F369445

General Info

Members Datasets Scaffolds Average Seq Length
260 144 520 154

Family's Representative Sequence

Representative Sequence 3300005983|Ga0081540_1002291|Ga0081540_10022914
Length 172
Sequence MERVPAERADLDASKLDRTEIVGMIAAALLVISVFLEWYSLTTDPSVVQRGNDPSNWACGVGNSSCSGWDTFPVVSVLLILAALAPFILSWIVIRGHALSWPRGELTAVVGLTAFVLVAFNGIIDKPQDGLEMSLGFGYWLALAASFAIFLSGGFRAVESGGGAQRKPPATF

Samples

Sample ID Description Type Environment
1 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
2 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
3 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
4 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
5 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
6 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
7 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
8 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
9 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
10 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
11 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
12 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
13 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
14 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
15 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
16 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
17 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
18 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
19 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
20 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
21 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
22 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
23 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
24 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
25 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
26 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
27 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
38 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
39 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
40 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
41 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
42 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
43 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
44 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
45 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
46 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
47 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
48 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
49 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
50 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
51 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
52 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
53 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
54 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
55 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
56 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
57 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
58 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
59 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
60 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
61 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
62 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
63 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
64 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
65 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
66 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
67 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
68 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
69 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
70 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
71 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
72 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
73 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
74 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
75 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
76 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
77 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
78 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
79 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
80 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
81 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
82 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
83 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
84 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
85 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
86 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
87 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
88 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
89 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
90 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
91 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
92 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
93 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
94 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
95 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
96 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
97 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
98 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
99 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
100 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
101 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
102 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
103 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
104 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
105 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
106 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
107 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
108 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
109 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
110 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
118 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
121 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
122 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
123 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
124 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
125 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
126 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
127 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
128 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
129 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
130 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
131 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
133 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
134 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
135 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
136 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
137 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
138 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
139 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
140 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
141 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
142 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
143 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
144 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.46
Nodule 0
Rhizoplane 7.31
Rhizosphere 78.85
Stem 0
Stem Tuber 0
Unclassified 5.77

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081540_1002291 3300005983 Bacteria 15726
2 Ga0070709_10023053 3300005434 Bacteria 3650
3 Ga0070714_100106945 3300005435 Bacteria 2472
4 Ga0070714_100444581 3300005435 Bacteria 1231
5 Ga0070713_100041912 3300005436 Bacteria 3732
6 Ga0070713_100053657 3300005436 Bacteria 3341
7 Ga0070713_100084213 3300005436 Bacteria 2720
8 Ga0070710_10087881 3300005437 Bacteria 1828
9 Ga0070710_10341162 3300005437 Unclassified 989
10 Ga0070710_11243537 3300005437 Bacteria 552
11 Ga0070711_100154067 3300005439 Bacteria 1736
12 Ga0070711_100342567 3300005439 Bacteria 1200
13 Ga0070705_100293225 3300005440 Bacteria 1162
14 Ga0070706_100957928 3300005467 Bacteria 790
15 Ga0070693_100404128 3300005547 Bacteria 948
16 Ga0070704_100276722 3300005549 Bacteria 1389
17 Ga0068856_100443204 3300005614 Bacteria 1319
18 Ga0081455_10038290 3300005937 Bacteria 4247
19 Ga0081538_10051525 3300005981 Bacteria 2470
20 Ga0081538_10207979 3300005981 Bacteria 793
21 Ga0081539_10248764 3300005985 Bacteria 791
22 Ga0070717_10082947 3300006028 Bacteria 2694
23 Ga0070717_10104854 3300006028 Bacteria 2405
24 Ga0070717_10810545 3300006028 Unclassified 852
25 Ga0070717_11188631 3300006028 Bacteria 694
26 Ga0075365_10035190 3300006038 Bacteria 3238
27 Ga0075363_100535847 3300006048 Unclassified 698
28 Ga0075364_10064136 3300006051 Bacteria 2411
29 Ga0075364_10338713 3300006051 Bacteria 1025
30 Ga0070716_100100507 3300006173 Bacteria 1772
31 Ga0070712_100010346 3300006175 Bacteria 5883
32 Ga0070712_100345111 3300006175 Bacteria 1217
33 Ga0075431_100561648 3300006847 Bacteria 1128
34 Ga0111539_11835252 3300009094 Bacteria 703
35 Ga0105245_10320547 3300009098 Bacteria 1526
36 Ga0105243_11786673 3300009148 Unclassified 645
37 Ga0213876_10017733 3300021384 Bacteria 3757
38 Ga0213876_10053759 3300021384 Bacteria 2126
39 Ga0213876_10109620 3300021384 Bacteria 1465
40 Ga0213875_10082601 3300021388 Bacteria 1499
41 Ga0213875_10284590 3300021388 Bacteria 781
42 Ga0207692_10009999 3300025898 Bacteria 3979
43 Ga0207685_10013723 3300025905 Bacteria 2514
44 Ga0207699_10028840 3300025906 Bacteria 3089
45 Ga0207693_10022587 3300025915 Bacteria 4998
46 Ga0207693_10317850 3300025915 Bacteria 1219
47 Ga0207663_10013885 3300025916 Bacteria 4393
48 Ga0207687_11313615 3300025927 Unclassified 622
49 Ga0207700_10039764 3300025928 Bacteria 3426
50 Ga0207700_10145549 3300025928 Bacteria 1952
51 Ga0207700_10397073 3300025928 Bacteria 1208
52 Ga0207664_10002005 3300025929 Bacteria 13412
53 Ga0207664_10049247 3300025929 Bacteria 3316
54 Ga0207664_10182947 3300025929 Bacteria 1800
55 Ga0207664_10504831 3300025929 Bacteria 1083
56 Ga0207664_10601536 3300025929 Bacteria 987
57 Ga0207709_10942442 3300025935 Unclassified 703
58 Ga0207665_10143562 3300025939 Bacteria 1704
59 Ga0373938_0147776 3300034957 Bacteria 624
60 Ga0373923_0070521 3300035111 Bacteria 1500
61 Ga0373956_0042348 3300035119 Bacteria 2024
62 Ga0373955_0105823 3300035172 Bacteria 1621
63 Ga0373927_0405331 3300035695 Bacteria 900
64 Ga0373947_0902999 3300035725 Unclassified 603
65 Ga0373937_0019063 3300036401 Bacteria 6139
66 Ga0373925_0820601 3300037068 Bacteria 767
67 Ga0395899_0814636 3300037312 Bacteria 576
68 Ga0395900_0284912 3300037418 Bacteria 1643
69 Ga0395900_1353175 3300037418 Unclassified 625
70 Ga0395898_0091793 3300037466 Bacteria 2921
71 Ga0395898_0617456 3300037466 Bacteria 1027
72 Ga0395898_1396339 3300037466 Unclassified 628
73 Ga0395905_1232714 3300037471 Bacteria 652
74 Ga0436364_0438741 3300037853 Bacteria 3473
75 Ga0436364_0472332 3300037853 Bacteria 14490
76 Ga0436364_0688956 3300037853 Bacteria 820
77 Ga0436364_0900206 3300037853 Bacteria 1392
78 Ga0436364_0916790 3300037853 Bacteria 988
79 Ga0436364_1297310 3300037853 Bacteria 1035
80 Ga0436364_1299511 3300037853 Bacteria 2724
81 Ga0436364_1325740 3300037853 Bacteria 2004
82 Ga0395901_0029216 3300038443 Bacteria 5674
83 Ga0395901_0190024 3300038443 Bacteria 2154
84 Ga0395901_0199932 3300038443 Bacteria 2095
85 Ga0395901_0359353 3300038443 Bacteria 1502
86 Ga0436365_0105225 3300039437 Unclassified 559
87 Ga0436365_0124177 3300039437 Bacteria 3514
88 Ga0436365_0483150 3300039437 Bacteria 1022
89 Ga0436365_0510228 3300039437 Bacteria 2480
90 Ga0436365_0539242 3300039437 Bacteria 2679
91 Ga0436365_0595886 3300039437 Bacteria 4447
92 Ga0436365_1131245 3300039437 Bacteria 1185
93 Ga0436365_1166682 3300039437 Bacteria 3917
94 Ga0436363_0082309 3300039450 Bacteria 702
95 Ga0436363_0620830 3300039450 Bacteria 566
96 Ga0436363_0826049 3300039450 Bacteria 1312
97 Ga0436363_0989178 3300039450 Bacteria 1383
98 Ga0436363_1268108 3300039450 Unclassified 532
99 Ga0436363_1404016 3300039450 Bacteria 1700
100 Ga0436362_0527340 3300039453 Bacteria 2370
101 Ga0436362_0566097 3300039453 Unclassified 1206
102 Ga0451800_0634229 3300041459 Bacteria 979
103 Ga0466969_0027736 3300044656 Bacteria 2899
104 Ga0466969_0035510 3300044656 Bacteria 2521
105 Ga0466969_0061215 3300044656 Bacteria 1829
106 Ga0466969_0431270 3300044656 Bacteria 599
107 Ga0466966_0203072 3300044684 Bacteria 1199
108 Ga0466966_0374760 3300044684 Bacteria 855
109 Ga0466966_0852699 3300044684 Bacteria 549
110 Ga0466961_0013880 3300044693 Bacteria 5161
111 Ga0466961_0019356 3300044693 Bacteria 4379
112 Ga0466961_0097178 3300044693 Bacteria 1857
113 Ga0466961_0111155 3300044693 Bacteria 1724
114 Ga0466961_0182749 3300044693 Bacteria 1301
115 Ga0466961_0191398 3300044693 Bacteria 1268
116 Ga0466961_0809499 3300044693 Bacteria 559
117 Ga0466963_0003602 3300044694 Bacteria 8902
118 Ga0466963_0012129 3300044694 Bacteria 5268
119 Ga0466963_0104967 3300044694 Bacteria 1936
120 Ga0466963_0440832 3300044694 Bacteria 919
121 Ga0466963_0691430 3300044694 Bacteria 720
122 Ga0466971_0010793 3300044719 Bacteria 3995
123 Ga0466971_0310706 3300044719 Bacteria 758
124 Ga0466968_0057778 3300044735 Bacteria 1668
125 Ga0466968_0154836 3300044735 Bacteria 1055
126 Ga0466970_0110733 3300044765 Bacteria 1499
127 Ga0466970_0128496 3300044765 Bacteria 1391
128 Ga0466970_0214620 3300044765 Bacteria 1073
129 Ga0466957_0499332 3300044842 Bacteria 843
130 Ga0466957_0948696 3300044842 Unclassified 616
131 Ga0466959_0006075 3300045049 Bacteria 8334
132 Ga0466959_0009827 3300045049 Bacteria 6817
133 Ga0466959_0024885 3300045049 Bacteria 4434
134 Ga0466959_0050019 3300045049 Bacteria 3070
135 Ga0466958_0008782 3300045836 Bacteria 5612
136 Ga0466958_0017958 3300045836 Bacteria 4099
137 Ga0466958_0018703 3300045836 Bacteria 4025
138 Ga0466958_0046446 3300045836 Bacteria 2620
139 Ga0466958_0168598 3300045836 Bacteria 1386
140 Ga0466958_0617466 3300045836 Bacteria 705
141 Ga0466958_0673924 3300045836 Unclassified 673
142 Ga0466967_0056454 3300045976 Bacteria 3462
143 Ga0466967_0123050 3300045976 Bacteria 2400
144 Ga0466967_0282674 3300045976 Bacteria 1592
145 Ga0466967_0484734 3300045976 Bacteria 1212
146 Ga0466967_1074927 3300045976 Bacteria 801
147 Ga0495592_0091625 3300046454 Bacteria 2180
148 Ga0495592_0781567 3300046454 Bacteria 568
149 Ga0495629_0135842 3300046459 Bacteria 1712
150 Ga0495651_0011604 3300046462 Bacteria 6771
151 Ga0495653_0021876 3300046463 Bacteria 5177
152 Ga0495662_0071168 3300046476 Bacteria 1685
153 Ga0495664_0453347 3300046477 Bacteria 768
154 Ga0495596_0081067 3300046500 Bacteria 1260
155 Ga0495608_0037566 3300046511 Bacteria 3256
156 Ga0495618_0025379 3300046514 Bacteria 3678
157 Ga0495628_0035219 3300046516 Bacteria 4024
158 Ga0495643_0274861 3300046522 Bacteria 777
159 Ga0495644_0040384 3300046523 Bacteria 1759
160 Ga0495663_0037937 3300046525 Bacteria 1455
161 Ga0495666_0389031 3300046526 Unclassified 627
162 Ga0495652_0010817 3300046529 Bacteria 8269
163 Ga0495640_0061548 3300046533 Bacteria 2549
164 Ga0495587_0014204 3300046536 Bacteria 4998
165 Ga0495587_0210802 3300046536 Bacteria 1097
166 Ga0495645_0390017 3300046543 Bacteria 889
167 Ga0495667_0009240 3300046559 Bacteria 6686
168 Ga0495667_0253934 3300046559 Bacteria 1119
169 Ga0495656_0346339 3300046615 Bacteria 769
170 Ga0495634_0074875 3300046642 Bacteria 2224
171 Ga0495635_0011782 3300046663 Bacteria 6131
172 Ga0495657_0038700 3300046675 Bacteria 3280
173 Ga0495623_0207143 3300046679 Bacteria 1124
174 Ga0495613_0054082 3300046689 Bacteria 2952
175 Ga0495660_0232173 3300046810 Bacteria 864
176 Ga0495604_0031070 3300047317 Bacteria 4238
177 Ga0495674_0020787 3300047319 Bacteria 6077
178 Ga0495674_0221607 3300047319 Bacteria 1563
179 Ga0495680_0043102 3300047322 Bacteria 3575
180 Ga0495680_0127126 3300047322 Bacteria 1876
181 Ga0495684_0018196 3300047471 Bacteria 5415
182 Ga0495593_0031593 3300047673 Bacteria 2892
183 Ga0495602_0016831 3300048088 Bacteria 7340
184 Ga0495602_0295844 3300048088 Bacteria 1187
185 Ga0496101_1482223 3300048904 Bacteria 528
186 Ga0496104_0058495 3300048907 Bacteria 3649
187 Ga0496104_0285047 3300048907 Bacteria 1565
188 Ga0496105_0235907 3300048908 Bacteria 1485
189 Ga0496105_0439140 3300048908 Bacteria 1031
190 Ga0496106_0555034 3300048909 Bacteria 921
191 Ga0496108_0824502 3300048911 Bacteria 799
192 Ga0496109_0334860 3300048912 Bacteria 1429
193 Ga0496109_0457723 3300048912 Bacteria 1205
194 Ga0496110_0434217 3300048913 Bacteria 1197
195 Ga0496110_0792462 3300048913 Bacteria 852
196 Ga0496110_0850414 3300048913 Bacteria 818
197 Ga0496111_0122162 3300048914 Bacteria 1924
198 Ga0496111_0326175 3300048914 Bacteria 1137
199 Ga0496112_0022418 3300048915 Bacteria 6019
200 Ga0496113_0071106 3300048916 Bacteria 2646
201 Ga0496114_0192596 3300048917 Bacteria 1784
202 Ga0496115_0039795 3300048918 Bacteria 3735
203 Ga0501031_0293370 3300049568 Bacteria 1054
204 Ga0501031_0437644 3300049568 Bacteria 845
205 Ga0501036_0035388 3300049572 Bacteria 4227
206 Ga0501036_0065248 3300049572 Bacteria 3082
207 Ga0501037_0027827 3300049573 Bacteria 4178
208 Ga0501038_0081562 3300049574 Bacteria 2725
209 Ga0501038_1179258 3300049574 Bacteria 557
210 Ga0501039_0061093 3300049575 Bacteria 2918
211 Ga0501039_0464527 3300049575 Bacteria 994
212 Ga0501039_0634711 3300049575 Bacteria 836
213 Ga0501040_0155871 3300049576 Bacteria 1613
214 Ga0501040_0576847 3300049576 Bacteria 812
215 Ga0501041_0065540 3300049577 Bacteria 2225
216 Ga0501041_1111634 3300049577 Bacteria 509
217 Ga0501042_0254772 3300049578 Bacteria 1266
218 Ga0501042_1408000 3300049578 Bacteria 508
219 Ga0501046_0184251 3300049580 Bacteria 1560
220 Ga0501048_0096947 3300049582 Bacteria 2080
221 Ga0501068_0516579 3300049584 Bacteria 775
222 Ga0501071_0160204 3300049587 Bacteria 1681
223 Ga0501071_0279884 3300049587 Bacteria 1262
224 Ga0501071_0312221 3300049587 Bacteria 1193
225 Ga0501072_0052366 3300049588 Bacteria 3214
226 Ga0501072_0071087 3300049588 Bacteria 2749
227 Ga0501072_0234017 3300049588 Bacteria 1463
228 Ga0501074_0155108 3300049590 Bacteria 1636
229 Ga0501075_0092114 3300049591 Bacteria 2300
230 Ga0501076_0011840 3300049592 Bacteria 6513
231 Ga0501076_0358191 3300049592 Bacteria 1198
232 Ga0501076_0461687 3300049592 Bacteria 1046
233 Ga0501077_0029977 3300049593 Bacteria 3461
234 Ga0501079_0111971 3300049741 Bacteria 2121
235 Ga0501079_0176421 3300049741 Bacteria 1667
236 Ga0501079_0419445 3300049741 Bacteria 1050
237 Ga0501080_0119878 3300049742 Bacteria 2439
238 Ga0501080_0599226 3300049742 Bacteria 978
239 Ga0501081_0130212 3300049743 Bacteria 1797
240 Ga0501081_1371042 3300049743 Bacteria 536
241 Ga0501083_1080266 3300049744 Bacteria 522
242 Ga0501035_0735341 3300049822 Bacteria 793
243 Ga0501045_0175363 3300049824 Bacteria 1597
244 Ga0501045_0757666 3300049824 Bacteria 715
245 nmdc:mga00v17_100141_c1 3300050491 Bacteria 1828
246 nmdc:mga00v17_308343_c1 3300050491 Bacteria 1028
247 nmdc:mga00v17_61204_c1 3300050491 Bacteria 2313
248 nmdc:mga00v17_74620_c1 3300050491 Bacteria 2108
249 nmdc:mga05p37_1534393_c1 3300050507 Archaea 661
250 nmdc:mga06r32_967286_c1 3300050510 Bacteria 805
251 Ga0495612_0052046 3300053078 Bacteria 1684
252 Ga0495655_0068379 3300053083 Bacteria 987
253 Ga0495595_0018452 3300053084 Bacteria 3014
254 Ga0495619_0002668 3300053085 Bacteria 11671
255 Ga0500554_058401 3300053102 Bacteria 1232
256 Ga0501084_0028887 3300054114 Bacteria 4636
257 Ga0501082_0237517 3300060353 Bacteria 1586
258 Ga0466962_0006866 3300061719 Bacteria 5459
259 Ga0530510_0084113 3300061734 Bacteria 2317
260 Ga0530510_0696011 3300061734 Bacteria 774
261 Ga0081540_1002291
262 Ga0070709_10023053
263 Ga0070714_100106945
264 Ga0070714_100444581
265 Ga0070713_100041912
266 Ga0070713_100053657
267 Ga0070713_100084213
268 Ga0070710_10087881
269 Ga0070710_10341162
270 Ga0070710_11243537
271 Ga0070711_100154067
272 Ga0070711_100342567
273 Ga0070705_100293225
274 Ga0070706_100957928
275 Ga0070693_100404128
276 Ga0070704_100276722
277 Ga0068856_100443204
278 Ga0081455_10038290
279 Ga0081538_10051525
280 Ga0081538_10207979
281 Ga0081539_10248764
282 Ga0070717_10082947
283 Ga0070717_10104854
284 Ga0070717_10810545
285 Ga0070717_11188631
286 Ga0075365_10035190
287 Ga0075363_100535847
288 Ga0075364_10064136
289 Ga0075364_10338713
290 Ga0070716_100100507
291 Ga0070712_100010346
292 Ga0070712_100345111
293 Ga0075431_100561648
294 Ga0111539_11835252
295 Ga0105245_10320547
296 Ga0105243_11786673
297 Ga0213876_10017733
298 Ga0213876_10053759
299 Ga0213876_10109620
300 Ga0213875_10082601
301 Ga0213875_10284590
302 Ga0207692_10009999
303 Ga0207685_10013723
304 Ga0207699_10028840
305 Ga0207693_10022587
306 Ga0207693_10317850
307 Ga0207663_10013885
308 Ga0207687_11313615
309 Ga0207700_10039764
310 Ga0207700_10145549
311 Ga0207700_10397073
312 Ga0207664_10002005
313 Ga0207664_10049247
314 Ga0207664_10182947
315 Ga0207664_10504831
316 Ga0207664_10601536
317 Ga0207709_10942442
318 Ga0207665_10143562
319 Ga0373938_0147776
320 Ga0373923_0070521
321 Ga0373956_0042348
322 Ga0373955_0105823
323 Ga0373927_0405331
324 Ga0373947_0902999
325 Ga0373937_0019063
326 Ga0373925_0820601
327 Ga0395899_0814636
328 Ga0395900_0284912
329 Ga0395900_1353175
330 Ga0395898_0091793
331 Ga0395898_0617456
332 Ga0395898_1396339
333 Ga0395905_1232714
334 Ga0436364_0438741
335 Ga0436364_0472332
336 Ga0436364_0688956
337 Ga0436364_0900206
338 Ga0436364_0916790
339 Ga0436364_1297310
340 Ga0436364_1299511
341 Ga0436364_1325740
342 Ga0395901_0029216
343 Ga0395901_0190024
344 Ga0395901_0199932
345 Ga0395901_0359353
346 Ga0436365_0105225
347 Ga0436365_0124177
348 Ga0436365_0483150
349 Ga0436365_0510228
350 Ga0436365_0539242
351 Ga0436365_0595886
352 Ga0436365_1131245
353 Ga0436365_1166682
354 Ga0436363_0082309
355 Ga0436363_0620830
356 Ga0436363_0826049
357 Ga0436363_0989178
358 Ga0436363_1268108
359 Ga0436363_1404016
360 Ga0436362_0527340
361 Ga0436362_0566097
362 Ga0451800_0634229
363 Ga0466969_0027736
364 Ga0466969_0035510
365 Ga0466969_0061215
366 Ga0466969_0431270
367 Ga0466966_0203072
368 Ga0466966_0374760
369 Ga0466966_0852699
370 Ga0466961_0013880
371 Ga0466961_0019356
372 Ga0466961_0097178
373 Ga0466961_0111155
374 Ga0466961_0182749
375 Ga0466961_0191398
376 Ga0466961_0809499
377 Ga0466963_0003602
378 Ga0466963_0012129
379 Ga0466963_0104967
380 Ga0466963_0440832
381 Ga0466963_0691430
382 Ga0466971_0010793
383 Ga0466971_0310706
384 Ga0466968_0057778
385 Ga0466968_0154836
386 Ga0466970_0110733
387 Ga0466970_0128496
388 Ga0466970_0214620
389 Ga0466957_0499332
390 Ga0466957_0948696
391 Ga0466959_0006075
392 Ga0466959_0009827
393 Ga0466959_0024885
394 Ga0466959_0050019
395 Ga0466958_0008782
396 Ga0466958_0017958
397 Ga0466958_0018703
398 Ga0466958_0046446
399 Ga0466958_0168598
400 Ga0466958_0617466
401 Ga0466958_0673924
402 Ga0466967_0056454
403 Ga0466967_0123050
404 Ga0466967_0282674
405 Ga0466967_0484734
406 Ga0466967_1074927
407 Ga0495592_0091625
408 Ga0495592_0781567
409 Ga0495629_0135842
410 Ga0495651_0011604
411 Ga0495653_0021876
412 Ga0495662_0071168
413 Ga0495664_0453347
414 Ga0495596_0081067
415 Ga0495608_0037566
416 Ga0495618_0025379
417 Ga0495628_0035219
418 Ga0495643_0274861
419 Ga0495644_0040384
420 Ga0495663_0037937
421 Ga0495666_0389031
422 Ga0495652_0010817
423 Ga0495640_0061548
424 Ga0495587_0014204
425 Ga0495587_0210802
426 Ga0495645_0390017
427 Ga0495667_0009240
428 Ga0495667_0253934
429 Ga0495656_0346339
430 Ga0495634_0074875
431 Ga0495635_0011782
432 Ga0495657_0038700
433 Ga0495623_0207143
434 Ga0495613_0054082
435 Ga0495660_0232173
436 Ga0495604_0031070
437 Ga0495674_0020787
438 Ga0495674_0221607
439 Ga0495680_0043102
440 Ga0495680_0127126
441 Ga0495684_0018196
442 Ga0495593_0031593
443 Ga0495602_0016831
444 Ga0495602_0295844
445 Ga0496101_1482223
446 Ga0496104_0058495
447 Ga0496104_0285047
448 Ga0496105_0235907
449 Ga0496105_0439140
450 Ga0496106_0555034
451 Ga0496108_0824502
452 Ga0496109_0334860
453 Ga0496109_0457723
454 Ga0496110_0434217
455 Ga0496110_0792462
456 Ga0496110_0850414
457 Ga0496111_0122162
458 Ga0496111_0326175
459 Ga0496112_0022418
460 Ga0496113_0071106
461 Ga0496114_0192596
462 Ga0496115_0039795
463 Ga0501031_0293370
464 Ga0501031_0437644
465 Ga0501036_0035388
466 Ga0501036_0065248
467 Ga0501037_0027827
468 Ga0501038_0081562
469 Ga0501038_1179258
470 Ga0501039_0061093
471 Ga0501039_0464527
472 Ga0501039_0634711
473 Ga0501040_0155871
474 Ga0501040_0576847
475 Ga0501041_0065540
476 Ga0501041_1111634
477 Ga0501042_0254772
478 Ga0501042_1408000
479 Ga0501046_0184251
480 Ga0501048_0096947
481 Ga0501068_0516579
482 Ga0501071_0160204
483 Ga0501071_0279884
484 Ga0501071_0312221
485 Ga0501072_0052366
486 Ga0501072_0071087
487 Ga0501072_0234017
488 Ga0501074_0155108
489 Ga0501075_0092114
490 Ga0501076_0011840
491 Ga0501076_0358191
492 Ga0501076_0461687
493 Ga0501077_0029977
494 Ga0501079_0111971
495 Ga0501079_0176421
496 Ga0501079_0419445
497 Ga0501080_0119878
498 Ga0501080_0599226
499 Ga0501081_0130212
500 Ga0501081_1371042
501 Ga0501083_1080266
502 Ga0501035_0735341
503 Ga0501045_0175363
504 Ga0501045_0757666
505 nmdc:mga00v17_100141_c1
506 nmdc:mga00v17_308343_c1
507 nmdc:mga00v17_61204_c1
508 nmdc:mga00v17_74620_c1
509 nmdc:mga05p37_1534393_c1
510 nmdc:mga06r32_967286_c1
511 Ga0495612_0052046
512 Ga0495655_0068379
513 Ga0495595_0018452
514 Ga0495619_0002668
515 Ga0500554_058401
516 Ga0501084_0028887
517 Ga0501082_0237517
518 Ga0466962_0006866
519 Ga0530510_0084113
520 Ga0530510_0696011

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6wkt-assembly1.cif.gz_A cu(i)-bound copper storage protein bscsp3 0.7918 54 140
4zsv-assembly1.cif.gz_A structure of a fusion protein with a helix linker, 2arh-3-3kaw-1.0 0.7501 4 139
3lmf-assembly1.cif.gz_A crystal structure of nmul_a1745 protein from nitrosospira multiformis, northeast structural genomics consortium target nmr72 0.7214 49 144
4zsz-assembly1.cif.gz_A structure of a fusion protein with a helix linker, 2arh-3-3kaw-3.0 0.6998 4 136
3kav-assembly1.cif.gz_A crystal structure of the mutant (l80m) pa2107 protein from pseudomonas aeruginosa, northeast structural genomics consortium target par198 0.6904 8 139
ID Description Score Start End Superfamily
3kawD00 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2; 0.7612 8 137 1.20.1270.360
af_P9WIR9_8_170_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.7541 2 152 1.20.140.150
3kawD00 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2; 0.7026 8 137 1.20.1270.360
af_Q4QQS9_255_369_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.701 7 136 1.20.140.150
af_I1JL94_100_204_1.20.58.120 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;BAG domain 0.6985 56 143 1.20.58.120
ID Description Score Start End GO Terms
AF-A0A2W5Z6L1-F1-model_v4 DUF1648 domain-containing protein 0.9358 4 153 GO:0016020
AF-A0A538KG73-F1-model_v4 Transmembrane protein 0.9085 1 139 GO:0016020
AF-A0A2W5Z6L1-F1-model_v4 DUF1648 domain-containing protein 0.9061 4 153 GO:0016020
AF-A0A7W1RSG0-F1-model_v4 Uncharacterized protein 0.897 1 152 GO:0016020
AF-A0A7V9CCE4-F1-model_v4 Uncharacterized protein 0.8965 1 153 GO:0016020

Map