Bacteria | 18463 |
| 195 | Ga0496122_0006012 | 3300048925 | Bacteria | 14165 |
| 196 | Ga0496122_0031750 | 3300048925 | Bacteria | 4385 |
| 197 | Ga0496122_0180263 | 3300048925 | Bacteria | 1261 |
| 198 | Ga0496123_0000971 | 3300048926 | Bacteria | 44294 |
| 199 | Ga0496123_0017925 | 3300048926 | Bacteria | 5668 |
| 200 | Ga0496124_0001705 | 3300048927 | Bacteria | 31058 |
| 201 | Ga0496124_0002917 | 3300048927 | Bacteria | 21559 |
| 202 | Ga0496124_0007627 | 3300048927 | Bacteria | 11459 |
| 203 | Ga0496124_0021735 | 3300048927 | Bacteria | 5905 |
| 204 | Ga0496125_0001896 | 3300048928 | Bacteria | 28683 |
| 205 | Ga0496125_0052622 | 3300048928 | Bacteria | 3347 |
| 206 | Ga0496126_0002126 | 3300048929 | Bacteria | 27665 |
| 207 | Ga0496126_0004627 | 3300048929 | Bacteria | 16301 |
| 208 | Ga0496126_0010488 | 3300048929 | Bacteria | 9706 |
| 209 | Ga0496126_0021005 | 3300048929 | Bacteria | 6389 |
| 210 | Ga0496126_0206853 | 3300048929 | Bacteria | 1654 |
| 211 | Ga0496126_0290857 | 3300048929 | Bacteria | 1351 |
| 212 | Ga0501083_0238203 | 3300049744 | Bacteria | 1185 |
| 213 | nmdc:mga0yw44_74982_c1 | 3300050492 | Bacteria | 2108 |
| 214 | Ga0500583_0102486 | 3300053092 | Bacteria | 1403 |
| 215 | Ga0500566_0000378 | 3300053094 | Bacteria | 24521 |
| 216 | Ga0500641_0026803 | 3300053096 | Bacteria | 2240 |
| 217 | Ga0500555_012944 | 3300053103 | Bacteria | 2403 |
| 218 | Ga0500556_0024063 | 3300053104 | Bacteria | 1996 |
| 219 | Ga0500562_004073 | 3300053108 | Bacteria | 3684 |
| 220 | Ga0500595_013707 | 3300053119 | Bacteria | 3100 |
| 221 | Ga0500595_022092 | 3300053119 | Bacteria | 2259 |
| 222 | Ga0500595_040658 | 3300053119 | Bacteria | 1498 |
| 223 | Ga0500614_007088 | 3300053123 | Bacteria | 2358 |
| 224 | Ga0500559_0017937 | 3300053136 | Bacteria | 2991 |
| 225 | Ga0500564_122795 | 3300053138 | Bacteria | 1130 |
| 226 | Ga0500568_0045348 | 3300053139 | Bacteria | 1750 |
| 227 | Ga0500568_0051814 | 3300053139 | Bacteria | 1613 |
| 228 | Ga0500577_0041747 | 3300053142 | Bacteria | 1675 |
| 229 | Ga0500604_0072344 | 3300053151 | Bacteria | 1101 |
| 230 | Ga0500616_0026790 | 3300053153 | Bacteria | 3187 |
| 231 | Ga0500619_010690 | 3300053154 | Bacteria | 2332 |
| 232 | Ga0500622_0000104 | 3300053156 | Bacteria | 85867 |
| 233 | Ga0500622_0110752 | 3300053156 | Bacteria | 1341 |
| 234 | Ga0500627_0051278 | 3300053158 | Bacteria | 1799 |
| 235 | Ga0500638_039292 | 3300053162 | Bacteria | 2297 |
| 236 | Ga0500601_000523 | 3300053737 | Bacteria | 5788 |
| 237 | Ga0500661_013875 | 3300055283 | Bacteria | 1451 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300011119 | Ga0105246_10436886 | Ga0105246_104368862 | 249 |
| 2 | 3300026075 | Ga0207708_10289320 | Ga0207708_102893202 | 256 |
| 3 | 3300048906 | Ga0496103_0099494 | Ga0496103_0099494_26_799 | 256 |
| 4 | 3300005439 | Ga0070711_100009465 | Ga0070711_1000094654 | 258 |
| 5 | 3300025916 | Ga0207663_10002917 | Ga0207663_100029175 | 258 |
| 6 | 3300049744 | Ga0501083_0238203 | Ga0501083_0238203_306_1142 | 259 |
| 7 | 3300005457 | Ga0070662_100447930 | Ga0070662_1004479301 | 261 |
| 8 | 3300035113 | Ga0373936_0072504 | Ga0373936_0072504_151_993 | 262 |
| 9 | 3300039450 | Ga0436363_0291218 | Ga0436363_0291218_4941_5777 | 263 |
| 10 | iso_pu_bacteria | 2849076700 | 2849081896 | 273 |
| 11 | 3300013105 | Ga0157369_10016648 | Ga0157369_100166486 | 276 |
| 12 | 3300031507 | Ga0307509_10157905 | Ga0307509_101579054 | 277 |
| 13 | 3300048925 | Ga0496122_0004098 | Ga0496122_0004098_17311_18147 | 277 |
| 14 | 3300046529 | Ga0495652_0263812 | Ga0495652_0263812_374_1255 | 278 |
| 15 | 3300053104 | Ga0500556_0024063 | Ga0500556_0024063_209_1090 | 278 |
| 16 | 3300048921 | Ga0496118_0023229 | Ga0496118_0023229_4383_5309 | 286 |
| 17 | iso_pu_bacteria | 2874645413 | 2874648893 | 288 |
| 18 | 3300009553 | Ga0105249_10726207 | Ga0105249_107262072 | 289 |
| 19 | 3300053123 | Ga0500614_007088 | Ga0500614_007088_150_1064 | 289 |
| 20 | 3300053138 | Ga0500564_122795 | Ga0500564_122795_125_1039 | 289 |
| 21 | 3300005340 | Ga0070689_100035397 | Ga0070689_1000353974 | 298 |
| 22 | 3300005445 | Ga0070708_100098967 | Ga0070708_1000989675 | 298 |
| 23 | 3300005536 | Ga0070697_100141927 | Ga0070697_1001419271 | 298 |
| 24 | 3300025273 | Ga0209673_1034712 | Ga0209673_10347121 | 298 |
| 25 | 3300025936 | Ga0207670_10015478 | Ga0207670_100154784 | 298 |
| 26 | 3300005467 | Ga0070706_100219095 | Ga0070706_1002190952 | 299 |
| 27 | 3300005468 | Ga0070707_100060328 | Ga0070707_1000603285 | 299 |
| 28 | 3300005471 | Ga0070698_100183670 | Ga0070698_1001836703 | 299 |
| 29 | 3300005518 | Ga0070699_100104071 | Ga0070699_1001040713 | 299 |
| 30 | 3300007265 | Ga0099794_10134168 | Ga0099794_101341681 | 299 |
| 31 | 3300025939 | Ga0207665_10051098 | Ga0207665_100510984 | 299 |
| 32 | 3300046477 | Ga0495664_0214151 | Ga0495664_0214151_121_1068 | 300 |
| 33 | 3300046529 | Ga0495652_0237366 | Ga0495652_0237366_173_1120 | 300 |
| 34 | 3300047472 | Ga0495686_0101457 | Ga0495686_0101457_343_1290 | 300 |
| 35 | 3300048929 | Ga0496126_0290857 | Ga0496126_0290857_132_1079 | 300 |
| 36 | 3300053119 | Ga0500595_040658 | Ga0500595_040658_183_1130 | 300 |
| 37 | 3300013306 | Ga0163162_10345502 | Ga0163162_103455022 | 301 |
| 38 | 3300053119 | Ga0500595_013707 | Ga0500595_013707_1495_2460 | 301 |
| 39 | 3300003354 | JGI25160J50197_1005015 | JGI25160J50197_10050157 | 302 |
| 40 | 3300005262 | Ga0065165_1002335 | Ga0065165_100233512 | 302 |
| 41 | 3300005338 | Ga0068868_100157350 | Ga0068868_1001573502 | 302 |
| 42 | 3300005455 | Ga0070663_100025243 | Ga0070663_1000252432 | 302 |
| 43 | 3300005616 | Ga0068852_100172739 | Ga0068852_1001727392 | 302 |
| 44 | 3300009101 | Ga0105247_10074368 | Ga0105247_100743682 | 302 |
| 45 | 3300010375 | Ga0105239_10078725 | Ga0105239_100787253 | 302 |
| 46 | 3300013306 | Ga0163162_10113407 | Ga0163162_101134073 | 302 |
| 47 | 3300013308 | Ga0157375_10038494 | Ga0157375_100384944 | 302 |
| 48 | 3300014325 | Ga0163163_10131011 | Ga0163163_101310114 | 302 |
| 49 | 3300025302 | Ga0207426_1000354 | Ga0207426_100035417 | 302 |
| 50 | 3300025900 | Ga0207710_10012394 | Ga0207710_100123943 | 302 |
| 51 | 3300025910 | Ga0207684_10035008 | Ga0207684_100350082 | 302 |
| 52 | 3300025933 | Ga0207706_10214131 | Ga0207706_102141312 | 302 |
| 53 | 3300026023 | Ga0207677_10185406 | Ga0207677_101854061 | 302 |
| 54 | 3300026067 | Ga0207678_10021956 | Ga0207678_100219563 | 302 |
| 55 | 3300026142 | Ga0207698_10148141 | Ga0207698_101481412 | 302 |
| 56 | 3300028380 | Ga0268265_10483820 | Ga0268265_104838201 | 302 |
| 57 | 3300046492 | Ga0495585_0197268 | Ga0495585_0197268_11_982 | 302 |
| 58 | 3300046557 | Ga0495622_0019678 | Ga0495622_0019678_1287_2258 | 302 |
| 59 | 3300046557 | Ga0495622_0148642 | Ga0495622_0148642_81_1046 | 302 |
| 60 | 3300046674 | Ga0495588_0005368 | Ga0495588_0005368_967_1938 | 302 |
| 61 | 3300047321 | Ga0495676_0091192 | Ga0495676_0091192_118_1089 | 302 |
| 62 | 3300048903 | Ga0496100_0051632 | Ga0496100_0051632_608_1579 | 302 |
| 63 | 3300048904 | Ga0496101_0090074 | Ga0496101_0090074_244_1215 | 302 |
| 64 | 3300048908 | Ga0496105_0056155 | Ga0496105_0056155_1382_2353 | 302 |
| 65 | 3300048909 | Ga0496106_0419493 | Ga0496106_0419493_62_1033 | 302 |
| 66 | 3300048913 | Ga0496110_0115116 | Ga0496110_0115116_445_1416 | 302 |
| 67 | 3300048919 | Ga0496116_0027566 | Ga0496116_0027566_1247_2218 | 302 |
| 68 | 3300048921 | Ga0496118_0072059 | Ga0496118_0072059_1223_2194 | 302 |
| 69 | 3300048922 | Ga0496119_0067562 | Ga0496119_0067562_40_1011 | 302 |
| 70 | 3300048924 | Ga0496121_0044703 | Ga0496121_0044703_1993_2964 | 302 |
| 71 | 3300003354 | JGI25160J50197_1005480 | JGI25160J50197_10054803 | 303 |
| 72 | 3300005262 | Ga0065165_1018992 | Ga0065165_10189921 | 303 |
| 73 | 3300021441 | Ga0213871_10003523 | Ga0213871_100035234 | 303 |
| 74 | 3300037471 | Ga0395905_0050446 | Ga0395905_0050446_1256_2224 | 303 |
| 75 | 3300039438 | Ga0436360_0222245 | Ga0436360_0222245_3582_4553 | 303 |
| 76 | 3300046512 | Ga0495610_0004246 | Ga0495610_0004246_4922_5893 | 303 |
| 77 | 3300053139 | Ga0500568_0045348 | Ga0500568_0045348_91_1062 | 303 |
| 78 | 3300003752 | Ga0055539_1003689 | Ga0055539_10036892 | 304 |
| 79 | 3300005548 | Ga0070665_100073397 | Ga0070665_1000733972 | 304 |
| 80 | 3300025230 | Ga0209563_102897 | Ga0209563_1028973 | 304 |
| 81 | 3300048929 | Ga0496126_0206853 | Ga0496126_0206853_117_1085 | 304 |
| 82 | 3300013306 | Ga0163162_10682561 | Ga0163162_106825611 | 305 |
| 83 | 3300021377 | Ga0213874_10009839 | Ga0213874_100098392 | 305 |
| 84 | 3300021384 | Ga0213876_10054247 | Ga0213876_100542472 | 305 |
| 85 | 3300025297 | Ga0209758_1011849 | Ga0209758_10118495 | 305 |
| 86 | 3300037853 | Ga0436364_0413544 | Ga0436364_0413544_562_1533 | 305 |
| 87 | 3300039450 | Ga0436363_0448408 | Ga0436363_0448408_446_1417 | 305 |
| 88 | 3300046462 | Ga0495651_0217851 | Ga0495651_0217851_170_1141 | 305 |
| 89 | 3300046529 | Ga0495652_0029484 | Ga0495652_0029484_1290_2261 | 305 |
| 90 | 3300046533 | Ga0495640_0041523 | Ga0495640_0041523_1163_2134 | 305 |
| 91 | 3300046642 | Ga0495634_0207804 | Ga0495634_0207804_24_995 | 305 |
| 92 | 3300046675 | Ga0495657_0033529 | Ga0495657_0033529_1513_2484 | 305 |
| 93 | 3300046680 | Ga0495646_0135210 | Ga0495646_0135210_189_1160 | 305 |
| 94 | 3300046694 | Ga0495649_0021576 | Ga0495649_0021576_1558_2529 | 305 |
| 95 | 3300047317 | Ga0495604_0009181 | Ga0495604_0009181_3290_4261 | 305 |
| 96 | 3300047321 | Ga0495676_0076320 | Ga0495676_0076320_1199_2170 | 305 |
| 97 | 3300047469 | Ga0495673_0019753 | Ga0495673_0019753_1642_2610 | 305 |
| 98 | 3300048088 | Ga0495602_0134866 | Ga0495602_0134866_567_1538 | 305 |
| 99 | 3300048907 | Ga0496104_0007795 | Ga0496104_0007795_4591_5562 | 305 |
| 100 | 3300048908 | Ga0496105_0032593 | Ga0496105_0032593_1637_2608 | 305 |
| 101 | 3300048916 | Ga0496113_0027970 | Ga0496113_0027970_2874_3845 | 305 |
| 102 | 3300048917 | Ga0496114_0494198 | Ga0496114_0494198_101_1072 | 305 |
| 103 | 3300048918 | Ga0496115_0298967 | Ga0496115_0298967_172_1143 | 305 |
| 104 | 3300048922 | Ga0496119_0015908 | Ga0496119_0015908_3679_4650 | 305 |
| 105 | 3300048923 | Ga0496120_0015141 | Ga0496120_0015141_2822_3793 | 305 |
| 106 | 3300048928 | Ga0496125_0052622 | Ga0496125_0052622_2267_3238 | 305 |
| 107 | 3300048929 | Ga0496126_0021005 | Ga0496126_0021005_4157_5128 | 305 |
| 108 | 3300053094 | Ga0500566_0000378 | Ga0500566_0000378_518_1489 | 305 |
| 109 | 3300053162 | Ga0500638_039292 | Ga0500638_039292_36_1007 | 305 |
| 110 | 3300006038 | Ga0075365_10078845 | Ga0075365_100788452 | 306 |
| 111 | 3300041452 | Ga0451793_0371502 | Ga0451793_0371502_251_1219 | 306 |
| 112 | 3300046454 | Ga0495592_0019818 | Ga0495592_0019818_2568_3578 | 306 |
| 113 | 3300046460 | Ga0495638_0004161 | Ga0495638_0004161_4242_5213 | 306 |
| 114 | 3300046462 | Ga0495651_0044298 | Ga0495651_0044298_473_1483 | 306 |
| 115 | 3300046463 | Ga0495653_0164224 | Ga0495653_0164224_462_1433 | 306 |
| 116 | 3300046474 | Ga0495605_0038581 | Ga0495605_0038581_453_1424 | 306 |
| 117 | 3300046477 | Ga0495664_0035019 | Ga0495664_0035019_325_1335 | 306 |
| 118 | 3300046511 | Ga0495608_0003835 | Ga0495608_0003835_5161_6171 | 306 |
| 119 | 3300046516 | Ga0495628_0072061 | Ga0495628_0072061_1598_2608 | 306 |
| 120 | 3300046529 | Ga0495652_0015106 | Ga0495652_0015106_2680_3690 | 306 |
| 121 | 3300046533 | Ga0495640_0035251 | Ga0495640_0035251_703_1713 | 306 |
| 122 | 3300046536 | Ga0495587_0045361 | Ga0495587_0045361_1237_2247 | 306 |
| 123 | 3300046559 | Ga0495667_0003327 | Ga0495667_0003327_3612_4622 | 306 |
| 124 | 3300046642 | Ga0495634_0040362 | Ga0495634_0040362_1938_2948 | 306 |
| 125 | 3300046663 | Ga0495635_0042909 | Ga0495635_0042909_2097_3107 | 306 |
| 126 | 3300046665 | Ga0495661_0102853 | Ga0495661_0102853_396_1367 | 306 |
| 127 | 3300046678 | Ga0495599_0040860 | Ga0495599_0040860_230_1240 | 306 |
| 128 | 3300046679 | Ga0495623_0006484 | Ga0495623_0006484_1165_2175 | 306 |
| 129 | 3300046689 | Ga0495613_0098755 | Ga0495613_0098755_781_1791 | 306 |
| 130 | 3300046809 | Ga0495600_0063666 | Ga0495600_0063666_924_1934 | 306 |
| 131 | 3300047317 | Ga0495604_0003922 | Ga0495604_0003922_1379_2389 | 306 |
| 132 | 3300047319 | Ga0495674_0010755 | Ga0495674_0010755_1338_2348 | 306 |
| 133 | 3300047322 | Ga0495680_0027328 | Ga0495680_0027328_2687_3697 | 306 |
| 134 | 3300047444 | Ga0495675_0042270 | Ga0495675_0042270_463_1473 | 306 |
| 135 | 3300048088 | Ga0495602_0014951 | Ga0495602_0014951_5801_6811 | 306 |
| 136 | 3300048924 | Ga0496121_0121833 | Ga0496121_0121833_670_1641 | 306 |
| 137 | 3300048929 | Ga0496126_0010488 | Ga0496126_0010488_8181_9152 | 306 |
| 138 | 3300050492 | nmdc:mga0yw44_74982_c1 | nmdc:mga0yw44_74982_c1_808_1776 | 306 |
| 139 | 3300053092 | Ga0500583_0102486 | Ga0500583_0102486_289_1260 | 306 |
| 140 | 3300053096 | Ga0500641_0026803 | Ga0500641_0026803_336_1307 | 306 |
| 141 | 3300053103 | Ga0500555_012944 | Ga0500555_012944_1088_2059 | 306 |
| 142 | 3300053108 | Ga0500562_004073 | Ga0500562_004073_837_1808 | 306 |
| 143 | 3300053119 | Ga0500595_022092 | Ga0500595_022092_257_1225 | 306 |
| 144 | 3300053136 | Ga0500559_0017937 | Ga0500559_0017937_60_1028 | 306 |
| 145 | 3300053139 | Ga0500568_0051814 | Ga0500568_0051814_249_1220 | 306 |
| 146 | 3300053142 | Ga0500577_0041747 | Ga0500577_0041747_394_1365 | 306 |
| 147 | 3300053151 | Ga0500604_0072344 | Ga0500604_0072344_33_1004 | 306 |
| 148 | 3300053153 | Ga0500616_0026790 | Ga0500616_0026790_2098_3069 | 306 |
| 149 | 3300053154 | Ga0500619_010690 | Ga0500619_010690_46_1014 | 306 |
| 150 | 3300053156 | Ga0500622_0110752 | Ga0500622_0110752_73_1044 | 306 |
| 151 | 3300053158 | Ga0500627_0051278 | Ga0500627_0051278_614_1585 | 306 |
| 152 | 3300053737 | Ga0500601_000523 | Ga0500601_000523_1270_2241 | 306 |
| 153 | 3300055283 | Ga0500661_013875 | Ga0500661_013875_357_1328 | 306 |
| 154 | 3300003790 | Ga0055528_1000039 | Ga0055528_1000039102 | 307 |
| 155 | 3300005455 | Ga0070663_100061744 | Ga0070663_1000617443 | 307 |
| 156 | 3300005614 | Ga0068856_100522848 | Ga0068856_1005228481 | 307 |
| 157 | 3300025273 | Ga0209673_1000161 | Ga0209673_1000161123 | 307 |
| 158 | 3300025981 | Ga0207640_10042144 | Ga0207640_100421441 | 307 |
| 159 | 3300026067 | Ga0207678_10092069 | Ga0207678_100920691 | 307 |
| 160 | 3300026078 | Ga0207702_10387049 | Ga0207702_103870491 | 307 |
| 161 | 3300046507 | Ga0495606_0107362 | Ga0495606_0107362_656_1627 | 307 |
| 162 | 3300046519 | Ga0495632_0004024 | Ga0495632_0004024_5372_6352 | 307 |
| 163 | 3300048924 | Ga0496121_0162798 | Ga0496121_0162798_87_1058 | 307 |
| 164 | 3300048924 | Ga0496121_0006136 | Ga0496121_0006136_10788_11756 | 308 |
| 165 | 3300006163 | Ga0070715_10060466 | Ga0070715_100604662 | 309 |
| 166 | 3300003775 | Ga0055524_1009924 | Ga0055524_10099241 | 310 |
| 167 | 3300003790 | Ga0055528_1002356 | Ga0055528_10023567 | 310 |
| 168 | 3300025273 | Ga0209673_1000132 | Ga0209673_100013211 | 310 |
| 169 | 3300025295 | Ga0209564_1001841 | Ga0209564_10018418 | 310 |
| 170 | 3300025299 | Ga0209256_1000479 | Ga0209256_100047911 | 310 |
| 171 | 3300039437 | Ga0436365_0025836 | Ga0436365_0025836_1447_2418 | 310 |
| 172 | 3300048919 | Ga0496116_0039648 | Ga0496116_0039648_546_1526 | 310 |
| 173 | 3300048925 | Ga0496122_0031750 | Ga0496122_0031750_201_1181 | 310 |
| 174 | iso_pu_bacteria | 3005445848 | 3005452478 | 312 |
| 175 | 3300028786 | Ga0307517_10000008 | Ga0307517_1000000885 | 313 |
| 176 | 3300037853 | Ga0436364_0053036 | Ga0436364_0053036_1204_2175 | 314 |
| 177 | 3300033180 | Ga0307510_10035866 | Ga0307510_100358665 | 316 |
| 178 | iso_pu_bacteria | 2513237146 | 2513925988 | 316 |
| 179 | iso_pu_bacteria | 2599185170 | 2599417466 | 316 |
| 180 | iso_pu_bacteria | 2838035591 | 2838038326 | 316 |
| 181 | iso_pu_bacteria | 2515154113 | 2515636535 | 318 |
| 182 | iso_pu_bacteria | 2515154114 | 2515642319 | 318 |
| 183 | iso_pu_bacteria | 2582581308 | 2585283406 | 318 |
| 184 | iso_pu_bacteria | 2585427527 | 2585537127 | 318 |
| 185 | iso_pu_bacteria | 2738541293 | 2738801595 | 318 |
| 186 | iso_pu_bacteria | 2821123053 | 2821129958 | 318 |
| 187 | iso_pu_bacteria | 2821443989 | 2821445480 | 318 |
| 188 | iso_pu_bacteria | 2842110456 | 2842114473 | 318 |
| 189 | iso_pu_bacteria | 2844533157 | 2844536139 | 318 |
| 190 | iso_pu_bacteria | 2852387548 | 2852393541 | 318 |
| 191 | iso_pu_bacteria | 2933586486 | 2933590671 | 318 |
| 192 | iso_pu_bacteria | 2977942078 | 2977947340 | 318 |
| 193 | iso_pu_bacteria | 3005445848 | 3005447863 | 318 |
| 194 | iso_pu_bacteria | 8005542996 | 8005549568 | 318 |
| 195 | iso_pu_bacteria | 8024486573 | 8024490479 | 318 |
| 196 | iso_pu_bacteria | 2643221643 | 2644237382 | 320 |
| 197 | 3300021388 | Ga0213875_10022131 | Ga0213875_100221312 | 321 |
| 198 | 3300025295 | Ga0209564_1031985 | Ga0209564_10319852 | 321 |
| 199 | 3300031731 | Ga0307405_10003912 | Ga0307405_100039125 | 321 |
| 200 | 3300046519 | Ga0495632_0000703 | Ga0495632_0000703_24833_25804 | 321 |
| 201 | 3300048919 | Ga0496116_0009812 | Ga0496116_0009812_2106_3077 | 321 |
| 202 | 3300048919 | Ga0496116_0011617 | Ga0496116_0011617_1873_2844 | 321 |
| 203 | 3300048919 | Ga0496116_0027586 | Ga0496116_0027586_391_1362 | 321 |
| 204 | 3300048921 | Ga0496118_0007702 | Ga0496118_0007702_7084_8052 | 321 |
| 205 | 3300048924 | Ga0496121_0008253 | Ga0496121_0008253_6958_7929 | 321 |
| 206 | 3300048924 | Ga0496121_0119582 | Ga0496121_0119582_968_1978 | 321 |
| 207 | 3300048925 | Ga0496122_0006012 | Ga0496122_0006012_9510_10481 | 321 |
| 208 | 3300048926 | Ga0496123_0017925 | Ga0496123_0017925_1588_2559 | 321 |
| 209 | 3300048927 | Ga0496124_0002917 | Ga0496124_0002917_19159_20130 | 321 |
| 210 | 3300048927 | Ga0496124_0007627 | Ga0496124_0007627_10065_11036 | 321 |
| 211 | 3300002773 | JGI25152J39213_1006787 | JGI25152J39213_10067874 | 322 |
| 212 | 3300003214 | JGI25165J46597_1001928 | JGI25165J46597_10019284 | 322 |
| 213 | 3300003323 | rootH1_10088588 | rootH1_100885882 | 322 |
| 214 | 3300003790 | Ga0055528_1007327 | Ga0055528_10073277 | 322 |
| 215 | 3300005563 | Ga0068855_100180321 | Ga0068855_1001803212 | 322 |
| 216 | 3300009093 | Ga0105240_10000255 | Ga0105240_1000025528 | 322 |
| 217 | 3300009177 | Ga0105248_10144529 | Ga0105248_101445292 | 322 |
| 218 | 3300009545 | Ga0105237_10001144 | Ga0105237_1000114424 | 322 |
| 219 | 3300010375 | Ga0105239_10000932 | Ga0105239_1000093216 | 322 |
| 220 | 3300015265 | Ga0182005_1004760 | Ga0182005_10047602 | 322 |
| 221 | 3300025253 | Ga0209677_100272 | Ga0209677_10027210 | 322 |
| 222 | 3300025258 | Ga0209129_1000237 | Ga0209129_100023730 | 322 |
| 223 | 3300025261 | Ga0209233_1000282 | Ga0209233_100028247 | 322 |
| 224 | 3300025273 | Ga0209673_1000554 | Ga0209673_100055446 | 322 |
| 225 | 3300025294 | Ga0209025_1006818 | Ga0209025_10068183 | 322 |
| 226 | 3300025295 | Ga0209564_1004757 | Ga0209564_10047571 | 322 |
| 227 | 3300025299 | Ga0209256_1000292 | Ga0209256_100029264 | 322 |
| 228 | 3300025913 | Ga0207695_10000352 | Ga0207695_1000035274 | 322 |
| 229 | 3300025914 | Ga0207671_10000534 | Ga0207671_1000053420 | 322 |
| 230 | 3300025949 | Ga0207667_10263912 | Ga0207667_102639122 | 322 |
| 231 | 3300041498 | Ga0451841_0221433 | Ga0451841_0221433_1224_2204 | 322 |
| 232 | 3300041507 | Ga0451851_0421712 | Ga0451851_0421712_17113_18081 | 322 |
| 233 | 3300041511 | Ga0451855_0942538 | Ga0451855_0942538_854_1870 | 322 |
| 234 | 3300041512 | Ga0451853_0844562 | Ga0451853_0844562_742_1722 | 322 |
| 235 | 3300046512 | Ga0495610_0047338 | Ga0495610_0047338_441_1409 | 322 |
| 236 | 3300047472 | Ga0495686_0093511 | Ga0495686_0093511_187_1170 | 322 |
| 237 | 3300048903 | Ga0496100_0000274 | Ga0496100_0000274_22860_23840 | 322 |
| 238 | 3300048905 | Ga0496102_0075244 | Ga0496102_0075244_1707_2687 | 322 |
| 239 | 3300048908 | Ga0496105_0012683 | Ga0496105_0012683_96_1076 | 322 |
| 240 | 3300048913 | Ga0496110_0293391 | Ga0496110_0293391_429_1409 | 322 |
| 241 | 3300048916 | Ga0496113_0012492 | Ga0496113_0012492_4618_5598 | 322 |
| 242 | 3300048919 | Ga0496116_0000810 | Ga0496116_0000810_17642_18622 | 322 |
| 243 | 3300048919 | Ga0496116_0050073 | Ga0496116_0050073_383_1363 | 322 |
| 244 | 3300048920 | Ga0496117_0001702 | Ga0496117_0001702_12842_13822 | 322 |
| 245 | 3300048921 | Ga0496118_0001874 | Ga0496118_0001874_12842_13822 | 322 |
| 246 | 3300048922 | Ga0496119_0001423 | Ga0496119_0001423_16099_17079 | 322 |
| 247 | 3300048922 | Ga0496119_0006335 | Ga0496119_0006335_8378_9358 | 322 |
| 248 | 3300048923 | Ga0496120_0000931 | Ga0496120_0000931_22790_23770 | 322 |
| 249 | 3300048924 | Ga0496121_0002373 | Ga0496121_0002373_16651_17631 | 322 |
| 250 | 3300048924 | Ga0496121_0020584 | Ga0496121_0020584_3132_4103 | 322 |
| 251 | 3300048925 | Ga0496122_0001469 | Ga0496122_0001469_18338_19318 | 322 |
| 252 | 3300048925 | Ga0496122_0180263 | Ga0496122_0180263_167_1147 | 322 |
| 253 | 3300048926 | Ga0496123_0000971 | Ga0496123_0000971_25358_26338 | 322 |
| 254 | 3300048927 | Ga0496124_0001705 | Ga0496124_0001705_12437_13417 | 322 |
| 255 | 3300048927 | Ga0496124_0021735 | Ga0496124_0021735_3428_4408 | 322 |
| 256 | 3300048928 | Ga0496125_0001896 | Ga0496125_0001896_3204_4184 | 322 |
| 257 | 3300048929 | Ga0496126_0002126 | Ga0496126_0002126_17762_18742 | 322 |
| 258 | 3300048929 | Ga0496126_0004627 | Ga0496126_0004627_10411_11391 | 322 |
| 259 | 3300053156 | Ga0500622_0000104 | Ga0500622_0000104_62423_63391 | 322 |
| 260 | iso_pu_bacteria | 2534681796 | 2535518680 | 322 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2znb-assembly1.cif.gz_A | metallo-beta-lactamase (cadmium-bound form) | 0.8707 | 52 | 272 |
| 3znb-assembly1.cif.gz_A | metallo-beta-lactamase (zn, hg-bound form) | 0.8418 | 51 | 272 |
| 3kns-assembly4.cif.gz_D | bacillus cereus metallo-beta-lactamase cys221asp mutant, 20 mm zn(ii) | 0.8405 | 55 | 271 |
| 1bmc-assembly1.cif.gz_A | structure of a zinc metallo-beta-lactamase from bacillus cereus | 0.8394 | 55 | 271 |
| 1kr3-assembly2.cif.gz_B | crystal structure of the metallo beta-lactamase from bacteroides fragilis (cfia) in complex with the tricyclic inhibitor sb-236050. | 0.8315 | 54 | 272 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A0R0HZQ1_3_96_3.60.15.10 | Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like | 0.8534 | 171 | 260 | 3.60.15.10 |
| af_Q682P6_229_394_3.60.15.10 | Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like | 0.8502 | 84 | 260 | 3.60.15.10 |
| 1m2xC00 | Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like | 0.8236 | 54 | 272 | 3.60.15.10 |
| af_O86346_330_578_3.60.15.10 | Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like | 0.8229 | 57 | 276 | 3.60.15.10 |
| 5lscA00 | Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like | 0.8087 | 54 | 272 | 3.60.15.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A090KNM1-F1-model_v4 | Uncultured bacterium genome assembly Metasoil_fosmids_resub | 0.9895 | 39 | 322 |
GO:0016787
GO:0017001 GO:0042597 GO:0046677 GO:0046872 |
| AF-A0A4Q6BDX4-F1-model_v4 | MBL fold metallo-hydrolase | 0.9882 | 60 | 322 |
GO:0016787
GO:0017001 GO:0042597 GO:0046677 GO:0046872 |
| AF-A0A2A5FWV3-F1-model_v4 | Metallo-beta-lactamase domain-containing protein | 0.9874 | 176 | 322 |
|
| AF-A0A4Q6BDX4-F1-model_v4 | MBL fold metallo-hydrolase | 0.9844 | 60 | 322 |
GO:0016787
GO:0017001 GO:0042597 GO:0046677 GO:0046872 |
| AF-A0A7W5KRH6-F1-model_v4 | deleted | 0.9843 | 171 | 322 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar