F369741

General Info

Members Datasets Scaffolds Average Seq Length
260 185 237 310

Family's Representative Sequence

Representative Sequence 3300041511|Ga0451855_0942538|Ga0451855_0942538_854_1870
Length 338
Sequence VVAPFHRNWHDVMEPEMNKHDYALSRRGFCLCCLGGATFATTGGWLTPAEVFAAAKSLVVQIREAAAAADITTTKLRGGISALSGSGGNMGVLVGEDGKLLVDAGITATRPRIEKALADLGPQPIKHLINSHWHFDHTDGNEWLNSEGAVIMAHPNSLKHLTVATRVEDWDFDFPASPKGALPTMLMKGDEEALKHNGQTVALKYYGPAHTDSDISVFFQEANVVHVADTFWNGVYPFIDYSTGGSIDGQIQAAEANVKMVDDQTIVIPGHGEIGNKKDLIAWRDMLVGIRENVAKLKKDGRSVEETIAAKPTAKWDPVFGNWAISPALFTRLAYEGV

Samples

Sample ID Description Type Environment
1 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
2 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
3 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
4 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
5 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
6 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
7 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
8 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
9 2738541293 Rhizobium sp. GV031 Isolate Unclassified
10 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
11 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
12 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
13 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
14 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
15 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
16 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
17 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
18 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
19 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
20 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
21 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
22 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
23 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
24 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
25 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
26 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
27 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
28 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
29 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
30 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
45 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
46 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
54 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
59 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
60 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
61 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
62 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
63 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
66 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
67 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
68 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
69 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
70 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
71 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
72 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
73 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
90 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
91 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
92 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
93 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
94 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
95 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
96 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
97 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
98 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
99 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
100 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
101 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
102 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
103 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
104 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
105 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
106 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
107 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
108 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
109 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
110 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
111 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
112 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
113 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
114 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
115 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
116 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
117 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
118 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
119 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
120 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
121 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
122 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
123 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
124 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
125 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
126 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
127 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
128 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
129 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
130 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
131 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
132 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
133 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
134 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
135 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
136 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
137 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
138 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
139 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
140 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
141 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
142 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
143 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
144 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
145 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
146 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
147 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
148 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
149 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
150 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
151 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
152 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
153 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
154 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
155 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
156 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
157 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
158 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
159 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
160 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
161 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
162 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
163 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
164 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
165 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
166 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
167 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
168 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
169 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
170 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
171 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
172 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
173 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
174 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
175 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
176 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
177 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
178 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
179 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
180 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
181 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
182 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
183 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
184 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
185 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 91.15
Metatranscriptomes 0
Isolates 8.85

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.38
Nodule 4.62
Rhizoplane 6.54
Rhizosphere 41.54
Stem 0
Stem Tuber 0
Unclassified 26.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1006787 3300002773 Bacteria 3044
2 JGI25165J46597_1001928 3300003214 Bacteria 8228
3 rootH1_10088588 3300003323 Bacteria 2167
4 JGI25160J50197_1005015 3300003354 Bacteria 5601
5 JGI25160J50197_1005480 3300003354 Bacteria 5275
6 Ga0055539_1003689 3300003752 Bacteria 2100
7 Ga0055524_1009924 3300003775 Bacteria 3828
8 Ga0055528_1000039 3300003790 Bacteria 112899
9 Ga0055528_1002356 3300003790 Bacteria 10222
10 Ga0055528_1007327 3300003790 Bacteria 4895
11 Ga0065165_1002335 3300005262 Bacteria 16541
12 Ga0065165_1018992 3300005262 Bacteria 2469
13 Ga0068868_100157350 3300005338 Bacteria 1874
14 Ga0070689_100035397 3300005340 Bacteria 3816
15 Ga0070711_100009465 3300005439 Bacteria 6005
16 Ga0070708_100098967 3300005445 Unclassified 2667
17 Ga0070663_100025243 3300005455 Bacteria 4010
18 Ga0070663_100061744 3300005455 Bacteria 2699
19 Ga0070662_100447930 3300005457 Bacteria 1071
20 Ga0070706_100219095 3300005467 Unclassified 1776
21 Ga0070707_100060328 3300005468 Bacteria 3638
22 Ga0070698_100183670 3300005471 Bacteria 2029
23 Ga0070699_100104071 3300005518 Bacteria 2490
24 Ga0070697_100141927 3300005536 Unclassified 2020
25 Ga0070665_100073397 3300005548 Bacteria 3427
26 Ga0068855_100180321 3300005563 Bacteria 2388
27 Ga0068856_100522848 3300005614 Bacteria 1208
28 Ga0068852_100172739 3300005616 Bacteria 2027
29 Ga0075365_10078845 3300006038 Bacteria 2228
30 Ga0070715_10060466 3300006163 Bacteria 1661
31 Ga0099794_10134168 3300007265 Bacteria 1251
32 Ga0105240_10000255 3300009093 Bacteria 105565
33 Ga0105247_10074368 3300009101 Bacteria 2131
34 Ga0105248_10144529 3300009177 Bacteria 2684
35 Ga0105237_10001144 3300009545 Bacteria 35671
36 Ga0105249_10726207 3300009553 Bacteria 1055
37 Ga0105239_10000932 3300010375 Bacteria 41400
38 Ga0105239_10078725 3300010375 Bacteria 3627
39 Ga0105246_10436886 3300011119 Bacteria 1096
40 Ga0157369_10016648 3300013105 Bacteria 8266
41 Ga0163162_10113407 3300013306 Bacteria 2809
42 Ga0163162_10345502 3300013306 Bacteria 1620
43 Ga0163162_10682561 3300013306 Bacteria 1149
44 Ga0157375_10038494 3300013308 Bacteria 4592
45 Ga0163163_10131011 3300014325 Bacteria 2548
46 Ga0182005_1004760 3300015265 Bacteria 4330
47 Ga0213874_10009839 3300021377 Bacteria 2377
48 Ga0213876_10054247 3300021384 Bacteria 2116
49 Ga0213875_10022131 3300021388 Bacteria 3042
50 Ga0213871_10003523 3300021441 Bacteria 3028
51 Ga0209563_102897 3300025230 Bacteria 3714
52 Ga0209677_100272 3300025253 Bacteria 34642
53 Ga0209129_1000237 3300025258 Bacteria 60205
54 Ga0209233_1000282 3300025261 Bacteria 70340
55 Ga0209673_1000132 3300025273 Bacteria 162349
56 Ga0209673_1000161 3300025273 Bacteria 142073
57 Ga0209673_1000554 3300025273 Bacteria 60073
58 Ga0209673_1034712 3300025273 Bacteria 1519
59 Ga0209025_1006818 3300025294 Bacteria 8718
60 Ga0209564_1001841 3300025295 Bacteria 19383
61 Ga0209564_1004757 3300025295 Bacteria 8119
62 Ga0209564_1031985 3300025295 Bacteria 1594
63 Ga0209758_1011849 3300025297 Bacteria 4975
64 Ga0209256_1000292 3300025299 Bacteria 88135
65 Ga0209256_1000479 3300025299 Bacteria 59572
66 Ga0207426_1000354 3300025302 Bacteria 83734
67 Ga0207710_10012394 3300025900 Bacteria 3588
68 Ga0207684_10035008 3300025910 Bacteria 4265
69 Ga0207695_10000352 3300025913 Bacteria 105524
70 Ga0207671_10000534 3300025914 Bacteria 51293
71 Ga0207663_10002917 3300025916 Bacteria 8268
72 Ga0207706_10214131 3300025933 Bacteria 1688
73 Ga0207670_10015478 3300025936 Bacteria 4559
74 Ga0207665_10051098 3300025939 Bacteria 2781
75 Ga0207667_10263912 3300025949 Bacteria 1761
76 Ga0207640_10042144 3300025981 Bacteria 2909
77 Ga0207677_10185406 3300026023 Bacteria 1641
78 Ga0207678_10021956 3300026067 Bacteria 5595
79 Ga0207678_10092069 3300026067 Bacteria 2591
80 Ga0207708_10289320 3300026075 Bacteria 1330
81 Ga0207702_10387049 3300026078 Bacteria 1346
82 Ga0207698_10148141 3300026142 Bacteria 2033
83 Ga0268265_10483820 3300028380 Bacteria 1163
84 Ga0307517_10000008 3300028786 Bacteria 243202
85 Ga0307509_10157905 3300031507 Bacteria 2171
86 Ga0307405_10003912 3300031731 Bacteria 6955
87 Ga0307510_10035866 3300033180 Bacteria 5530
88 Ga0373936_0072504 3300035113 Bacteria 1422
89 Ga0395905_0050446 3300037471 Bacteria 3898
90 Ga0436364_0053036 3300037853 Bacteria 3247
91 Ga0436364_0413544 3300037853 Bacteria 2408
92 Ga0436365_0025836 3300039437 Bacteria 6124
93 Ga0436360_0222245 3300039438 Bacteria 5330
94 Ga0436363_0291218 3300039450 Bacteria 15657
95 Ga0436363_0448408 3300039450 Bacteria 2797
96 Ga0451793_0371502 3300041452 Bacteria 1431
97 Ga0451841_0221433 3300041498 Bacteria 2959
98 Ga0451851_0421712 3300041507 Bacteria 21588
99 Ga0451855_0942538 3300041511 Bacteria 10911
100 Ga0451853_0844562 3300041512 Bacteria 2073
101 Ga0495592_0019818 3300046454 Bacteria 5114
102 Ga0495638_0004161 3300046460 Bacteria 11032
103 Ga0495651_0044298 3300046462 Bacteria 3449
104 Ga0495651_0217851 3300046462 Bacteria 1323
105 Ga0495653_0164224 3300046463 Bacteria 1539
106 Ga0495605_0038581 3300046474 Bacteria 2396
107 Ga0495664_0035019 3300046477 Bacteria 2955
108 Ga0495664_0214151 3300046477 Bacteria 1167
109 Ga0495585_0197268 3300046492 Bacteria 1027
110 Ga0495606_0107362 3300046507 Bacteria 1689
111 Ga0495608_0003835 3300046511 Bacteria 10806
112 Ga0495610_0004246 3300046512 Bacteria 10671
113 Ga0495610_0047338 3300046512 Bacteria 2116
114 Ga0495628_0072061 3300046516 Bacteria 2692
115 Ga0495632_0000703 3300046519 Bacteria 30486
116 Ga0495632_0004024 3300046519 Bacteria 10159
117 Ga0495652_0015106 3300046529 Bacteria 6917
118 Ga0495652_0029484 3300046529 Bacteria 4820
119 Ga0495652_0237366 3300046529 Bacteria 1359
120 Ga0495652_0263812 3300046529 Bacteria 1270
121 Ga0495640_0035251 3300046533 Bacteria 3542
122 Ga0495640_0041523 3300046533 Bacteria 3214
123 Ga0495587_0045361 3300046536 Bacteria 2613
124 Ga0495622_0019678 3300046557 Bacteria 3143
125 Ga0495622_0148642 3300046557 Bacteria 1061
126 Ga0495667_0003327 3300046559 Bacteria 10762
127 Ga0495634_0040362 3300046642 Bacteria 3175
128 Ga0495634_0207804 3300046642 Bacteria 1213
129 Ga0495635_0042909 3300046663 Bacteria 3122
130 Ga0495661_0102853 3300046665 Bacteria 1605
131 Ga0495588_0005368 3300046674 Bacteria 5699
132 Ga0495657_0033529 3300046675 Bacteria 3574
133 Ga0495599_0040860 3300046678 Bacteria 2912
134 Ga0495623_0006484 3300046679 Bacteria 7617
135 Ga0495646_0135210 3300046680 Bacteria 1384
136 Ga0495613_0098755 3300046689 Bacteria 2110
137 Ga0495649_0021576 3300046694 Bacteria 3608
138 Ga0495600_0063666 3300046809 Bacteria 2410
139 Ga0495604_0003922 3300047317 Bacteria 11848
140 Ga0495604_0009181 3300047317 Bacteria 7826
141 Ga0495674_0010755 3300047319 Bacteria 8656
142 Ga0495676_0076320 3300047321 Bacteria 2559
143 Ga0495676_0091192 3300047321 Bacteria 2279
144 Ga0495680_0027328 3300047322 Bacteria 4690
145 Ga0495675_0042270 3300047444 Bacteria 2903
146 Ga0495673_0019753 3300047469 Bacteria 3371
147 Ga0495686_0093511 3300047472 Bacteria 1823
148 Ga0495686_0101457 3300047472 Bacteria 1735
149 Ga0495602_0014951 3300048088 Bacteria 7851
150 Ga0495602_0134866 3300048088 Bacteria 1963
151 Ga0496100_0000274 3300048903 Bacteria 26128
152 Ga0496100_0051632 3300048903 Bacteria 2670
153 Ga0496101_0090074 3300048904 Bacteria 2281
154 Ga0496102_0075244 3300048905 Bacteria 3104
155 Ga0496103_0099494 3300048906 Bacteria 1840
156 Ga0496104_0007795 3300048907 Bacteria 9490
157 Ga0496105_0012683 3300048908 Bacteria 6675
158 Ga0496105_0032593 3300048908 Bacteria 4278
159 Ga0496105_0056155 3300048908 Bacteria 3250
160 Ga0496106_0419493 3300048909 Bacteria 1075
161 Ga0496110_0115116 3300048913 Bacteria 2420
162 Ga0496110_0293391 3300048913 Bacteria 1481
163 Ga0496113_0012492 3300048916 Bacteria 5709
164 Ga0496113_0027970 3300048916 Bacteria 4049
165 Ga0496114_0494198 3300048917 Bacteria 1082
166 Ga0496115_0298967 3300048918 Bacteria 1319
167 Ga0496116_0000810 3300048919 Bacteria 39564
168 Ga0496116_0009812 3300048919 Bacteria 8114
169 Ga0496116_0011617 3300048919 Bacteria 7266
170 Ga0496116_0027566 3300048919 Bacteria 4135
171 Ga0496116_0027586 3300048919 Bacteria 4133
172 Ga0496116_0039648 3300048919 Bacteria 3254
173 Ga0496116_0050073 3300048919 Bacteria 2786
174 Ga0496117_0001702 3300048920 Bacteria 30477
175 Ga0496118_0001874 3300048921 Bacteria 30042
176 Ga0496118_0007702 3300048921 Bacteria 11323
177 Ga0496118_0023229 3300048921 Bacteria 5392
178 Ga0496118_0072059 3300048921 Bacteria 2484
179 Ga0496119_0001423 3300048922 Bacteria 28946
180 Ga0496119_0006335 3300048922 Bacteria 11012
181 Ga0496119_0015908 3300048922 Bacteria 5759
182 Ga0496119_0067562 3300048922 Bacteria 2108
183 Ga0496120_0000931 3300048923 Bacteria 40425
184 Ga0496120_0015141 3300048923 Bacteria 5101
185 Ga0496121_0002373 3300048924 Bacteria 28961
186 Ga0496121_0006136 3300048924 Bacteria 15088
187 Ga0496121_0008253 3300048924 Bacteria 12325
188 Ga0496121_0020584 3300048924 Bacteria 6516
189 Ga0496121_0044703 3300048924 Bacteria 3815
190 Ga0496121_0119582 3300048924 Bacteria 1992
191 Ga0496121_0121833 3300048924 Bacteria 1968
192 Ga0496121_0162798 3300048924 Bacteria 1629
193 Ga0496122_0001469 3300048925 Bacteria 37960
194 Ga0496122_0004098 3300048925 Bacteria 18463
195 Ga0496122_0006012 3300048925 Bacteria 14165
196 Ga0496122_0031750 3300048925 Bacteria 4385
197 Ga0496122_0180263 3300048925 Bacteria 1261
198 Ga0496123_0000971 3300048926 Bacteria 44294
199 Ga0496123_0017925 3300048926 Bacteria 5668
200 Ga0496124_0001705 3300048927 Bacteria 31058
201 Ga0496124_0002917 3300048927 Bacteria 21559
202 Ga0496124_0007627 3300048927 Bacteria 11459
203 Ga0496124_0021735 3300048927 Bacteria 5905
204 Ga0496125_0001896 3300048928 Bacteria 28683
205 Ga0496125_0052622 3300048928 Bacteria 3347
206 Ga0496126_0002126 3300048929 Bacteria 27665
207 Ga0496126_0004627 3300048929 Bacteria 16301
208 Ga0496126_0010488 3300048929 Bacteria 9706
209 Ga0496126_0021005 3300048929 Bacteria 6389
210 Ga0496126_0206853 3300048929 Bacteria 1654
211 Ga0496126_0290857 3300048929 Bacteria 1351
212 Ga0501083_0238203 3300049744 Bacteria 1185
213 nmdc:mga0yw44_74982_c1 3300050492 Bacteria 2108
214 Ga0500583_0102486 3300053092 Bacteria 1403
215 Ga0500566_0000378 3300053094 Bacteria 24521
216 Ga0500641_0026803 3300053096 Bacteria 2240
217 Ga0500555_012944 3300053103 Bacteria 2403
218 Ga0500556_0024063 3300053104 Bacteria 1996
219 Ga0500562_004073 3300053108 Bacteria 3684
220 Ga0500595_013707 3300053119 Bacteria 3100
221 Ga0500595_022092 3300053119 Bacteria 2259
222 Ga0500595_040658 3300053119 Bacteria 1498
223 Ga0500614_007088 3300053123 Bacteria 2358
224 Ga0500559_0017937 3300053136 Bacteria 2991
225 Ga0500564_122795 3300053138 Bacteria 1130
226 Ga0500568_0045348 3300053139 Bacteria 1750
227 Ga0500568_0051814 3300053139 Bacteria 1613
228 Ga0500577_0041747 3300053142 Bacteria 1675
229 Ga0500604_0072344 3300053151 Bacteria 1101
230 Ga0500616_0026790 3300053153 Bacteria 3187
231 Ga0500619_010690 3300053154 Bacteria 2332
232 Ga0500622_0000104 3300053156 Bacteria 85867
233 Ga0500622_0110752 3300053156 Bacteria 1341
234 Ga0500627_0051278 3300053158 Bacteria 1799
235 Ga0500638_039292 3300053162 Bacteria 2297
236 Ga0500601_000523 3300053737 Bacteria 5788
237 Ga0500661_013875 3300055283 Bacteria 1451

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300011119 Ga0105246_10436886 Ga0105246_104368862 249
2 3300026075 Ga0207708_10289320 Ga0207708_102893202 256
3 3300048906 Ga0496103_0099494 Ga0496103_0099494_26_799 256
4 3300005439 Ga0070711_100009465 Ga0070711_1000094654 258
5 3300025916 Ga0207663_10002917 Ga0207663_100029175 258
6 3300049744 Ga0501083_0238203 Ga0501083_0238203_306_1142 259
7 3300005457 Ga0070662_100447930 Ga0070662_1004479301 261
8 3300035113 Ga0373936_0072504 Ga0373936_0072504_151_993 262
9 3300039450 Ga0436363_0291218 Ga0436363_0291218_4941_5777 263
10 iso_pu_bacteria 2849076700 2849081896 273
11 3300013105 Ga0157369_10016648 Ga0157369_100166486 276
12 3300031507 Ga0307509_10157905 Ga0307509_101579054 277
13 3300048925 Ga0496122_0004098 Ga0496122_0004098_17311_18147 277
14 3300046529 Ga0495652_0263812 Ga0495652_0263812_374_1255 278
15 3300053104 Ga0500556_0024063 Ga0500556_0024063_209_1090 278
16 3300048921 Ga0496118_0023229 Ga0496118_0023229_4383_5309 286
17 iso_pu_bacteria 2874645413 2874648893 288
18 3300009553 Ga0105249_10726207 Ga0105249_107262072 289
19 3300053123 Ga0500614_007088 Ga0500614_007088_150_1064 289
20 3300053138 Ga0500564_122795 Ga0500564_122795_125_1039 289
21 3300005340 Ga0070689_100035397 Ga0070689_1000353974 298
22 3300005445 Ga0070708_100098967 Ga0070708_1000989675 298
23 3300005536 Ga0070697_100141927 Ga0070697_1001419271 298
24 3300025273 Ga0209673_1034712 Ga0209673_10347121 298
25 3300025936 Ga0207670_10015478 Ga0207670_100154784 298
26 3300005467 Ga0070706_100219095 Ga0070706_1002190952 299
27 3300005468 Ga0070707_100060328 Ga0070707_1000603285 299
28 3300005471 Ga0070698_100183670 Ga0070698_1001836703 299
29 3300005518 Ga0070699_100104071 Ga0070699_1001040713 299
30 3300007265 Ga0099794_10134168 Ga0099794_101341681 299
31 3300025939 Ga0207665_10051098 Ga0207665_100510984 299
32 3300046477 Ga0495664_0214151 Ga0495664_0214151_121_1068 300
33 3300046529 Ga0495652_0237366 Ga0495652_0237366_173_1120 300
34 3300047472 Ga0495686_0101457 Ga0495686_0101457_343_1290 300
35 3300048929 Ga0496126_0290857 Ga0496126_0290857_132_1079 300
36 3300053119 Ga0500595_040658 Ga0500595_040658_183_1130 300
37 3300013306 Ga0163162_10345502 Ga0163162_103455022 301
38 3300053119 Ga0500595_013707 Ga0500595_013707_1495_2460 301
39 3300003354 JGI25160J50197_1005015 JGI25160J50197_10050157 302
40 3300005262 Ga0065165_1002335 Ga0065165_100233512 302
41 3300005338 Ga0068868_100157350 Ga0068868_1001573502 302
42 3300005455 Ga0070663_100025243 Ga0070663_1000252432 302
43 3300005616 Ga0068852_100172739 Ga0068852_1001727392 302
44 3300009101 Ga0105247_10074368 Ga0105247_100743682 302
45 3300010375 Ga0105239_10078725 Ga0105239_100787253 302
46 3300013306 Ga0163162_10113407 Ga0163162_101134073 302
47 3300013308 Ga0157375_10038494 Ga0157375_100384944 302
48 3300014325 Ga0163163_10131011 Ga0163163_101310114 302
49 3300025302 Ga0207426_1000354 Ga0207426_100035417 302
50 3300025900 Ga0207710_10012394 Ga0207710_100123943 302
51 3300025910 Ga0207684_10035008 Ga0207684_100350082 302
52 3300025933 Ga0207706_10214131 Ga0207706_102141312 302
53 3300026023 Ga0207677_10185406 Ga0207677_101854061 302
54 3300026067 Ga0207678_10021956 Ga0207678_100219563 302
55 3300026142 Ga0207698_10148141 Ga0207698_101481412 302
56 3300028380 Ga0268265_10483820 Ga0268265_104838201 302
57 3300046492 Ga0495585_0197268 Ga0495585_0197268_11_982 302
58 3300046557 Ga0495622_0019678 Ga0495622_0019678_1287_2258 302
59 3300046557 Ga0495622_0148642 Ga0495622_0148642_81_1046 302
60 3300046674 Ga0495588_0005368 Ga0495588_0005368_967_1938 302
61 3300047321 Ga0495676_0091192 Ga0495676_0091192_118_1089 302
62 3300048903 Ga0496100_0051632 Ga0496100_0051632_608_1579 302
63 3300048904 Ga0496101_0090074 Ga0496101_0090074_244_1215 302
64 3300048908 Ga0496105_0056155 Ga0496105_0056155_1382_2353 302
65 3300048909 Ga0496106_0419493 Ga0496106_0419493_62_1033 302
66 3300048913 Ga0496110_0115116 Ga0496110_0115116_445_1416 302
67 3300048919 Ga0496116_0027566 Ga0496116_0027566_1247_2218 302
68 3300048921 Ga0496118_0072059 Ga0496118_0072059_1223_2194 302
69 3300048922 Ga0496119_0067562 Ga0496119_0067562_40_1011 302
70 3300048924 Ga0496121_0044703 Ga0496121_0044703_1993_2964 302
71 3300003354 JGI25160J50197_1005480 JGI25160J50197_10054803 303
72 3300005262 Ga0065165_1018992 Ga0065165_10189921 303
73 3300021441 Ga0213871_10003523 Ga0213871_100035234 303
74 3300037471 Ga0395905_0050446 Ga0395905_0050446_1256_2224 303
75 3300039438 Ga0436360_0222245 Ga0436360_0222245_3582_4553 303
76 3300046512 Ga0495610_0004246 Ga0495610_0004246_4922_5893 303
77 3300053139 Ga0500568_0045348 Ga0500568_0045348_91_1062 303
78 3300003752 Ga0055539_1003689 Ga0055539_10036892 304
79 3300005548 Ga0070665_100073397 Ga0070665_1000733972 304
80 3300025230 Ga0209563_102897 Ga0209563_1028973 304
81 3300048929 Ga0496126_0206853 Ga0496126_0206853_117_1085 304
82 3300013306 Ga0163162_10682561 Ga0163162_106825611 305
83 3300021377 Ga0213874_10009839 Ga0213874_100098392 305
84 3300021384 Ga0213876_10054247 Ga0213876_100542472 305
85 3300025297 Ga0209758_1011849 Ga0209758_10118495 305
86 3300037853 Ga0436364_0413544 Ga0436364_0413544_562_1533 305
87 3300039450 Ga0436363_0448408 Ga0436363_0448408_446_1417 305
88 3300046462 Ga0495651_0217851 Ga0495651_0217851_170_1141 305
89 3300046529 Ga0495652_0029484 Ga0495652_0029484_1290_2261 305
90 3300046533 Ga0495640_0041523 Ga0495640_0041523_1163_2134 305
91 3300046642 Ga0495634_0207804 Ga0495634_0207804_24_995 305
92 3300046675 Ga0495657_0033529 Ga0495657_0033529_1513_2484 305
93 3300046680 Ga0495646_0135210 Ga0495646_0135210_189_1160 305
94 3300046694 Ga0495649_0021576 Ga0495649_0021576_1558_2529 305
95 3300047317 Ga0495604_0009181 Ga0495604_0009181_3290_4261 305
96 3300047321 Ga0495676_0076320 Ga0495676_0076320_1199_2170 305
97 3300047469 Ga0495673_0019753 Ga0495673_0019753_1642_2610 305
98 3300048088 Ga0495602_0134866 Ga0495602_0134866_567_1538 305
99 3300048907 Ga0496104_0007795 Ga0496104_0007795_4591_5562 305
100 3300048908 Ga0496105_0032593 Ga0496105_0032593_1637_2608 305
101 3300048916 Ga0496113_0027970 Ga0496113_0027970_2874_3845 305
102 3300048917 Ga0496114_0494198 Ga0496114_0494198_101_1072 305
103 3300048918 Ga0496115_0298967 Ga0496115_0298967_172_1143 305
104 3300048922 Ga0496119_0015908 Ga0496119_0015908_3679_4650 305
105 3300048923 Ga0496120_0015141 Ga0496120_0015141_2822_3793 305
106 3300048928 Ga0496125_0052622 Ga0496125_0052622_2267_3238 305
107 3300048929 Ga0496126_0021005 Ga0496126_0021005_4157_5128 305
108 3300053094 Ga0500566_0000378 Ga0500566_0000378_518_1489 305
109 3300053162 Ga0500638_039292 Ga0500638_039292_36_1007 305
110 3300006038 Ga0075365_10078845 Ga0075365_100788452 306
111 3300041452 Ga0451793_0371502 Ga0451793_0371502_251_1219 306
112 3300046454 Ga0495592_0019818 Ga0495592_0019818_2568_3578 306
113 3300046460 Ga0495638_0004161 Ga0495638_0004161_4242_5213 306
114 3300046462 Ga0495651_0044298 Ga0495651_0044298_473_1483 306
115 3300046463 Ga0495653_0164224 Ga0495653_0164224_462_1433 306
116 3300046474 Ga0495605_0038581 Ga0495605_0038581_453_1424 306
117 3300046477 Ga0495664_0035019 Ga0495664_0035019_325_1335 306
118 3300046511 Ga0495608_0003835 Ga0495608_0003835_5161_6171 306
119 3300046516 Ga0495628_0072061 Ga0495628_0072061_1598_2608 306
120 3300046529 Ga0495652_0015106 Ga0495652_0015106_2680_3690 306
121 3300046533 Ga0495640_0035251 Ga0495640_0035251_703_1713 306
122 3300046536 Ga0495587_0045361 Ga0495587_0045361_1237_2247 306
123 3300046559 Ga0495667_0003327 Ga0495667_0003327_3612_4622 306
124 3300046642 Ga0495634_0040362 Ga0495634_0040362_1938_2948 306
125 3300046663 Ga0495635_0042909 Ga0495635_0042909_2097_3107 306
126 3300046665 Ga0495661_0102853 Ga0495661_0102853_396_1367 306
127 3300046678 Ga0495599_0040860 Ga0495599_0040860_230_1240 306
128 3300046679 Ga0495623_0006484 Ga0495623_0006484_1165_2175 306
129 3300046689 Ga0495613_0098755 Ga0495613_0098755_781_1791 306
130 3300046809 Ga0495600_0063666 Ga0495600_0063666_924_1934 306
131 3300047317 Ga0495604_0003922 Ga0495604_0003922_1379_2389 306
132 3300047319 Ga0495674_0010755 Ga0495674_0010755_1338_2348 306
133 3300047322 Ga0495680_0027328 Ga0495680_0027328_2687_3697 306
134 3300047444 Ga0495675_0042270 Ga0495675_0042270_463_1473 306
135 3300048088 Ga0495602_0014951 Ga0495602_0014951_5801_6811 306
136 3300048924 Ga0496121_0121833 Ga0496121_0121833_670_1641 306
137 3300048929 Ga0496126_0010488 Ga0496126_0010488_8181_9152 306
138 3300050492 nmdc:mga0yw44_74982_c1 nmdc:mga0yw44_74982_c1_808_1776 306
139 3300053092 Ga0500583_0102486 Ga0500583_0102486_289_1260 306
140 3300053096 Ga0500641_0026803 Ga0500641_0026803_336_1307 306
141 3300053103 Ga0500555_012944 Ga0500555_012944_1088_2059 306
142 3300053108 Ga0500562_004073 Ga0500562_004073_837_1808 306
143 3300053119 Ga0500595_022092 Ga0500595_022092_257_1225 306
144 3300053136 Ga0500559_0017937 Ga0500559_0017937_60_1028 306
145 3300053139 Ga0500568_0051814 Ga0500568_0051814_249_1220 306
146 3300053142 Ga0500577_0041747 Ga0500577_0041747_394_1365 306
147 3300053151 Ga0500604_0072344 Ga0500604_0072344_33_1004 306
148 3300053153 Ga0500616_0026790 Ga0500616_0026790_2098_3069 306
149 3300053154 Ga0500619_010690 Ga0500619_010690_46_1014 306
150 3300053156 Ga0500622_0110752 Ga0500622_0110752_73_1044 306
151 3300053158 Ga0500627_0051278 Ga0500627_0051278_614_1585 306
152 3300053737 Ga0500601_000523 Ga0500601_000523_1270_2241 306
153 3300055283 Ga0500661_013875 Ga0500661_013875_357_1328 306
154 3300003790 Ga0055528_1000039 Ga0055528_1000039102 307
155 3300005455 Ga0070663_100061744 Ga0070663_1000617443 307
156 3300005614 Ga0068856_100522848 Ga0068856_1005228481 307
157 3300025273 Ga0209673_1000161 Ga0209673_1000161123 307
158 3300025981 Ga0207640_10042144 Ga0207640_100421441 307
159 3300026067 Ga0207678_10092069 Ga0207678_100920691 307
160 3300026078 Ga0207702_10387049 Ga0207702_103870491 307
161 3300046507 Ga0495606_0107362 Ga0495606_0107362_656_1627 307
162 3300046519 Ga0495632_0004024 Ga0495632_0004024_5372_6352 307
163 3300048924 Ga0496121_0162798 Ga0496121_0162798_87_1058 307
164 3300048924 Ga0496121_0006136 Ga0496121_0006136_10788_11756 308
165 3300006163 Ga0070715_10060466 Ga0070715_100604662 309
166 3300003775 Ga0055524_1009924 Ga0055524_10099241 310
167 3300003790 Ga0055528_1002356 Ga0055528_10023567 310
168 3300025273 Ga0209673_1000132 Ga0209673_100013211 310
169 3300025295 Ga0209564_1001841 Ga0209564_10018418 310
170 3300025299 Ga0209256_1000479 Ga0209256_100047911 310
171 3300039437 Ga0436365_0025836 Ga0436365_0025836_1447_2418 310
172 3300048919 Ga0496116_0039648 Ga0496116_0039648_546_1526 310
173 3300048925 Ga0496122_0031750 Ga0496122_0031750_201_1181 310
174 iso_pu_bacteria 3005445848 3005452478 312
175 3300028786 Ga0307517_10000008 Ga0307517_1000000885 313
176 3300037853 Ga0436364_0053036 Ga0436364_0053036_1204_2175 314
177 3300033180 Ga0307510_10035866 Ga0307510_100358665 316
178 iso_pu_bacteria 2513237146 2513925988 316
179 iso_pu_bacteria 2599185170 2599417466 316
180 iso_pu_bacteria 2838035591 2838038326 316
181 iso_pu_bacteria 2515154113 2515636535 318
182 iso_pu_bacteria 2515154114 2515642319 318
183 iso_pu_bacteria 2582581308 2585283406 318
184 iso_pu_bacteria 2585427527 2585537127 318
185 iso_pu_bacteria 2738541293 2738801595 318
186 iso_pu_bacteria 2821123053 2821129958 318
187 iso_pu_bacteria 2821443989 2821445480 318
188 iso_pu_bacteria 2842110456 2842114473 318
189 iso_pu_bacteria 2844533157 2844536139 318
190 iso_pu_bacteria 2852387548 2852393541 318
191 iso_pu_bacteria 2933586486 2933590671 318
192 iso_pu_bacteria 2977942078 2977947340 318
193 iso_pu_bacteria 3005445848 3005447863 318
194 iso_pu_bacteria 8005542996 8005549568 318
195 iso_pu_bacteria 8024486573 8024490479 318
196 iso_pu_bacteria 2643221643 2644237382 320
197 3300021388 Ga0213875_10022131 Ga0213875_100221312 321
198 3300025295 Ga0209564_1031985 Ga0209564_10319852 321
199 3300031731 Ga0307405_10003912 Ga0307405_100039125 321
200 3300046519 Ga0495632_0000703 Ga0495632_0000703_24833_25804 321
201 3300048919 Ga0496116_0009812 Ga0496116_0009812_2106_3077 321
202 3300048919 Ga0496116_0011617 Ga0496116_0011617_1873_2844 321
203 3300048919 Ga0496116_0027586 Ga0496116_0027586_391_1362 321
204 3300048921 Ga0496118_0007702 Ga0496118_0007702_7084_8052 321
205 3300048924 Ga0496121_0008253 Ga0496121_0008253_6958_7929 321
206 3300048924 Ga0496121_0119582 Ga0496121_0119582_968_1978 321
207 3300048925 Ga0496122_0006012 Ga0496122_0006012_9510_10481 321
208 3300048926 Ga0496123_0017925 Ga0496123_0017925_1588_2559 321
209 3300048927 Ga0496124_0002917 Ga0496124_0002917_19159_20130 321
210 3300048927 Ga0496124_0007627 Ga0496124_0007627_10065_11036 321
211 3300002773 JGI25152J39213_1006787 JGI25152J39213_10067874 322
212 3300003214 JGI25165J46597_1001928 JGI25165J46597_10019284 322
213 3300003323 rootH1_10088588 rootH1_100885882 322
214 3300003790 Ga0055528_1007327 Ga0055528_10073277 322
215 3300005563 Ga0068855_100180321 Ga0068855_1001803212 322
216 3300009093 Ga0105240_10000255 Ga0105240_1000025528 322
217 3300009177 Ga0105248_10144529 Ga0105248_101445292 322
218 3300009545 Ga0105237_10001144 Ga0105237_1000114424 322
219 3300010375 Ga0105239_10000932 Ga0105239_1000093216 322
220 3300015265 Ga0182005_1004760 Ga0182005_10047602 322
221 3300025253 Ga0209677_100272 Ga0209677_10027210 322
222 3300025258 Ga0209129_1000237 Ga0209129_100023730 322
223 3300025261 Ga0209233_1000282 Ga0209233_100028247 322
224 3300025273 Ga0209673_1000554 Ga0209673_100055446 322
225 3300025294 Ga0209025_1006818 Ga0209025_10068183 322
226 3300025295 Ga0209564_1004757 Ga0209564_10047571 322
227 3300025299 Ga0209256_1000292 Ga0209256_100029264 322
228 3300025913 Ga0207695_10000352 Ga0207695_1000035274 322
229 3300025914 Ga0207671_10000534 Ga0207671_1000053420 322
230 3300025949 Ga0207667_10263912 Ga0207667_102639122 322
231 3300041498 Ga0451841_0221433 Ga0451841_0221433_1224_2204 322
232 3300041507 Ga0451851_0421712 Ga0451851_0421712_17113_18081 322
233 3300041511 Ga0451855_0942538 Ga0451855_0942538_854_1870 322
234 3300041512 Ga0451853_0844562 Ga0451853_0844562_742_1722 322
235 3300046512 Ga0495610_0047338 Ga0495610_0047338_441_1409 322
236 3300047472 Ga0495686_0093511 Ga0495686_0093511_187_1170 322
237 3300048903 Ga0496100_0000274 Ga0496100_0000274_22860_23840 322
238 3300048905 Ga0496102_0075244 Ga0496102_0075244_1707_2687 322
239 3300048908 Ga0496105_0012683 Ga0496105_0012683_96_1076 322
240 3300048913 Ga0496110_0293391 Ga0496110_0293391_429_1409 322
241 3300048916 Ga0496113_0012492 Ga0496113_0012492_4618_5598 322
242 3300048919 Ga0496116_0000810 Ga0496116_0000810_17642_18622 322
243 3300048919 Ga0496116_0050073 Ga0496116_0050073_383_1363 322
244 3300048920 Ga0496117_0001702 Ga0496117_0001702_12842_13822 322
245 3300048921 Ga0496118_0001874 Ga0496118_0001874_12842_13822 322
246 3300048922 Ga0496119_0001423 Ga0496119_0001423_16099_17079 322
247 3300048922 Ga0496119_0006335 Ga0496119_0006335_8378_9358 322
248 3300048923 Ga0496120_0000931 Ga0496120_0000931_22790_23770 322
249 3300048924 Ga0496121_0002373 Ga0496121_0002373_16651_17631 322
250 3300048924 Ga0496121_0020584 Ga0496121_0020584_3132_4103 322
251 3300048925 Ga0496122_0001469 Ga0496122_0001469_18338_19318 322
252 3300048925 Ga0496122_0180263 Ga0496122_0180263_167_1147 322
253 3300048926 Ga0496123_0000971 Ga0496123_0000971_25358_26338 322
254 3300048927 Ga0496124_0001705 Ga0496124_0001705_12437_13417 322
255 3300048927 Ga0496124_0021735 Ga0496124_0021735_3428_4408 322
256 3300048928 Ga0496125_0001896 Ga0496125_0001896_3204_4184 322
257 3300048929 Ga0496126_0002126 Ga0496126_0002126_17762_18742 322
258 3300048929 Ga0496126_0004627 Ga0496126_0004627_10411_11391 322
259 3300053156 Ga0500622_0000104 Ga0500622_0000104_62423_63391 322
260 iso_pu_bacteria 2534681796 2535518680 322

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00753

Lactamase_B

Metallo-beta-lactamase superfamily

83

271

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
2znb-assembly1.cif.gz_A metallo-beta-lactamase (cadmium-bound form) 0.8707 52 272
3znb-assembly1.cif.gz_A metallo-beta-lactamase (zn, hg-bound form) 0.8418 51 272
3kns-assembly4.cif.gz_D bacillus cereus metallo-beta-lactamase cys221asp mutant, 20 mm zn(ii) 0.8405 55 271
1bmc-assembly1.cif.gz_A structure of a zinc metallo-beta-lactamase from bacillus cereus 0.8394 55 271
1kr3-assembly2.cif.gz_B crystal structure of the metallo beta-lactamase from bacteroides fragilis (cfia) in complex with the tricyclic inhibitor sb-236050. 0.8315 54 272
ID Description Score Start End Superfamily
af_A0A0R0HZQ1_3_96_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8534 171 260 3.60.15.10
af_Q682P6_229_394_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8502 84 260 3.60.15.10
1m2xC00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8236 54 272 3.60.15.10
af_O86346_330_578_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8229 57 276 3.60.15.10
5lscA00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8087 54 272 3.60.15.10
ID Description Score Start End GO Terms
AF-A0A090KNM1-F1-model_v4 Uncultured bacterium genome assembly Metasoil_fosmids_resub 0.9895 39 322 GO:0016787
GO:0017001
GO:0042597
GO:0046677
GO:0046872
AF-A0A4Q6BDX4-F1-model_v4 MBL fold metallo-hydrolase 0.9882 60 322 GO:0016787
GO:0017001
GO:0042597
GO:0046677
GO:0046872
AF-A0A2A5FWV3-F1-model_v4 Metallo-beta-lactamase domain-containing protein 0.9874 176 322
AF-A0A4Q6BDX4-F1-model_v4 MBL fold metallo-hydrolase 0.9844 60 322 GO:0016787
GO:0017001
GO:0042597
GO:0046677
GO:0046872
AF-A0A7W5KRH6-F1-model_v4 deleted 0.9843 171 322

Feature Viewer

pLDDT pTM Quality
86.58 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map