F369366
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 260 | 199 | 260 | 134 |
Family's Representative Sequence
| Representative Sequence | 3300005439|Ga0070711_100653827|Ga0070711_1006538272 |
| Length | 153 |
| Sequence | VVAAQIGARPATAATAMVIARALLEDLVAHAREEYDAECCGVIAYAPTDDGLAPEAVRVHRARNVFASPKRFEIDGKELLGAIEQFEDEGWDLGAIYHSHTHTEPYPSQTDINFAANWPGLEWVIVGLAGEEPDVRCYLIEDGAVRALELEVR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 2 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 3 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 7 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 9 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 12 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 38 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 39 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 41 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 42 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 43 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 44 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 45 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 46 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 47 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 48 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 49 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 54 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 55 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 56 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 57 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 59 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 80 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 85 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 86 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 87 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 128 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 132 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 133 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 134 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 135 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 136 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 137 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 138 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 139 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 140 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 141 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 142 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 143 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 144 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 145 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 146 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 147 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 148 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 149 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 150 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 151 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 152 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 153 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 154 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 155 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 156 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 157 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 158 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 159 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 177 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 178 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 179 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 180 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 181 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 182 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 183 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 184 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 185 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 186 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 187 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 188 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 189 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 190 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 191 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 192 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 193 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 194 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 195 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 196 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.08 |
| Metatranscriptomes | 1.92 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 9.23 |
| Rhizosphere | 90.38 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.38 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24745J21846_1034542 | 3300002073 | Bacteria | 616 |
| 2 | JGI24744J21845_10045551 | 3300002077 | Bacteria | 814 |
| 3 | rootH1_10180553 | 3300003323 | Bacteria | 1291 |
| 4 | Ga0070683_100407141 | 3300005329 | Bacteria | 1297 |
| 5 | Ga0070683_100662272 | 3300005329 | Bacteria | 1000 |
| 6 | Ga0070690_100404950 | 3300005330 | Bacteria | 1003 |
| 7 | Ga0068869_100090816 | 3300005334 | Bacteria | 2296 |
| 8 | Ga0070689_100062254 | 3300005340 | Bacteria | 2903 |
| 9 | Ga0070691_10208774 | 3300005341 | Bacteria | 1029 |
| 10 | Ga0070687_100044085 | 3300005343 | Bacteria | 2270 |
| 11 | Ga0070661_100218947 | 3300005344 | Bacteria | 1460 |
| 12 | Ga0070692_10192394 | 3300005345 | Bacteria | 1189 |
| 13 | Ga0070668_100319432 | 3300005347 | Bacteria | 1307 |
| 14 | Ga0070669_100561123 | 3300005353 | Bacteria | 953 |
| 15 | Ga0070669_100618031 | 3300005353 | Bacteria | 909 |
| 16 | Ga0070674_100180627 | 3300005356 | Bacteria | 1616 |
| 17 | Ga0070688_101395854 | 3300005365 | Bacteria | 568 |
| 18 | Ga0070659_100062914 | 3300005366 | Bacteria | 2934 |
| 19 | Ga0070667_100083799 | 3300005367 | Bacteria | 2732 |
| 20 | Ga0070667_101638938 | 3300005367 | Bacteria | 605 |
| 21 | Ga0070709_10545685 | 3300005434 | Bacteria | 886 |
| 22 | Ga0070714_101178399 | 3300005435 | Bacteria | 747 |
| 23 | Ga0070713_100240989 | 3300005436 | Bacteria | 1647 |
| 24 | Ga0070710_10226808 | 3300005437 | Bacteria | 1191 |
| 25 | Ga0070711_100001500 | 3300005439 | Bacteria | 12830 |
| 26 | Ga0070711_100181399 | 3300005439 | Bacteria | 1612 |
| 27 | Ga0070711_100653827 | 3300005439 | Unclassified | 881 |
| 28 | Ga0070705_100082905 | 3300005440 | Bacteria | 1974 |
| 29 | Ga0070700_100187590 | 3300005441 | Bacteria | 1443 |
| 30 | Ga0070694_100451854 | 3300005444 | Bacteria | 1015 |
| 31 | Ga0070663_100076623 | 3300005455 | Bacteria | 2446 |
| 32 | Ga0070678_100044344 | 3300005456 | Bacteria | 3175 |
| 33 | Ga0070662_100166480 | 3300005457 | Bacteria | 1728 |
| 34 | Ga0070681_10507841 | 3300005458 | Bacteria | 1119 |
| 35 | Ga0070681_11080683 | 3300005458 | Bacteria | 723 |
| 36 | Ga0070681_11919895 | 3300005458 | Bacteria | 520 |
| 37 | Ga0070685_10024228 | 3300005466 | Bacteria | 3331 |
| 38 | Ga0070684_100047879 | 3300005535 | Bacteria | 3707 |
| 39 | Ga0070684_101995860 | 3300005535 | Bacteria | 548 |
| 40 | Ga0070686_100623026 | 3300005544 | Bacteria | 852 |
| 41 | Ga0070693_100268064 | 3300005547 | Bacteria | 1139 |
| 42 | Ga0070665_100114028 | 3300005548 | Bacteria | 2705 |
| 43 | Ga0070665_100606131 | 3300005548 | Bacteria | 1108 |
| 44 | Ga0070704_100208328 | 3300005549 | Bacteria | 1583 |
| 45 | Ga0070664_100182320 | 3300005564 | Bacteria | 1867 |
| 46 | Ga0070664_100520653 | 3300005564 | Bacteria | 1098 |
| 47 | Ga0068854_100806650 | 3300005578 | Bacteria | 818 |
| 48 | Ga0068856_100205204 | 3300005614 | Bacteria | 1986 |
| 49 | Ga0070702_100140126 | 3300005615 | Bacteria | 1539 |
| 50 | Ga0070702_100322947 | 3300005615 | Bacteria | 1076 |
| 51 | Ga0068852_100185413 | 3300005616 | Bacteria | 1959 |
| 52 | Ga0068859_100043865 | 3300005617 | Bacteria | 4494 |
| 53 | Ga0068866_10854601 | 3300005718 | Bacteria | 637 |
| 54 | Ga0068861_100060435 | 3300005719 | Bacteria | 2904 |
| 55 | Ga0068861_100223907 | 3300005719 | Bacteria | 1591 |
| 56 | Ga0068861_100932427 | 3300005719 | Bacteria | 824 |
| 57 | Ga0068851_10045205 | 3300005834 | Bacteria | 2225 |
| 58 | Ga0068870_10155637 | 3300005840 | Bacteria | 1350 |
| 59 | Ga0068863_100218274 | 3300005841 | Bacteria | 1837 |
| 60 | Ga0068858_100125311 | 3300005842 | Bacteria | 2404 |
| 61 | Ga0068862_100409890 | 3300005844 | Bacteria | 1269 |
| 62 | Ga0070717_10610416 | 3300006028 | Bacteria | 990 |
| 63 | Ga0070717_10931590 | 3300006028 | Unclassified | 791 |
| 64 | Ga0070715_10182553 | 3300006163 | Bacteria | 1053 |
| 65 | Ga0070716_100809866 | 3300006173 | Bacteria | 726 |
| 66 | Ga0070712_100011732 | 3300006175 | Bacteria | 5566 |
| 67 | Ga0068871_100357704 | 3300006358 | Bacteria | 1293 |
| 68 | Ga0075428_102610461 | 3300006844 | Bacteria | 516 |
| 69 | Ga0075433_10954097 | 3300006852 | Bacteria | 748 |
| 70 | Ga0068865_100120543 | 3300006881 | Bacteria | 1950 |
| 71 | Ga0097620_100043865 | 3300006931 | Bacteria | 4494 |
| 72 | Ga0075435_101337538 | 3300007076 | Bacteria | 628 |
| 73 | Ga0105240_10046441 | 3300009093 | Bacteria | 5503 |
| 74 | Ga0111539_10322939 | 3300009094 | Bacteria | 1796 |
| 75 | Ga0111539_10520526 | 3300009094 | Bacteria | 1386 |
| 76 | Ga0105245_10082027 | 3300009098 | Bacteria | 2949 |
| 77 | Ga0105245_10157843 | 3300009098 | Bacteria | 2150 |
| 78 | Ga0105243_10068426 | 3300009148 | Bacteria | 2862 |
| 79 | Ga0105243_10088188 | 3300009148 | Bacteria | 2548 |
| 80 | Ga0105243_10608659 | 3300009148 | Bacteria | 1053 |
| 81 | Ga0105241_10142534 | 3300009174 | Bacteria | 1953 |
| 82 | Ga0105242_10137973 | 3300009176 | Bacteria | 2113 |
| 83 | Ga0105248_10958112 | 3300009177 | Bacteria | 966 |
| 84 | Ga0105237_10343335 | 3300009545 | Bacteria | 1497 |
| 85 | Ga0105237_12047809 | 3300009545 | Unclassified | 581 |
| 86 | Ga0105249_10066037 | 3300009553 | Bacteria | 3330 |
| 87 | Ga0105239_10125636 | 3300010375 | Bacteria | 2851 |
| 88 | Ga0105239_10213631 | 3300010375 | Bacteria | 2162 |
| 89 | Ga0105239_11225562 | 3300010375 | Bacteria | 865 |
| 90 | Ga0105246_10038192 | 3300011119 | Bacteria | 3226 |
| 91 | Ga0157371_10231443 | 3300013102 | Bacteria | 1328 |
| 92 | Ga0157369_12071124 | 3300013105 | Bacteria | 577 |
| 93 | Ga0157374_11124397 | 3300013296 | Bacteria | 806 |
| 94 | Ga0157378_10281713 | 3300013297 | Bacteria | 1602 |
| 95 | Ga0157378_11455243 | 3300013297 | Bacteria | 729 |
| 96 | Ga0163162_10043685 | 3300013306 | Bacteria | 4487 |
| 97 | Ga0163162_10593112 | 3300013306 | Bacteria | 1235 |
| 98 | Ga0157372_10440074 | 3300013307 | Bacteria | 1519 |
| 99 | Ga0157375_10357294 | 3300013308 | Bacteria | 1627 |
| 100 | Ga0157375_11610191 | 3300013308 | Bacteria | 768 |
| 101 | Ga0163163_10204835 | 3300014325 | Bacteria | 2021 |
| 102 | Ga0163163_10273630 | 3300014325 | Bacteria | 1740 |
| 103 | Ga0157380_10768542 | 3300014326 | Bacteria | 977 |
| 104 | Ga0182008_10129960 | 3300014497 | Bacteria | 1255 |
| 105 | Ga0157377_10034398 | 3300014745 | Bacteria | 2773 |
| 106 | Ga0157377_11115299 | 3300014745 | Bacteria | 605 |
| 107 | Ga0157379_10005656 | 3300014968 | Bacteria | 10742 |
| 108 | Ga0157379_10089872 | 3300014968 | Bacteria | 2755 |
| 109 | Ga0157376_10294415 | 3300014969 | Bacteria | 1534 |
| 110 | Ga0157376_10539588 | 3300014969 | Bacteria | 1152 |
| 111 | Ga0163161_10203905 | 3300017792 | Bacteria | 1525 |
| 112 | Ga0206350_10154106 | 3300020080 | Bacteria | 1640 |
| 113 | Ga0206354_10419973 | 3300020081 | Bacteria | 725 |
| 114 | Ga0206353_10253719 | 3300020082 | Bacteria | 694 |
| 115 | Ga0206353_10910689 | 3300020082 | Bacteria | 922 |
| 116 | Ga0207692_10015258 | 3300025898 | Bacteria | 3376 |
| 117 | Ga0207642_10064200 | 3300025899 | Bacteria | 1720 |
| 118 | Ga0207710_10068786 | 3300025900 | Bacteria | 1620 |
| 119 | Ga0207685_10159710 | 3300025905 | Bacteria | 1028 |
| 120 | Ga0207699_10428922 | 3300025906 | Bacteria | 945 |
| 121 | Ga0207643_10115416 | 3300025908 | Bacteria | 1586 |
| 122 | Ga0207654_10112381 | 3300025911 | Bacteria | 1697 |
| 123 | Ga0207707_11095195 | 3300025912 | Bacteria | 649 |
| 124 | Ga0207695_10014458 | 3300025913 | Bacteria | 9348 |
| 125 | Ga0207671_10328398 | 3300025914 | Bacteria | 1211 |
| 126 | Ga0207693_10027758 | 3300025915 | Bacteria | 4474 |
| 127 | Ga0207693_10053979 | 3300025915 | Bacteria | 3153 |
| 128 | Ga0207663_10001162 | 3300025916 | Bacteria | 12157 |
| 129 | Ga0207663_10149861 | 3300025916 | Bacteria | 1635 |
| 130 | Ga0207663_10220237 | 3300025916 | Bacteria | 1380 |
| 131 | Ga0207657_10047518 | 3300025919 | Bacteria | 3752 |
| 132 | Ga0207649_10937641 | 3300025920 | Bacteria | 680 |
| 133 | Ga0207687_10053372 | 3300025927 | Bacteria | 2824 |
| 134 | Ga0207687_10240421 | 3300025927 | Bacteria | 1435 |
| 135 | Ga0207644_10749197 | 3300025931 | Bacteria | 816 |
| 136 | Ga0207690_10200706 | 3300025932 | Bacteria | 1514 |
| 137 | Ga0207706_10120341 | 3300025933 | Bacteria | 2308 |
| 138 | Ga0207686_10083731 | 3300025934 | Bacteria | 2088 |
| 139 | Ga0207686_10545298 | 3300025934 | Bacteria | 906 |
| 140 | Ga0207709_10121467 | 3300025935 | Bacteria | 1764 |
| 141 | Ga0207670_10048526 | 3300025936 | Bacteria | 2834 |
| 142 | Ga0207669_10117629 | 3300025937 | Bacteria | 1797 |
| 143 | Ga0207704_11785636 | 3300025938 | Bacteria | 529 |
| 144 | Ga0207711_10596568 | 3300025941 | Bacteria | 1030 |
| 145 | Ga0207689_10398005 | 3300025942 | Bacteria | 1148 |
| 146 | Ga0207661_10634510 | 3300025944 | Bacteria | 981 |
| 147 | Ga0207667_10936252 | 3300025949 | Bacteria | 856 |
| 148 | Ga0207712_10086793 | 3300025961 | Bacteria | 2293 |
| 149 | Ga0207668_10101195 | 3300025972 | Bacteria | 2141 |
| 150 | Ga0207640_10188348 | 3300025981 | Bacteria | 1553 |
| 151 | Ga0207658_10962517 | 3300025986 | Bacteria | 778 |
| 152 | Ga0207677_10171864 | 3300026023 | Bacteria | 1695 |
| 153 | Ga0207678_10397007 | 3300026067 | Bacteria | 1194 |
| 154 | Ga0207708_10022857 | 3300026075 | Bacteria | 4722 |
| 155 | Ga0207702_10651916 | 3300026078 | Bacteria | 1035 |
| 156 | Ga0207641_10321712 | 3300026088 | Bacteria | 1467 |
| 157 | Ga0207648_10248206 | 3300026089 | Bacteria | 1586 |
| 158 | Ga0207676_10499895 | 3300026095 | Bacteria | 1154 |
| 159 | Ga0207674_10166683 | 3300026116 | Bacteria | 2157 |
| 160 | Ga0207675_100010350 | 3300026118 | Bacteria | 8741 |
| 161 | Ga0207675_100310136 | 3300026118 | Bacteria | 1539 |
| 162 | Ga0207675_101009770 | 3300026118 | Bacteria | 850 |
| 163 | Ga0207428_10374843 | 3300027907 | Bacteria | 1045 |
| 164 | Ga0268266_10573506 | 3300028379 | Bacteria | 1082 |
| 165 | Ga0268265_10201871 | 3300028380 | Bacteria | 1725 |
| 166 | Ga0268265_10317977 | 3300028380 | Bacteria | 1408 |
| 167 | Ga0268265_10339841 | 3300028380 | Bacteria | 1367 |
| 168 | Ga0268264_10356315 | 3300028381 | Bacteria | 1394 |
| 169 | Ga0265337_1001815 | 3300028556 | Bacteria | 10247 |
| 170 | Ga0265326_10001279 | 3300028558 | Bacteria | 8925 |
| 171 | Ga0265319_1000796 | 3300028563 | Bacteria | 20409 |
| 172 | Ga0265318_10000961 | 3300028577 | Bacteria | 18489 |
| 173 | Ga0265322_10007430 | 3300028654 | Bacteria | 3198 |
| 174 | Ga0265336_10000060 | 3300028666 | Bacteria | 103055 |
| 175 | Ga0265338_10000234 | 3300028800 | Bacteria | 103028 |
| 176 | Ga0265324_10007611 | 3300029957 | Bacteria | 4372 |
| 177 | Ga0265332_10337313 | 3300031238 | Bacteria | 622 |
| 178 | Ga0265320_10055930 | 3300031240 | Bacteria | 1898 |
| 179 | Ga0265340_10000014 | 3300031247 | Bacteria | 103055 |
| 180 | Ga0265327_10014680 | 3300031251 | Bacteria | 5110 |
| 181 | Ga0265316_10046033 | 3300031344 | Bacteria | 3460 |
| 182 | Ga0307405_10740766 | 3300031731 | Bacteria | 818 |
| 183 | Ga0307406_10180856 | 3300031901 | Bacteria | 1535 |
| 184 | Ga0307406_10421872 | 3300031901 | Bacteria | 1063 |
| 185 | Ga0307406_10511979 | 3300031901 | Bacteria | 975 |
| 186 | Ga0307416_103683404 | 3300032002 | Unclassified | 513 |
| 187 | Ga0307415_100250720 | 3300032126 | Bacteria | 1438 |
| 188 | Ga0307415_101405223 | 3300032126 | Bacteria | 665 |
| 189 | Ga0373935_0395524 | 3300035692 | Bacteria | 992 |
| 190 | Ga0373925_0055658 | 3300037068 | Bacteria | 2962 |
| 191 | Ga0395900_0058250 | 3300037418 | Bacteria | 3977 |
| 192 | Ga0395900_0151175 | 3300037418 | Bacteria | 2372 |
| 193 | Ga0395905_1426011 | 3300037471 | Bacteria | 597 |
| 194 | Ga0395901_0139212 | 3300038443 | Bacteria | 2551 |
| 195 | Ga0395901_0170969 | 3300038443 | Bacteria | 2280 |
| 196 | Ga0395901_0249890 | 3300038443 | Bacteria | 1848 |
| 197 | Ga0436360_1087594 | 3300039438 | Bacteria | 767 |
| 198 | Ga0436362_0524843 | 3300039453 | Bacteria | 540 |
| 199 | Ga0451797_0258303 | 3300041453 | Bacteria | 591 |
| 200 | Ga0466963_1307479 | 3300044694 | Unclassified | 509 |
| 201 | Ga0466960_0009744 | 3300044901 | Bacteria | 3973 |
| 202 | Ga0466960_0081005 | 3300044901 | Bacteria | 1636 |
| 203 | Ga0466960_0206605 | 3300044901 | Bacteria | 1075 |
| 204 | Ga0466967_0074790 | 3300045976 | Bacteria | 3043 |
| 205 | Ga0466967_1221954 | 3300045976 | Bacteria | 749 |
| 206 | Ga0466967_1846537 | 3300045976 | Bacteria | 601 |
| 207 | Ga0495641_0205136 | 3300046461 | Bacteria | 884 |
| 208 | Ga0495653_0000231 | 3300046463 | Bacteria | 45492 |
| 209 | Ga0495664_0000086 | 3300046477 | Bacteria | 45525 |
| 210 | Ga0495608_0457690 | 3300046511 | Bacteria | 776 |
| 211 | Ga0495618_0000054 | 3300046514 | Bacteria | 83787 |
| 212 | Ga0495630_0049784 | 3300046517 | Bacteria | 3135 |
| 213 | Ga0495666_0073461 | 3300046526 | Bacteria | 1623 |
| 214 | Ga0495652_0109720 | 3300046529 | Bacteria | 2221 |
| 215 | Ga0495657_0000006 | 3300046675 | Bacteria | 250610 |
| 216 | Ga0495646_0066231 | 3300046680 | Bacteria | 2137 |
| 217 | Ga0495646_0090741 | 3300046680 | Bacteria | 1765 |
| 218 | Ga0495647_0181415 | 3300046681 | Bacteria | 916 |
| 219 | Ga0495589_0092064 | 3300046794 | Bacteria | 1472 |
| 220 | Ga0495600_0015795 | 3300046809 | Bacteria | 4780 |
| 221 | Ga0495604_0097005 | 3300047317 | Bacteria | 2174 |
| 222 | Ga0495676_0038900 | 3300047321 | Bacteria | 3946 |
| 223 | Ga0495680_0260086 | 3300047322 | Bacteria | 1228 |
| 224 | Ga0495684_0007653 | 3300047471 | Bacteria | 8360 |
| 225 | Ga0496100_0267665 | 3300048903 | Bacteria | 1269 |
| 226 | Ga0496101_0256454 | 3300048904 | Bacteria | 1363 |
| 227 | Ga0496102_0000096 | 3300048905 | Bacteria | 124941 |
| 228 | Ga0496102_0206782 | 3300048905 | Bacteria | 1850 |
| 229 | Ga0496103_0000035 | 3300048906 | Bacteria | 182242 |
| 230 | Ga0496104_0000028 | 3300048907 | Bacteria | 203377 |
| 231 | Ga0496105_0108458 | 3300048908 | Bacteria | 2292 |
| 232 | Ga0496105_0290686 | 3300048908 | Bacteria | 1316 |
| 233 | Ga0496106_0021569 | 3300048909 | Bacteria | 4783 |
| 234 | Ga0496106_0123903 | 3300048909 | Bacteria | 2022 |
| 235 | Ga0496106_0332164 | 3300048909 | Bacteria | 1220 |
| 236 | Ga0496106_0875818 | 3300048909 | Bacteria | 710 |
| 237 | Ga0496106_0928210 | 3300048909 | Unclassified | 686 |
| 238 | Ga0496107_0001197 | 3300048910 | Bacteria | 15807 |
| 239 | Ga0496107_0318033 | 3300048910 | Bacteria | 1158 |
| 240 | Ga0496109_0099041 | 3300048912 | Bacteria | 2703 |
| 241 | Ga0496110_0001995 | 3300048913 | Bacteria | 15182 |
| 242 | Ga0496110_0333662 | 3300048913 | Bacteria | 1381 |
| 243 | Ga0496111_0001859 | 3300048914 | Bacteria | 12460 |
| 244 | Ga0496111_0071374 | 3300048914 | Bacteria | 2527 |
| 245 | Ga0496112_0117109 | 3300048915 | Bacteria | 2634 |
| 246 | Ga0496115_0036332 | 3300048918 | Bacteria | 3900 |
| 247 | Ga0496115_0153018 | 3300048918 | Bacteria | 1905 |
| 248 | Ga0501034_0391467 | 3300049571 | Bacteria | 1314 |
| 249 | Ga0501034_0646148 | 3300049571 | Bacteria | 960 |
| 250 | Ga0501047_0677802 | 3300049581 | Bacteria | 849 |
| 251 | Ga0501070_0446012 | 3300049586 | Bacteria | 1044 |
| 252 | nmdc:mga08y16_225351_c1 | 3300050511 | Bacteria | 1940 |
| 253 | nmdc:mga0n895_861634_c1 | 3300050512 | Bacteria | 893 |
| 254 | nmdc:mga0rr50_972366_c1 | 3300050513 | Bacteria | 723 |
| 255 | nmdc:mga0a205_676916_c1 | 3300050515 | Bacteria | 882 |
| 256 | Ga0495601_0000673 | 3300053077 | Bacteria | 18239 |
| 257 | Ga0495601_0047138 | 3300053077 | Bacteria | 2713 |
| 258 | Ga0495612_0000049 | 3300053078 | Bacteria | 54959 |
| 259 | Ga0495619_0118055 | 3300053085 | Bacteria | 1817 |
| 260 | Ga0587106_166389 | 3300059605 | Bacteria | 500 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300059605 | Ga0587106_166389 | Ga0587106_166389_134_463 | 102 |
| 2 | 3300005329 | Ga0070683_100662272 | Ga0070683_1006622721 | 107 |
| 3 | 3300005458 | Ga0070681_10507841 | Ga0070681_105078412 | 107 |
| 4 | 3300025944 | Ga0207661_10634510 | Ga0207661_106345101 | 107 |
| 5 | 3300028380 | Ga0268265_10339841 | Ga0268265_103398413 | 107 |
| 6 | 3300041453 | Ga0451797_0258303 | Ga0451797_0258303_219_542 | 107 |
| 7 | 3300039438 | Ga0436360_1087594 | Ga0436360_1087594_247_669 | 119 |
| 8 | 3300044901 | Ga0466960_0009744 | Ga0466960_0009744_2517_2897 | 124 |
| 9 | 3300005548 | Ga0070665_100606131 | Ga0070665_1006061312 | 125 |
| 10 | 3300014968 | Ga0157379_10005656 | Ga0157379_100056569 | 125 |
| 11 | 3300020082 | Ga0206353_10910689 | Ga0206353_109106892 | 125 |
| 12 | 3300028379 | Ga0268266_10573506 | Ga0268266_105735063 | 125 |
| 13 | 3300048908 | Ga0496105_0290686 | Ga0496105_0290686_686_1075 | 125 |
| 14 | 3300049571 | Ga0501034_0646148 | Ga0501034_0646148_111_494 | 127 |
| 15 | 3300049581 | Ga0501047_0677802 | Ga0501047_0677802_260_643 | 127 |
| 16 | 3300049586 | Ga0501070_0446012 | Ga0501070_0446012_170_553 | 127 |
| 17 | 3300045976 | Ga0466967_1221954 | Ga0466967_1221954_293_679 | 128 |
| 18 | 3300049571 | Ga0501034_0391467 | Ga0501034_0391467_492_878 | 128 |
| 19 | 3300005439 | Ga0070711_100001500 | Ga0070711_1000015003 | 129 |
| 20 | 3300005439 | Ga0070711_100653827 | Ga0070711_1006538272 | 129 |
| 21 | 3300005535 | Ga0070684_100047879 | Ga0070684_1000478792 | 129 |
| 22 | 3300006028 | Ga0070717_10610416 | Ga0070717_106104161 | 129 |
| 23 | 3300009545 | Ga0105237_12047809 | Ga0105237_120478091 | 129 |
| 24 | 3300013297 | Ga0157378_11455243 | Ga0157378_114552431 | 129 |
| 25 | 3300025915 | Ga0207693_10053979 | Ga0207693_100539794 | 129 |
| 26 | 3300025916 | Ga0207663_10001162 | Ga0207663_1000116216 | 129 |
| 27 | 3300025916 | Ga0207663_10220237 | Ga0207663_102202373 | 129 |
| 28 | 3300028556 | Ga0265337_1001815 | Ga0265337_10018154 | 129 |
| 29 | 3300028558 | Ga0265326_10001279 | Ga0265326_100012795 | 129 |
| 30 | 3300028563 | Ga0265319_1000796 | Ga0265319_10007966 | 129 |
| 31 | 3300028577 | Ga0265318_10000961 | Ga0265318_100009618 | 129 |
| 32 | 3300028654 | Ga0265322_10007430 | Ga0265322_100074304 | 129 |
| 33 | 3300028666 | Ga0265336_10000060 | Ga0265336_1000006093 | 129 |
| 34 | 3300028800 | Ga0265338_10000234 | Ga0265338_1000023494 | 129 |
| 35 | 3300029957 | Ga0265324_10007611 | Ga0265324_100076114 | 129 |
| 36 | 3300031238 | Ga0265332_10337313 | Ga0265332_103373132 | 129 |
| 37 | 3300031240 | Ga0265320_10055930 | Ga0265320_100559302 | 129 |
| 38 | 3300031247 | Ga0265340_10000014 | Ga0265340_1000001420 | 129 |
| 39 | 3300031344 | Ga0265316_10046033 | Ga0265316_100460332 | 129 |
| 40 | 3300031731 | Ga0307405_10740766 | Ga0307405_107407663 | 129 |
| 41 | 3300031901 | Ga0307406_10180856 | Ga0307406_101808563 | 129 |
| 42 | 3300035692 | Ga0373935_0395524 | Ga0373935_0395524_192_605 | 129 |
| 43 | 3300037068 | Ga0373925_0055658 | Ga0373925_0055658_72_485 | 129 |
| 44 | 3300037418 | Ga0395900_0058250 | Ga0395900_0058250_3487_3894 | 129 |
| 45 | 3300037418 | Ga0395900_0151175 | Ga0395900_0151175_292_693 | 129 |
| 46 | 3300037471 | Ga0395905_1426011 | Ga0395905_1426011_133_546 | 129 |
| 47 | 3300038443 | Ga0395901_0170969 | Ga0395901_0170969_689_1096 | 129 |
| 48 | 3300044694 | Ga0466963_1307479 | Ga0466963_1307479_36_443 | 129 |
| 49 | 3300046463 | Ga0495653_0000231 | Ga0495653_0000231_33292_33705 | 129 |
| 50 | 3300046514 | Ga0495618_0000054 | Ga0495618_0000054_24984_25397 | 129 |
| 51 | 3300046517 | Ga0495630_0049784 | Ga0495630_0049784_2677_3096 | 129 |
| 52 | 3300046526 | Ga0495666_0073461 | Ga0495666_0073461_713_1126 | 129 |
| 53 | 3300046675 | Ga0495657_0000006 | Ga0495657_0000006_149629_150048 | 129 |
| 54 | 3300046680 | Ga0495646_0090741 | Ga0495646_0090741_832_1257 | 129 |
| 55 | 3300046681 | Ga0495647_0181415 | Ga0495647_0181415_53_466 | 129 |
| 56 | 3300047321 | Ga0495676_0038900 | Ga0495676_0038900_2136_2549 | 129 |
| 57 | 3300047471 | Ga0495684_0007653 | Ga0495684_0007653_7733_8152 | 129 |
| 58 | 3300053078 | Ga0495612_0000049 | Ga0495612_0000049_47244_47657 | 129 |
| 59 | 3300006028 | Ga0070717_10931590 | Ga0070717_109315901 | 130 |
| 60 | 3300009093 | Ga0105240_10046441 | Ga0105240_100464413 | 130 |
| 61 | 3300020081 | Ga0206354_10419973 | Ga0206354_104199731 | 130 |
| 62 | 3300025913 | Ga0207695_10014458 | Ga0207695_100144583 | 130 |
| 63 | 3300031251 | Ga0265327_10014680 | Ga0265327_100146804 | 130 |
| 64 | 3300046477 | Ga0495664_0000086 | Ga0495664_0000086_22413_22838 | 130 |
| 65 | 3300046511 | Ga0495608_0457690 | Ga0495608_0457690_138_593 | 130 |
| 66 | 3300046529 | Ga0495652_0109720 | Ga0495652_0109720_881_1303 | 130 |
| 67 | 3300046680 | Ga0495646_0066231 | Ga0495646_0066231_1338_1763 | 130 |
| 68 | 3300046809 | Ga0495600_0015795 | Ga0495600_0015795_2104_2559 | 130 |
| 69 | 3300047317 | Ga0495604_0097005 | Ga0495604_0097005_1248_1673 | 130 |
| 70 | 3300047322 | Ga0495680_0260086 | Ga0495680_0260086_797_1216 | 130 |
| 71 | 3300048905 | Ga0496102_0000096 | Ga0496102_0000096_71853_72275 | 130 |
| 72 | 3300048906 | Ga0496103_0000035 | Ga0496103_0000035_71666_72088 | 130 |
| 73 | 3300048907 | Ga0496104_0000028 | Ga0496104_0000028_3828_4253 | 130 |
| 74 | 3300048913 | Ga0496110_0001995 | Ga0496110_0001995_361_786 | 130 |
| 75 | 3300048914 | Ga0496111_0001859 | Ga0496111_0001859_8302_8727 | 130 |
| 76 | 3300053077 | Ga0495601_0000673 | Ga0495601_0000673_14156_14587 | 130 |
| 77 | 3300053077 | Ga0495601_0047138 | Ga0495601_0047138_1964_2386 | 130 |
| 78 | 3300053085 | Ga0495619_0118055 | Ga0495619_0118055_14_466 | 130 |
| 79 | 3300003323 | rootH1_10180553 | rootH1_101805531 | 131 |
| 80 | 3300045976 | Ga0466967_1846537 | Ga0466967_1846537_160_564 | 131 |
| 81 | 3300005353 | Ga0070669_100618031 | Ga0070669_1006180313 | 132 |
| 82 | 3300005367 | Ga0070667_101638938 | Ga0070667_1016389381 | 132 |
| 83 | 3300005434 | Ga0070709_10545685 | Ga0070709_105456851 | 132 |
| 84 | 3300005435 | Ga0070714_101178399 | Ga0070714_1011783991 | 132 |
| 85 | 3300005436 | Ga0070713_100240989 | Ga0070713_1002409892 | 132 |
| 86 | 3300005458 | Ga0070681_11919895 | Ga0070681_119198951 | 132 |
| 87 | 3300009148 | Ga0105243_10608659 | Ga0105243_106086591 | 132 |
| 88 | 3300014969 | Ga0157376_10539588 | Ga0157376_105395882 | 132 |
| 89 | 3300020082 | Ga0206353_10253719 | Ga0206353_102537193 | 132 |
| 90 | 3300025906 | Ga0207699_10428922 | Ga0207699_104289222 | 132 |
| 91 | 3300025934 | Ga0207686_10545298 | Ga0207686_105452983 | 132 |
| 92 | 3300025938 | Ga0207704_11785636 | Ga0207704_117856361 | 132 |
| 93 | 3300032126 | Ga0307415_101405223 | Ga0307415_1014052232 | 132 |
| 94 | 3300038443 | Ga0395901_0139212 | Ga0395901_0139212_296_694 | 132 |
| 95 | 3300038443 | Ga0395901_0249890 | Ga0395901_0249890_25_423 | 132 |
| 96 | 3300039453 | Ga0436362_0524843 | Ga0436362_0524843_86_517 | 132 |
| 97 | 3300046794 | Ga0495589_0092064 | Ga0495589_0092064_196_597 | 132 |
| 98 | 3300048910 | Ga0496107_0001197 | Ga0496107_0001197_928_1332 | 132 |
| 99 | 3300048918 | Ga0496115_0036332 | Ga0496115_0036332_1803_2207 | 132 |
| 100 | 3300002073 | JGI24745J21846_1034542 | JGI24745J21846_10345421 | 133 |
| 101 | 3300002077 | JGI24744J21845_10045551 | JGI24744J21845_100455512 | 133 |
| 102 | 3300005329 | Ga0070683_100407141 | Ga0070683_1004071412 | 133 |
| 103 | 3300005330 | Ga0070690_100404950 | Ga0070690_1004049503 | 133 |
| 104 | 3300005334 | Ga0068869_100090816 | Ga0068869_1000908164 | 133 |
| 105 | 3300005340 | Ga0070689_100062254 | Ga0070689_1000622545 | 133 |
| 106 | 3300005341 | Ga0070691_10208774 | Ga0070691_102087742 | 133 |
| 107 | 3300005343 | Ga0070687_100044085 | Ga0070687_1000440852 | 133 |
| 108 | 3300005344 | Ga0070661_100218947 | Ga0070661_1002189473 | 133 |
| 109 | 3300005345 | Ga0070692_10192394 | Ga0070692_101923941 | 133 |
| 110 | 3300005347 | Ga0070668_100319432 | Ga0070668_1003194321 | 133 |
| 111 | 3300005353 | Ga0070669_100561123 | Ga0070669_1005611232 | 133 |
| 112 | 3300005356 | Ga0070674_100180627 | Ga0070674_1001806273 | 133 |
| 113 | 3300005365 | Ga0070688_101395854 | Ga0070688_1013958541 | 133 |
| 114 | 3300005366 | Ga0070659_100062914 | Ga0070659_1000629144 | 133 |
| 115 | 3300005367 | Ga0070667_100083799 | Ga0070667_1000837992 | 133 |
| 116 | 3300005437 | Ga0070710_10226808 | Ga0070710_102268083 | 133 |
| 117 | 3300005439 | Ga0070711_100181399 | Ga0070711_1001813993 | 133 |
| 118 | 3300005440 | Ga0070705_100082905 | Ga0070705_1000829053 | 133 |
| 119 | 3300005441 | Ga0070700_100187590 | Ga0070700_1001875903 | 133 |
| 120 | 3300005444 | Ga0070694_100451854 | Ga0070694_1004518542 | 133 |
| 121 | 3300005455 | Ga0070663_100076623 | Ga0070663_1000766233 | 133 |
| 122 | 3300005456 | Ga0070678_100044344 | Ga0070678_1000443444 | 133 |
| 123 | 3300005457 | Ga0070662_100166480 | Ga0070662_1001664803 | 133 |
| 124 | 3300005458 | Ga0070681_11080683 | Ga0070681_110806831 | 133 |
| 125 | 3300005466 | Ga0070685_10024228 | Ga0070685_100242285 | 133 |
| 126 | 3300005535 | Ga0070684_101995860 | Ga0070684_1019958601 | 133 |
| 127 | 3300005544 | Ga0070686_100623026 | Ga0070686_1006230262 | 133 |
| 128 | 3300005547 | Ga0070693_100268064 | Ga0070693_1002680642 | 133 |
| 129 | 3300005548 | Ga0070665_100114028 | Ga0070665_1001140284 | 133 |
| 130 | 3300005549 | Ga0070704_100208328 | Ga0070704_1002083284 | 133 |
| 131 | 3300005564 | Ga0070664_100182320 | Ga0070664_1001823202 | 133 |
| 132 | 3300005564 | Ga0070664_100520653 | Ga0070664_1005206532 | 133 |
| 133 | 3300005578 | Ga0068854_100806650 | Ga0068854_1008066502 | 133 |
| 134 | 3300005614 | Ga0068856_100205204 | Ga0068856_1002052043 | 133 |
| 135 | 3300005615 | Ga0070702_100140126 | Ga0070702_1001401262 | 133 |
| 136 | 3300005615 | Ga0070702_100322947 | Ga0070702_1003229472 | 133 |
| 137 | 3300005616 | Ga0068852_100185413 | Ga0068852_1001854134 | 133 |
| 138 | 3300005617 | Ga0068859_100043865 | Ga0068859_1000438653 | 133 |
| 139 | 3300005718 | Ga0068866_10854601 | Ga0068866_108546012 | 133 |
| 140 | 3300005719 | Ga0068861_100060435 | Ga0068861_1000604355 | 133 |
| 141 | 3300005719 | Ga0068861_100223907 | Ga0068861_1002239072 | 133 |
| 142 | 3300005719 | Ga0068861_100932427 | Ga0068861_1009324272 | 133 |
| 143 | 3300005834 | Ga0068851_10045205 | Ga0068851_100452053 | 133 |
| 144 | 3300005840 | Ga0068870_10155637 | Ga0068870_101556373 | 133 |
| 145 | 3300005841 | Ga0068863_100218274 | Ga0068863_1002182743 | 133 |
| 146 | 3300005842 | Ga0068858_100125311 | Ga0068858_1001253112 | 133 |
| 147 | 3300005844 | Ga0068862_100409890 | Ga0068862_1004098903 | 133 |
| 148 | 3300006163 | Ga0070715_10182553 | Ga0070715_101825532 | 133 |
| 149 | 3300006173 | Ga0070716_100809866 | Ga0070716_1008098662 | 133 |
| 150 | 3300006175 | Ga0070712_100011732 | Ga0070712_1000117324 | 133 |
| 151 | 3300006358 | Ga0068871_100357704 | Ga0068871_1003577043 | 133 |
| 152 | 3300006844 | Ga0075428_102610461 | Ga0075428_1026104611 | 133 |
| 153 | 3300006852 | Ga0075433_10954097 | Ga0075433_109540972 | 133 |
| 154 | 3300006881 | Ga0068865_100120543 | Ga0068865_1001205434 | 133 |
| 155 | 3300006931 | Ga0097620_100043865 | Ga0097620_1000438653 | 133 |
| 156 | 3300007076 | Ga0075435_101337538 | Ga0075435_1013375382 | 133 |
| 157 | 3300009094 | Ga0111539_10322939 | Ga0111539_103229393 | 133 |
| 158 | 3300009094 | Ga0111539_10520526 | Ga0111539_105205262 | 133 |
| 159 | 3300009098 | Ga0105245_10082027 | Ga0105245_100820275 | 133 |
| 160 | 3300009098 | Ga0105245_10157843 | Ga0105245_101578432 | 133 |
| 161 | 3300009148 | Ga0105243_10068426 | Ga0105243_100684265 | 133 |
| 162 | 3300009148 | Ga0105243_10088188 | Ga0105243_100881884 | 133 |
| 163 | 3300009174 | Ga0105241_10142534 | Ga0105241_101425344 | 133 |
| 164 | 3300009176 | Ga0105242_10137973 | Ga0105242_101379734 | 133 |
| 165 | 3300009177 | Ga0105248_10958112 | Ga0105248_109581122 | 133 |
| 166 | 3300009545 | Ga0105237_10343335 | Ga0105237_103433353 | 133 |
| 167 | 3300009553 | Ga0105249_10066037 | Ga0105249_100660373 | 133 |
| 168 | 3300010375 | Ga0105239_10125636 | Ga0105239_101256365 | 133 |
| 169 | 3300010375 | Ga0105239_10213631 | Ga0105239_102136313 | 133 |
| 170 | 3300010375 | Ga0105239_11225562 | Ga0105239_112255621 | 133 |
| 171 | 3300011119 | Ga0105246_10038192 | Ga0105246_100381923 | 133 |
| 172 | 3300013102 | Ga0157371_10231443 | Ga0157371_102314432 | 133 |
| 173 | 3300013105 | Ga0157369_12071124 | Ga0157369_120711241 | 133 |
| 174 | 3300013296 | Ga0157374_11124397 | Ga0157374_111243972 | 133 |
| 175 | 3300013297 | Ga0157378_10281713 | Ga0157378_102817132 | 133 |
| 176 | 3300013306 | Ga0163162_10043685 | Ga0163162_100436852 | 133 |
| 177 | 3300013306 | Ga0163162_10593112 | Ga0163162_105931121 | 133 |
| 178 | 3300013307 | Ga0157372_10440074 | Ga0157372_104400743 | 133 |
| 179 | 3300013308 | Ga0157375_10357294 | Ga0157375_103572942 | 133 |
| 180 | 3300013308 | Ga0157375_11610191 | Ga0157375_116101912 | 133 |
| 181 | 3300014325 | Ga0163163_10204835 | Ga0163163_102048353 | 133 |
| 182 | 3300014325 | Ga0163163_10273630 | Ga0163163_102736303 | 133 |
| 183 | 3300014326 | Ga0157380_10768542 | Ga0157380_107685422 | 133 |
| 184 | 3300014497 | Ga0182008_10129960 | Ga0182008_101299602 | 133 |
| 185 | 3300014745 | Ga0157377_10034398 | Ga0157377_100343984 | 133 |
| 186 | 3300014745 | Ga0157377_11115299 | Ga0157377_111152991 | 133 |
| 187 | 3300014968 | Ga0157379_10089872 | Ga0157379_100898722 | 133 |
| 188 | 3300014969 | Ga0157376_10294415 | Ga0157376_102944153 | 133 |
| 189 | 3300017792 | Ga0163161_10203905 | Ga0163161_102039052 | 133 |
| 190 | 3300020080 | Ga0206350_10154106 | Ga0206350_101541063 | 133 |
| 191 | 3300025898 | Ga0207692_10015258 | Ga0207692_100152585 | 133 |
| 192 | 3300025899 | Ga0207642_10064200 | Ga0207642_100642004 | 133 |
| 193 | 3300025900 | Ga0207710_10068786 | Ga0207710_100687863 | 133 |
| 194 | 3300025905 | Ga0207685_10159710 | Ga0207685_101597103 | 133 |
| 195 | 3300025908 | Ga0207643_10115416 | Ga0207643_101154163 | 133 |
| 196 | 3300025911 | Ga0207654_10112381 | Ga0207654_101123811 | 133 |
| 197 | 3300025912 | Ga0207707_11095195 | Ga0207707_110951951 | 133 |
| 198 | 3300025914 | Ga0207671_10328398 | Ga0207671_103283982 | 133 |
| 199 | 3300025915 | Ga0207693_10027758 | Ga0207693_100277582 | 133 |
| 200 | 3300025916 | Ga0207663_10149861 | Ga0207663_101498613 | 133 |
| 201 | 3300025919 | Ga0207657_10047518 | Ga0207657_100475184 | 133 |
| 202 | 3300025920 | Ga0207649_10937641 | Ga0207649_109376411 | 133 |
| 203 | 3300025927 | Ga0207687_10053372 | Ga0207687_100533723 | 133 |
| 204 | 3300025927 | Ga0207687_10240421 | Ga0207687_102404212 | 133 |
| 205 | 3300025931 | Ga0207644_10749197 | Ga0207644_107491972 | 133 |
| 206 | 3300025932 | Ga0207690_10200706 | Ga0207690_102007063 | 133 |
| 207 | 3300025933 | Ga0207706_10120341 | Ga0207706_101203413 | 133 |
| 208 | 3300025934 | Ga0207686_10083731 | Ga0207686_100837313 | 133 |
| 209 | 3300025935 | Ga0207709_10121467 | Ga0207709_101214673 | 133 |
| 210 | 3300025936 | Ga0207670_10048526 | Ga0207670_100485264 | 133 |
| 211 | 3300025937 | Ga0207669_10117629 | Ga0207669_101176293 | 133 |
| 212 | 3300025941 | Ga0207711_10596568 | Ga0207711_105965682 | 133 |
| 213 | 3300025942 | Ga0207689_10398005 | Ga0207689_103980052 | 133 |
| 214 | 3300025949 | Ga0207667_10936252 | Ga0207667_109362521 | 133 |
| 215 | 3300025961 | Ga0207712_10086793 | Ga0207712_100867933 | 133 |
| 216 | 3300025972 | Ga0207668_10101195 | Ga0207668_101011953 | 133 |
| 217 | 3300025981 | Ga0207640_10188348 | Ga0207640_101883482 | 133 |
| 218 | 3300025986 | Ga0207658_10962517 | Ga0207658_109625172 | 133 |
| 219 | 3300026023 | Ga0207677_10171864 | Ga0207677_101718642 | 133 |
| 220 | 3300026067 | Ga0207678_10397007 | Ga0207678_103970073 | 133 |
| 221 | 3300026075 | Ga0207708_10022857 | Ga0207708_100228574 | 133 |
| 222 | 3300026078 | Ga0207702_10651916 | Ga0207702_106519162 | 133 |
| 223 | 3300026088 | Ga0207641_10321712 | Ga0207641_103217123 | 133 |
| 224 | 3300026089 | Ga0207648_10248206 | Ga0207648_102482063 | 133 |
| 225 | 3300026095 | Ga0207676_10499895 | Ga0207676_104998952 | 133 |
| 226 | 3300026116 | Ga0207674_10166683 | Ga0207674_101666834 | 133 |
| 227 | 3300026118 | Ga0207675_100010350 | Ga0207675_1000103502 | 133 |
| 228 | 3300026118 | Ga0207675_100310136 | Ga0207675_1003101363 | 133 |
| 229 | 3300026118 | Ga0207675_101009770 | Ga0207675_1010097702 | 133 |
| 230 | 3300027907 | Ga0207428_10374843 | Ga0207428_103748432 | 133 |
| 231 | 3300028380 | Ga0268265_10201871 | Ga0268265_102018713 | 133 |
| 232 | 3300028380 | Ga0268265_10317977 | Ga0268265_103179772 | 133 |
| 233 | 3300028381 | Ga0268264_10356315 | Ga0268264_103563153 | 133 |
| 234 | 3300031901 | Ga0307406_10421872 | Ga0307406_104218723 | 133 |
| 235 | 3300031901 | Ga0307406_10511979 | Ga0307406_105119792 | 133 |
| 236 | 3300032002 | Ga0307416_103683404 | Ga0307416_1036834041 | 133 |
| 237 | 3300032126 | Ga0307415_100250720 | Ga0307415_1002507201 | 133 |
| 238 | 3300044901 | Ga0466960_0081005 | Ga0466960_0081005_249_653 | 133 |
| 239 | 3300044901 | Ga0466960_0206605 | Ga0466960_0206605_240_641 | 133 |
| 240 | 3300045976 | Ga0466967_0074790 | Ga0466967_0074790_111_518 | 133 |
| 241 | 3300046461 | Ga0495641_0205136 | Ga0495641_0205136_234_635 | 133 |
| 242 | 3300048903 | Ga0496100_0267665 | Ga0496100_0267665_624_1025 | 133 |
| 243 | 3300048904 | Ga0496101_0256454 | Ga0496101_0256454_663_1067 | 133 |
| 244 | 3300048905 | Ga0496102_0206782 | Ga0496102_0206782_180_581 | 133 |
| 245 | 3300048908 | Ga0496105_0108458 | Ga0496105_0108458_1312_1713 | 133 |
| 246 | 3300048909 | Ga0496106_0021569 | Ga0496106_0021569_3238_3639 | 133 |
| 247 | 3300048909 | Ga0496106_0123903 | Ga0496106_0123903_177_578 | 133 |
| 248 | 3300048909 | Ga0496106_0332164 | Ga0496106_0332164_502_903 | 133 |
| 249 | 3300048909 | Ga0496106_0875818 | Ga0496106_0875818_198_602 | 133 |
| 250 | 3300048909 | Ga0496106_0928210 | Ga0496106_0928210_79_480 | 133 |
| 251 | 3300048910 | Ga0496107_0318033 | Ga0496107_0318033_367_768 | 133 |
| 252 | 3300048912 | Ga0496109_0099041 | Ga0496109_0099041_1313_1714 | 133 |
| 253 | 3300048913 | Ga0496110_0333662 | Ga0496110_0333662_253_654 | 133 |
| 254 | 3300048914 | Ga0496111_0071374 | Ga0496111_0071374_550_951 | 133 |
| 255 | 3300048915 | Ga0496112_0117109 | Ga0496112_0117109_1244_1645 | 133 |
| 256 | 3300048918 | Ga0496115_0153018 | Ga0496115_0153018_775_1176 | 133 |
| 257 | 3300050511 | nmdc:mga08y16_225351_c1 | nmdc:mga08y16_225351_c1_505_906 | 133 |
| 258 | 3300050512 | nmdc:mga0n895_861634_c1 | nmdc:mga0n895_861634_c1_233_634 | 133 |
| 259 | 3300050513 | nmdc:mga0rr50_972366_c1 | nmdc:mga0rr50_972366_c1_49_450 | 133 |
| 260 | 3300050515 | nmdc:mga0a205_676916_c1 | nmdc:mga0a205_676916_c1_269_670 | 133 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1oi0-assembly3.cif.gz_C | crystal structure of af2198, a jab1/mpn domain protein from archaeoglobus fulgidus | 0.8593 | 1 | 133 |
| 5ld9-assembly1.cif.gz_B | structure of deubiquitinating enzyme homolog, pyrococcus furiosus jamm1. | 0.8524 | 1 | 133 |
| 1oi0-assembly1.cif.gz_A | crystal structure of af2198, a jab1/mpn domain protein from archaeoglobus fulgidus | 0.8464 | 1 | 133 |
| 5ld9-assembly1.cif.gz_A | structure of deubiquitinating enzyme homolog, pyrococcus furiosus jamm1. | 0.8416 | 2 | 133 |
| 5ld9-assembly1.cif.gz_B | structure of deubiquitinating enzyme homolog, pyrococcus furiosus jamm1. | 0.8402 | 1 | 133 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WHS1_10_146_3.40.140.10 | Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 | 0.8986 | 1 | 133 | 3.40.140.10 |
| af_P9WHS1_10_146_3.40.140.10 | Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 | 0.8923 | 1 | 133 | 3.40.140.10 |
| 2kksA00 | Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 | 0.8219 | 2 | 133 | 3.40.140.10 |
| 1r5xB00 | Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 | 0.818 | 1 | 133 | 3.40.140.10 |
| af_Q54Z40_718_975_3.40.140.10 | Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 | 0.8138 | 2 | 133 | 3.40.140.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A537XDZ2-F1-model_v4 | M67 family metallopeptidase | 0.9664 | 1 | 133 |
GO:0006508
GO:0008235 GO:0008270 |
| AF-A0A537XDZ2-F1-model_v4 | M67 family metallopeptidase | 0.9592 | 1 | 133 |
GO:0006508
GO:0008235 GO:0008270 |
| AF-D3F2A1-F1-model_v4 | Mov34/MPN/PAD-1 family protein | 0.9548 | 1 | 133 |
GO:0006508
GO:0008235 GO:0008270 |
| AF-A0A1G1HZ05-F1-model_v4 | MPN domain-containing protein | 0.9535 | 4 | 132 |
GO:0006508
GO:0008235 GO:0008270 |
| AF-A0A4S1CHJ1-F1-model_v4 | M67 family peptidase | 0.9532 | 1 | 133 |
GO:0006508
GO:0008235 GO:0008270 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar