F369369

General Info

Members Datasets Scaffolds Average Seq Length
260 193 520 247

Family's Representative Sequence

Representative Sequence 3300005440|Ga0070705_100307202|Ga0070705_1003072022
Length 279
Sequence VVSDRKKSTFAVDAATRADKVVADHDSCLVIDLGFIGYAEAFALQQHLVAARKAGAIEDVLLVCEHPHVITMGRNGKREHLLASDRVLQQKNVEFHPTDRGGDVTYHGPGQIVGYPILNLAGIRRDVGWYVRMLEETMIRASADFGITAGREPGKTGIWVAPAGSANSASSEATSSSIGAPEKLGAIGVHLSRWVTSHGFAYNVSTDLRYFDLIVPCGIADRRVTSLEKILSRRVDRTEAVSRLVTYFVEIFGLAARTITQGELFERLKHGEQPVAVTA

Samples

Sample ID Description Type Environment
1 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
2 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
46 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
47 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
48 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
51 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
52 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
53 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
56 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
111 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
112 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
113 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
114 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
115 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
116 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
117 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
118 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
119 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
120 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
121 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
122 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
123 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
124 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
125 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
126 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
127 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
128 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
129 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
130 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
131 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
132 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
133 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
134 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
135 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
136 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
137 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
138 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
139 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
140 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
141 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
142 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
143 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
144 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
145 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
146 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
147 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
148 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
149 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
150 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
151 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
152 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
153 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
154 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
155 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
156 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
157 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
158 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
159 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
160 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
161 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
162 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
163 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
164 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
165 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
166 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
167 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
168 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
169 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
170 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
171 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
172 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
173 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
174 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
175 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
176 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
177 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
178 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
179 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
180 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
181 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
182 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
183 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
184 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
185 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
186 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
187 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
188 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
189 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
190 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
191 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
192 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
193 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.31
Metatranscriptomes 2.69
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.15
Nodule 0
Rhizoplane 3.46
Rhizosphere 95
Stem 0
Stem Tuber 0
Unclassified 3.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070705_100307202 3300005440 Bacteria 1139
2 Ga0055542_1010801 3300003762 Bacteria 1651
3 Ga0070658_10143894 3300005327 Bacteria 1993
4 Ga0070683_100002431 3300005329 Bacteria 14807
5 Ga0070683_100124683 3300005329 Bacteria 2434
6 Ga0070670_100139289 3300005331 Bacteria 2098
7 Ga0070680_100048933 3300005336 Bacteria 3446
8 Ga0068868_100122204 3300005338 Bacteria 2125
9 Ga0070660_100903764 3300005339 Bacteria 744
10 Ga0070661_100012196 3300005344 Bacteria 6009
11 Ga0070661_100300682 3300005344 Bacteria 1249
12 Ga0070675_100003956 3300005354 Bacteria 11235
13 Ga0070671_100031385 3300005355 Bacteria 4388
14 Ga0070674_100135599 3300005356 Bacteria 1840
15 Ga0070674_100179267 3300005356 Bacteria 1621
16 Ga0070659_100067748 3300005366 Bacteria 2831
17 Ga0070667_100554998 3300005367 Bacteria 1056
18 Ga0070709_10143315 3300005434 Bacteria 1644
19 Ga0070709_10308713 3300005434 Bacteria 1157
20 Ga0070714_100032293 3300005435 Bacteria 4369
21 Ga0070714_100649107 3300005435 Bacteria 1016
22 Ga0070713_100012835 3300005436 Bacteria 6162
23 Ga0070713_100088336 3300005436 Bacteria 2660
24 Ga0070713_100157775 3300005436 Bacteria 2023
25 Ga0070710_10033975 3300005437 Bacteria 2772
26 Ga0070710_10066709 3300005437 Bacteria 2063
27 Ga0070708_100317149 3300005445 Bacteria 1468
28 Ga0070678_100176949 3300005456 Bacteria 1743
29 Ga0070662_100020987 3300005457 Bacteria 4456
30 Ga0070681_10002235 3300005458 Bacteria 17648
31 Ga0070706_100051688 3300005467 Bacteria 3793
32 Ga0070707_100005858 3300005468 Bacteria 11459
33 Ga0070707_100012993 3300005468 Bacteria 7780
34 Ga0070707_100199124 3300005468 Bacteria 1952
35 Ga0070698_100018672 3300005471 Bacteria 7299
36 Ga0070699_100052659 3300005518 Bacteria 3521
37 Ga0070699_100054214 3300005518 Bacteria 3471
38 Ga0070699_100491565 3300005518 Bacteria 1114
39 Ga0070679_100017640 3300005530 Bacteria 6910
40 Ga0070684_100025506 3300005535 Bacteria 4971
41 Ga0070697_100010481 3300005536 Bacteria 7235
42 Ga0070697_100083285 3300005536 Bacteria 2638
43 Ga0070672_100032991 3300005543 Bacteria 3916
44 Ga0070686_100029855 3300005544 Bacteria 3321
45 Ga0070695_100082064 3300005545 Bacteria 2134
46 Ga0070693_100017090 3300005547 Bacteria 3765
47 Ga0070665_100000153 3300005548 Bacteria 126011
48 Ga0068855_100417735 3300005563 Bacteria 1467
49 Ga0070664_100009347 3300005564 Bacteria 7947
50 Ga0070664_100034190 3300005564 Bacteria 4263
51 Ga0070664_100099721 3300005564 Bacteria 2524
52 Ga0070664_100160653 3300005564 Bacteria 1988
53 Ga0068857_100101617 3300005577 Bacteria 2580
54 Ga0068854_100026404 3300005578 Bacteria 3992
55 Ga0068852_100235842 3300005616 Bacteria 1746
56 Ga0068859_100261447 3300005617 Bacteria 1822
57 Ga0068864_100030958 3300005618 Bacteria 4537
58 Ga0068866_10060653 3300005718 Bacteria 1962
59 Ga0068866_10271631 3300005718 Bacteria 1047
60 Ga0068860_100014534 3300005843 Bacteria 7703
61 Ga0068862_100111552 3300005844 Bacteria 2401
62 Ga0081539_10000019 3300005985 Bacteria 369381
63 Ga0070717_10125210 3300006028 Bacteria 2205
64 Ga0070716_100081974 3300006173 Bacteria 1928
65 Ga0070712_100018888 3300006175 Bacteria 4486
66 Ga0070712_100122463 3300006175 Bacteria 1959
67 Ga0075428_100064295 3300006844 Bacteria 4018
68 Ga0075428_100109928 3300006844 Bacteria 3003
69 Ga0075428_100151803 3300006844 Bacteria 2517
70 Ga0075430_100580660 3300006846 Bacteria 925
71 Ga0075431_100087552 3300006847 Bacteria 3214
72 Ga0075431_100443035 3300006847 Bacteria 1295
73 Ga0075433_10034157 3300006852 Bacteria 4366
74 Ga0075429_100217477 3300006880 Bacteria 1674
75 Ga0097620_100261443 3300006931 Bacteria 1822
76 Ga0099794_10011771 3300007265 Bacteria 3756
77 Ga0099794_10013554 3300007265 Unclassified 3551
78 Ga0099794_10018234 3300007265 Bacteria 3144
79 Ga0099794_10054396 3300007265 Bacteria 1932
80 Ga0099794_10093281 3300007265 Bacteria 1496
81 Ga0099795_10005894 3300007788 Bacteria 3300
82 Ga0105240_10067969 3300009093 Bacteria 4415
83 Ga0111539_10050493 3300009094 Bacteria 4955
84 Ga0114129_10034622 3300009147 Bacteria 7134
85 Ga0114129_10438882 3300009147 Bacteria 1714
86 Ga0105241_10265571 3300009174 Bacteria 1460
87 Ga0105241_10610793 3300009174 Bacteria 986
88 Ga0105242_10012279 3300009176 Bacteria 6593
89 Ga0105248_10032411 3300009177 Bacteria 5840
90 Ga0105248_10091646 3300009177 Bacteria 3423
91 Ga0105238_10243587 3300009551 Bacteria 1776
92 Ga0105238_10642528 3300009551 Bacteria 1071
93 Ga0157370_10093851 3300013104 Bacteria 2816
94 Ga0157370_10103429 3300013104 Bacteria 2666
95 Ga0157369_10023446 3300013105 Bacteria 6873
96 Ga0157369_10616055 3300013105 Bacteria 1120
97 Ga0157378_10002512 3300013297 Bacteria 16328
98 Ga0157378_10107485 3300013297 Bacteria 2553
99 Ga0157372_10101799 3300013307 Bacteria 3280
100 Ga0157372_10364634 3300013307 Bacteria 1683
101 Ga0157372_10387224 3300013307 Bacteria 1629
102 Ga0157375_10063340 3300013308 Bacteria 3678
103 Ga0163163_10000841 3300014325 Bacteria 26081
104 Ga0206349_1270492 3300020075 Bacteria 2238
105 Ga0206352_10733528 3300020078 Bacteria 2209
106 Ga0206350_11410696 3300020080 Bacteria 2584
107 Ga0206354_10432043 3300020081 Bacteria 1983
108 Ga0224712_10001037 3300022467 Bacteria 6097
109 Ga0209258_100293 3300025242 Bacteria 82199
110 Ga0209148_1000278 3300025254 Bacteria 79641
111 Ga0207656_10057539 3300025321 Bacteria 1696
112 Ga0207692_10054953 3300025898 Bacteria 2036
113 Ga0207642_10042918 3300025899 Unclassified 1991
114 Ga0207680_10048626 3300025903 Bacteria 2521
115 Ga0207699_10017183 3300025906 Bacteria 3801
116 Ga0207699_10090305 3300025906 Bacteria 1922
117 Ga0207699_10107467 3300025906 Bacteria 1782
118 Ga0207684_10015254 3300025910 Bacteria 6618
119 Ga0207654_10178705 3300025911 Bacteria 1383
120 Ga0207707_10015025 3300025912 Bacteria 6741
121 Ga0207695_10000095 3300025913 Bacteria 265435
122 Ga0207693_10011695 3300025915 Bacteria 7101
123 Ga0207693_10179924 3300025915 Bacteria 1664
124 Ga0207657_10752736 3300025919 Bacteria 755
125 Ga0207652_10032277 3300025921 Bacteria 4400
126 Ga0207646_10000152 3300025922 Bacteria 95335
127 Ga0207646_10005745 3300025922 Bacteria 13005
128 Ga0207694_10046804 3300025924 Bacteria 3344
129 Ga0207659_10021799 3300025926 Bacteria 4260
130 Ga0207700_10082501 3300025928 Bacteria 2514
131 Ga0207700_10334536 3300025928 Bacteria 1315
132 Ga0207664_10138142 3300025929 Bacteria 2058
133 Ga0207644_10324946 3300025931 Bacteria 1245
134 Ga0207690_10186482 3300025932 Bacteria 1566
135 Ga0207665_10076772 3300025939 Unclassified 2292
136 Ga0207665_10218237 3300025939 Unclassified 1396
137 Ga0207691_10004867 3300025940 Bacteria 12986
138 Ga0207711_10050455 3300025941 Bacteria 3562
139 Ga0207711_10624807 3300025941 Bacteria 1005
140 Ga0207689_10135632 3300025942 Bacteria 2026
141 Ga0207661_10004285 3300025944 Bacteria 9990
142 Ga0207661_10036130 3300025944 Bacteria 3855
143 Ga0207661_10113569 3300025944 Bacteria 2295
144 Ga0207679_10005972 3300025945 Bacteria 7660
145 Ga0207679_10023850 3300025945 Bacteria 4189
146 Ga0207679_10141754 3300025945 Bacteria 1944
147 Ga0207651_10185278 3300025960 Bacteria 1655
148 Ga0207648_10036792 3300026089 Bacteria 4312
149 Ga0207648_10094504 3300026089 Bacteria 2614
150 Ga0207676_10072287 3300026095 Bacteria 2772
151 Ga0207674_10003558 3300026116 Bacteria 19004
152 Ga0209970_1008396 3300027614 Bacteria 1694
153 Ga0209588_1001949 3300027671 Bacteria 5530
154 Ga0209588_1006142 3300027671 Bacteria 3476
155 Ga0209588_1028304 3300027671 Bacteria 1783
156 Ga0268266_10002672 3300028379 Bacteria 18755
157 Ga0268264_10013666 3300028381 Bacteria 6682
158 Ga0265319_1000871 3300028563 Bacteria 19197
159 Ga0265318_10001719 3300028577 Bacteria 12531
160 Ga0265338_10043878 3300028800 Bacteria 4139
161 Ga0265760_10003846 3300031090 Bacteria 4351
162 Ga0265760_10034891 3300031090 Bacteria 1488
163 Ga0265332_10063264 3300031238 Bacteria 1581
164 Ga0265328_10055691 3300031239 Unclassified 1451
165 Ga0265320_10000105 3300031240 Bacteria 72088
166 Ga0265325_10006929 3300031241 Bacteria 6840
167 Ga0265329_10000639 3300031242 Bacteria 17864
168 Ga0265340_10014805 3300031247 Bacteria 4065
169 Ga0265339_10229211 3300031249 Bacteria 906
170 Ga0265331_10000189 3300031250 Bacteria 75772
171 Ga0265331_10004285 3300031250 Bacteria 8937
172 Ga0265316_10003253 3300031344 Bacteria 16505
173 Ga0265316_10008656 3300031344 Bacteria 9421
174 Ga0265313_10028660 3300031595 Bacteria 2890
175 Ga0265314_10012752 3300031711 Bacteria 6831
176 Ga0265314_10057184 3300031711 Unclassified 2681
177 Ga0265342_10001696 3300031712 Bacteria 20205
178 Ga0307412_10594650 3300031911 Bacteria 936
179 Ga0316212_1011975 3300033547 Bacteria 1238
180 Ga0373926_0006387 3300035083 Bacteria 3917
181 Ga0373934_0002893 3300035086 Bacteria 6278
182 Ga0373944_0002399 3300035089 Bacteria 4769
183 Ga0373954_0000146 3300035118 Bacteria 24867
184 Ga0373956_0000805 3300035119 Bacteria 13044
185 Ga0373957_0133816 3300035120 Bacteria 1010
186 Ga0373943_0000986 3300035170 Bacteria 12635
187 Ga0373943_0068058 3300035170 Unclassified 1797
188 Ga0373955_0001163 3300035172 Bacteria 11163
189 Ga0373935_0000703 3300035692 Bacteria 17772
190 Ga0373927_0006629 3300035695 Bacteria 7886
191 Ga0373933_0000789 3300035724 Bacteria 19348
192 Ga0373947_0000375 3300035725 Bacteria 25325
193 Ga0373937_0000082 3300036401 Bacteria 87971
194 Ga0373925_0001319 3300037068 Bacteria 21717
195 Ga0373925_0089657 3300037068 Bacteria 2350
196 Ga0451577_0068242 3300042876 Bacteria 3171
197 Ga0451577_0176044 3300042876 Bacteria 1928
198 Ga0453683_0003038 3300044673 Bacteria 12560
199 Ga0453683_0012551 3300044673 Bacteria 5549
200 Ga0453683_0061502 3300044673 Bacteria 2348
201 Ga0453683_0124568 3300044673 Bacteria 1622
202 Ga0451576_0088926 3300045051 Bacteria 3212
203 Ga0495603_0013722 3300046455 Bacteria 4902
204 Ga0495603_0083333 3300046455 Bacteria 1873
205 Ga0495629_0004133 3300046459 Bacteria 10888
206 Ga0495651_0041545 3300046462 Bacteria 3572
207 Ga0495653_0163624 3300046463 Unclassified 1543
208 Ga0495580_0000178 3300046472 Bacteria 47631
209 Ga0495580_0002316 3300046472 Bacteria 16607
210 Ga0495582_0001551 3300046473 Bacteria 12955
211 Ga0495582_0003767 3300046473 Bacteria 8546
212 Ga0495639_0000327 3300046475 Bacteria 22890
213 Ga0495664_0049640 3300046477 Bacteria 2491
214 Ga0495608_0015305 3300046511 Bacteria 5322
215 Ga0495608_0017983 3300046511 Bacteria 4883
216 Ga0495628_0045606 3300046516 Bacteria 3484
217 Ga0495630_0003102 3300046517 Bacteria 11520
218 Ga0495665_0000018 3300046531 Bacteria 62843
219 Ga0495587_0000670 3300046536 Bacteria 22971
220 Ga0495645_0055033 3300046543 Bacteria 2890
221 Ga0495667_0018710 3300046559 Bacteria 4677
222 Ga0495635_0243567 3300046663 Bacteria 1213
223 Ga0495588_0003655 3300046674 Bacteria 6728
224 Ga0495657_0051171 3300046675 Bacteria 2774
225 Ga0495657_0264161 3300046675 Bacteria 1033
226 Ga0495623_0108572 3300046679 Bacteria 1684
227 Ga0495658_0000100 3300046683 Bacteria 45016
228 Ga0495613_0202482 3300046689 Bacteria 1399
229 Ga0495600_0291275 3300046809 Bacteria 1031
230 Ga0495581_0000398 3300047315 Bacteria 21794
231 Ga0495604_0002255 3300047317 Bacteria 15444
232 Ga0495684_0016520 3300047471 Bacteria 5684
233 Ga0495684_0094643 3300047471 Bacteria 2262
234 Ga0495593_0000056 3300047673 Bacteria 47474
235 Ga0495602_0001230 3300048088 Bacteria 25201
236 Ga0495614_0000019 3300048089 Bacteria 49609
237 Ga0496100_0462219 3300048903 Bacteria 974
238 Ga0496102_0002788 3300048905 Bacteria 14899
239 Ga0496103_0094569 3300048906 Bacteria 1888
240 Ga0496104_0181808 3300048907 Bacteria 2013
241 Ga0496105_0055559 3300048908 Bacteria 3269
242 Ga0496107_0123890 3300048910 Bacteria 1905
243 Ga0496109_0215615 3300048912 Bacteria 1805
244 Ga0496112_0154001 3300048915 Bacteria 2266
245 Ga0496115_0172934 3300048918 Bacteria 1786
246 Ga0501225_0035243 3300049705 Bacteria 1378
247 Ga0501081_0502247 3300049743 Bacteria 904
248 Ga0501283_014691 3300049779 Bacteria 1199
249 nmdc:mga05p37_22156_c1 3300050507 Bacteria 7701
250 nmdc:mga05p37_66035_c1 3300050507 Bacteria 4451
251 nmdc:mga0qj67_50766_c1 3300050509 Bacteria 3280
252 nmdc:mga0qj67_596708_c1 3300050509 Bacteria 883
253 nmdc:mga06r32_152884_c1 3300050510 Bacteria 2287
254 nmdc:mga06r32_461747_c1 3300050510 Bacteria 1249
255 nmdc:mga08y16_148690_c1 3300050511 Bacteria 2435
256 nmdc:mga0n895_11046_c1 3300050512 Bacteria 8031
257 nmdc:mga0rr50_3805_c1 3300050513 Bacteria 8764
258 nmdc:mga0a205_6167_c1 3300050515 Bacteria 10818
259 Ga0495601_0354689 3300053077 Bacteria 953
260 Ga0495619_0066784 3300053085 Bacteria 2400
261 Ga0070705_100307202
262 Ga0055542_1010801
263 Ga0070658_10143894
264 Ga0070683_100002431
265 Ga0070683_100124683
266 Ga0070670_100139289
267 Ga0070680_100048933
268 Ga0068868_100122204
269 Ga0070660_100903764
270 Ga0070661_100012196
271 Ga0070661_100300682
272 Ga0070675_100003956
273 Ga0070671_100031385
274 Ga0070674_100135599
275 Ga0070674_100179267
276 Ga0070659_100067748
277 Ga0070667_100554998
278 Ga0070709_10143315
279 Ga0070709_10308713
280 Ga0070714_100032293
281 Ga0070714_100649107
282 Ga0070713_100012835
283 Ga0070713_100088336
284 Ga0070713_100157775
285 Ga0070710_10033975
286 Ga0070710_10066709
287 Ga0070708_100317149
288 Ga0070678_100176949
289 Ga0070662_100020987
290 Ga0070681_10002235
291 Ga0070706_100051688
292 Ga0070707_100005858
293 Ga0070707_100012993
294 Ga0070707_100199124
295 Ga0070698_100018672
296 Ga0070699_100052659
297 Ga0070699_100054214
298 Ga0070699_100491565
299 Ga0070679_100017640
300 Ga0070684_100025506
301 Ga0070697_100010481
302 Ga0070697_100083285
303 Ga0070672_100032991
304 Ga0070686_100029855
305 Ga0070695_100082064
306 Ga0070693_100017090
307 Ga0070665_100000153
308 Ga0068855_100417735
309 Ga0070664_100009347
310 Ga0070664_100034190
311 Ga0070664_100099721
312 Ga0070664_100160653
313 Ga0068857_100101617
314 Ga0068854_100026404
315 Ga0068852_100235842
316 Ga0068859_100261447
317 Ga0068864_100030958
318 Ga0068866_10060653
319 Ga0068866_10271631
320 Ga0068860_100014534
321 Ga0068862_100111552
322 Ga0081539_10000019
323 Ga0070717_10125210
324 Ga0070716_100081974
325 Ga0070712_100018888
326 Ga0070712_100122463
327 Ga0075428_100064295
328 Ga0075428_100109928
329 Ga0075428_100151803
330 Ga0075430_100580660
331 Ga0075431_100087552
332 Ga0075431_100443035
333 Ga0075433_10034157
334 Ga0075429_100217477
335 Ga0097620_100261443
336 Ga0099794_10011771
337 Ga0099794_10013554
338 Ga0099794_10018234
339 Ga0099794_10054396
340 Ga0099794_10093281
341 Ga0099795_10005894
342 Ga0105240_10067969
343 Ga0111539_10050493
344 Ga0114129_10034622
345 Ga0114129_10438882
346 Ga0105241_10265571
347 Ga0105241_10610793
348 Ga0105242_10012279
349 Ga0105248_10032411
350 Ga0105248_10091646
351 Ga0105238_10243587
352 Ga0105238_10642528
353 Ga0157370_10093851
354 Ga0157370_10103429
355 Ga0157369_10023446
356 Ga0157369_10616055
357 Ga0157378_10002512
358 Ga0157378_10107485
359 Ga0157372_10101799
360 Ga0157372_10364634
361 Ga0157372_10387224
362 Ga0157375_10063340
363 Ga0163163_10000841
364 Ga0206349_1270492
365 Ga0206352_10733528
366 Ga0206350_11410696
367 Ga0206354_10432043
368 Ga0224712_10001037
369 Ga0209258_100293
370 Ga0209148_1000278
371 Ga0207656_10057539
372 Ga0207692_10054953
373 Ga0207642_10042918
374 Ga0207680_10048626
375 Ga0207699_10017183
376 Ga0207699_10090305
377 Ga0207699_10107467
378 Ga0207684_10015254
379 Ga0207654_10178705
380 Ga0207707_10015025
381 Ga0207695_10000095
382 Ga0207693_10011695
383 Ga0207693_10179924
384 Ga0207657_10752736
385 Ga0207652_10032277
386 Ga0207646_10000152
387 Ga0207646_10005745
388 Ga0207694_10046804
389 Ga0207659_10021799
390 Ga0207700_10082501
391 Ga0207700_10334536
392 Ga0207664_10138142
393 Ga0207644_10324946
394 Ga0207690_10186482
395 Ga0207665_10076772
396 Ga0207665_10218237
397 Ga0207691_10004867
398 Ga0207711_10050455
399 Ga0207711_10624807
400 Ga0207689_10135632
401 Ga0207661_10004285
402 Ga0207661_10036130
403 Ga0207661_10113569
404 Ga0207679_10005972
405 Ga0207679_10023850
406 Ga0207679_10141754
407 Ga0207651_10185278
408 Ga0207648_10036792
409 Ga0207648_10094504
410 Ga0207676_10072287
411 Ga0207674_10003558
412 Ga0209970_1008396
413 Ga0209588_1001949
414 Ga0209588_1006142
415 Ga0209588_1028304
416 Ga0268266_10002672
417 Ga0268264_10013666
418 Ga0265319_1000871
419 Ga0265318_10001719
420 Ga0265338_10043878
421 Ga0265760_10003846
422 Ga0265760_10034891
423 Ga0265332_10063264
424 Ga0265328_10055691
425 Ga0265320_10000105
426 Ga0265325_10006929
427 Ga0265329_10000639
428 Ga0265340_10014805
429 Ga0265339_10229211
430 Ga0265331_10000189
431 Ga0265331_10004285
432 Ga0265316_10003253
433 Ga0265316_10008656
434 Ga0265313_10028660
435 Ga0265314_10012752
436 Ga0265314_10057184
437 Ga0265342_10001696
438 Ga0307412_10594650
439 Ga0316212_1011975
440 Ga0373926_0006387
441 Ga0373934_0002893
442 Ga0373944_0002399
443 Ga0373954_0000146
444 Ga0373956_0000805
445 Ga0373957_0133816
446 Ga0373943_0000986
447 Ga0373943_0068058
448 Ga0373955_0001163
449 Ga0373935_0000703
450 Ga0373927_0006629
451 Ga0373933_0000789
452 Ga0373947_0000375
453 Ga0373937_0000082
454 Ga0373925_0001319
455 Ga0373925_0089657
456 Ga0451577_0068242
457 Ga0451577_0176044
458 Ga0453683_0003038
459 Ga0453683_0012551
460 Ga0453683_0061502
461 Ga0453683_0124568
462 Ga0451576_0088926
463 Ga0495603_0013722
464 Ga0495603_0083333
465 Ga0495629_0004133
466 Ga0495651_0041545
467 Ga0495653_0163624
468 Ga0495580_0000178
469 Ga0495580_0002316
470 Ga0495582_0001551
471 Ga0495582_0003767
472 Ga0495639_0000327
473 Ga0495664_0049640
474 Ga0495608_0015305
475 Ga0495608_0017983
476 Ga0495628_0045606
477 Ga0495630_0003102
478 Ga0495665_0000018
479 Ga0495587_0000670
480 Ga0495645_0055033
481 Ga0495667_0018710
482 Ga0495635_0243567
483 Ga0495588_0003655
484 Ga0495657_0051171
485 Ga0495657_0264161
486 Ga0495623_0108572
487 Ga0495658_0000100
488 Ga0495613_0202482
489 Ga0495600_0291275
490 Ga0495581_0000398
491 Ga0495604_0002255
492 Ga0495684_0016520
493 Ga0495684_0094643
494 Ga0495593_0000056
495 Ga0495602_0001230
496 Ga0495614_0000019
497 Ga0496100_0462219
498 Ga0496102_0002788
499 Ga0496103_0094569
500 Ga0496104_0181808
501 Ga0496105_0055559
502 Ga0496107_0123890
503 Ga0496109_0215615
504 Ga0496112_0154001
505 Ga0496115_0172934
506 Ga0501225_0035243
507 Ga0501081_0502247
508 Ga0501283_014691
509 nmdc:mga05p37_22156_c1
510 nmdc:mga05p37_66035_c1
511 nmdc:mga0qj67_50766_c1
512 nmdc:mga0qj67_596708_c1
513 nmdc:mga06r32_152884_c1
514 nmdc:mga06r32_461747_c1
515 nmdc:mga08y16_148690_c1
516 nmdc:mga0n895_11046_c1
517 nmdc:mga0rr50_3805_c1
518 nmdc:mga0a205_6167_c1
519 Ga0495601_0354689
520 Ga0495619_0066784

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF21948

LplA-B_cat

Lipoyl protein ligase A/B catalytic domain

37

249

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qhv-assembly1.cif.gz_A structural basis of octanoic acid recognition by lipoate-protein ligase b 0.9442 4 233
2qhv-assembly1.cif.gz_A structural basis of octanoic acid recognition by lipoate-protein ligase b 0.9355 4 233
1w66-assembly1.cif.gz_A structure of a lipoate-protein ligase b from mycobacterium tuberculosis 0.9188 5 230
1w66-assembly1.cif.gz_A structure of a lipoate-protein ligase b from mycobacterium tuberculosis 0.8539 5 230
2p0l-assembly1.cif.gz_A crystal structure of a lipoate-protein ligase a 0.7511 2 234
ID Description Score Start End Superfamily
af_P60720_2_203_3.30.930.10 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.9447 1 227 3.30.930.10
2qhuA01 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.9431 5 229 3.30.930.10
af_P60720_2_203_3.30.930.10 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.9355 1 227 3.30.930.10
af_O36017_5_216_3.30.930.10 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.9326 12 227 3.30.930.10
1w66A01 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.9311 5 227 3.30.930.10
ID Description Score Start End GO Terms
AF-A0A0E2LNW2-F1-model_v4 Octanoyltransferase (EC 2.3.1.181) (Lipoate-protein ligase B) (Lipoyl/octanoyl transferase) (Octanoyl-[acyl-carrier-protein]-protein N-octanoyltransferase) 0.9913 5 229 GO:0005737
GO:0033819
AF-A0A840D220-F1-model_v4 Octanoyltransferase (EC 2.3.1.181) (Lipoate-protein ligase B) (Lipoyl/octanoyl transferase) (Octanoyl-[acyl-carrier-protein]-protein N-octanoyltransferase) 0.9911 7 229 GO:0005737
GO:0033819
AF-A0A3M1ABT8-F1-model_v4 lipoyl(octanoyl) transferase (EC 2.3.1.181) 0.9902 59 231 GO:0033819
AF-A0A522R7W3-F1-model_v4 Octanoyltransferase (EC 2.3.1.181) (Lipoate-protein ligase B) (Lipoyl/octanoyl transferase) (Octanoyl-[acyl-carrier-protein]-protein N-octanoyltransferase) 0.9884 3 234 GO:0005737
GO:0033819
AF-A0A1I1Y1W9-F1-model_v4 Octanoyltransferase (EC 2.3.1.181) (Lipoate-protein ligase B) (Lipoyl/octanoyl transferase) (Octanoyl-[acyl-carrier-protein]-protein N-octanoyltransferase) 0.987 1 235 GO:0005737
GO:0033819

Map