F369366

General Info

Members Datasets Scaffolds Average Seq Length
260 199 260 134

Family's Representative Sequence

Representative Sequence 3300005439|Ga0070711_100653827|Ga0070711_1006538272
Length 153
Sequence VVAAQIGARPATAATAMVIARALLEDLVAHAREEYDAECCGVIAYAPTDDGLAPEAVRVHRARNVFASPKRFEIDGKELLGAIEQFEDEGWDLGAIYHSHTHTEPYPSQTDINFAANWPGLEWVIVGLAGEEPDVRCYLIEDGAVRALELEVR

Samples

Sample ID Description Type Environment
1 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
2 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
45 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
50 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
51 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
52 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
80 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
128 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
132 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
133 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
134 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
135 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
136 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
137 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
138 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
139 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
140 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
141 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
142 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
143 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
144 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
145 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
146 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
147 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
148 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
149 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
150 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
151 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
152 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
153 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
154 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
155 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
156 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
157 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
158 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
159 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
160 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
161 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
162 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
163 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
164 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
165 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
166 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
167 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
168 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
169 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
170 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
171 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
172 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
173 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
174 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
175 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
176 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
177 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
178 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
179 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
180 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
181 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
182 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
183 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
184 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
185 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
186 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
187 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
188 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
189 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
192 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
193 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
194 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
195 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
196 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
197 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
198 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
199 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.08
Metatranscriptomes 1.92
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 9.23
Rhizosphere 90.38
Stem 0
Stem Tuber 0
Unclassified 0.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24745J21846_1034542 3300002073 Bacteria 616
2 JGI24744J21845_10045551 3300002077 Bacteria 814
3 rootH1_10180553 3300003323 Bacteria 1291
4 Ga0070683_100407141 3300005329 Bacteria 1297
5 Ga0070683_100662272 3300005329 Bacteria 1000
6 Ga0070690_100404950 3300005330 Bacteria 1003
7 Ga0068869_100090816 3300005334 Bacteria 2296
8 Ga0070689_100062254 3300005340 Bacteria 2903
9 Ga0070691_10208774 3300005341 Bacteria 1029
10 Ga0070687_100044085 3300005343 Bacteria 2270
11 Ga0070661_100218947 3300005344 Bacteria 1460
12 Ga0070692_10192394 3300005345 Bacteria 1189
13 Ga0070668_100319432 3300005347 Bacteria 1307
14 Ga0070669_100561123 3300005353 Bacteria 953
15 Ga0070669_100618031 3300005353 Bacteria 909
16 Ga0070674_100180627 3300005356 Bacteria 1616
17 Ga0070688_101395854 3300005365 Bacteria 568
18 Ga0070659_100062914 3300005366 Bacteria 2934
19 Ga0070667_100083799 3300005367 Bacteria 2732
20 Ga0070667_101638938 3300005367 Bacteria 605
21 Ga0070709_10545685 3300005434 Bacteria 886
22 Ga0070714_101178399 3300005435 Bacteria 747
23 Ga0070713_100240989 3300005436 Bacteria 1647
24 Ga0070710_10226808 3300005437 Bacteria 1191
25 Ga0070711_100001500 3300005439 Bacteria 12830
26 Ga0070711_100181399 3300005439 Bacteria 1612
27 Ga0070711_100653827 3300005439 Unclassified 881
28 Ga0070705_100082905 3300005440 Bacteria 1974
29 Ga0070700_100187590 3300005441 Bacteria 1443
30 Ga0070694_100451854 3300005444 Bacteria 1015
31 Ga0070663_100076623 3300005455 Bacteria 2446
32 Ga0070678_100044344 3300005456 Bacteria 3175
33 Ga0070662_100166480 3300005457 Bacteria 1728
34 Ga0070681_10507841 3300005458 Bacteria 1119
35 Ga0070681_11080683 3300005458 Bacteria 723
36 Ga0070681_11919895 3300005458 Bacteria 520
37 Ga0070685_10024228 3300005466 Bacteria 3331
38 Ga0070684_100047879 3300005535 Bacteria 3707
39 Ga0070684_101995860 3300005535 Bacteria 548
40 Ga0070686_100623026 3300005544 Bacteria 852
41 Ga0070693_100268064 3300005547 Bacteria 1139
42 Ga0070665_100114028 3300005548 Bacteria 2705
43 Ga0070665_100606131 3300005548 Bacteria 1108
44 Ga0070704_100208328 3300005549 Bacteria 1583
45 Ga0070664_100182320 3300005564 Bacteria 1867
46 Ga0070664_100520653 3300005564 Bacteria 1098
47 Ga0068854_100806650 3300005578 Bacteria 818
48 Ga0068856_100205204 3300005614 Bacteria 1986
49 Ga0070702_100140126 3300005615 Bacteria 1539
50 Ga0070702_100322947 3300005615 Bacteria 1076
51 Ga0068852_100185413 3300005616 Bacteria 1959
52 Ga0068859_100043865 3300005617 Bacteria 4494
53 Ga0068866_10854601 3300005718 Bacteria 637
54 Ga0068861_100060435 3300005719 Bacteria 2904
55 Ga0068861_100223907 3300005719 Bacteria 1591
56 Ga0068861_100932427 3300005719 Bacteria 824
57 Ga0068851_10045205 3300005834 Bacteria 2225
58 Ga0068870_10155637 3300005840 Bacteria 1350
59 Ga0068863_100218274 3300005841 Bacteria 1837
60 Ga0068858_100125311 3300005842 Bacteria 2404
61 Ga0068862_100409890 3300005844 Bacteria 1269
62 Ga0070717_10610416 3300006028 Bacteria 990
63 Ga0070717_10931590 3300006028 Unclassified 791
64 Ga0070715_10182553 3300006163 Bacteria 1053
65 Ga0070716_100809866 3300006173 Bacteria 726
66 Ga0070712_100011732 3300006175 Bacteria 5566
67 Ga0068871_100357704 3300006358 Bacteria 1293
68 Ga0075428_102610461 3300006844 Bacteria 516
69 Ga0075433_10954097 3300006852 Bacteria 748
70 Ga0068865_100120543 3300006881 Bacteria 1950
71 Ga0097620_100043865 3300006931 Bacteria 4494
72 Ga0075435_101337538 3300007076 Bacteria 628
73 Ga0105240_10046441 3300009093 Bacteria 5503
74 Ga0111539_10322939 3300009094 Bacteria 1796
75 Ga0111539_10520526 3300009094 Bacteria 1386
76 Ga0105245_10082027 3300009098 Bacteria 2949
77 Ga0105245_10157843 3300009098 Bacteria 2150
78 Ga0105243_10068426 3300009148 Bacteria 2862
79 Ga0105243_10088188 3300009148 Bacteria 2548
80 Ga0105243_10608659 3300009148 Bacteria 1053
81 Ga0105241_10142534 3300009174 Bacteria 1953
82 Ga0105242_10137973 3300009176 Bacteria 2113
83 Ga0105248_10958112 3300009177 Bacteria 966
84 Ga0105237_10343335 3300009545 Bacteria 1497
85 Ga0105237_12047809 3300009545 Unclassified 581
86 Ga0105249_10066037 3300009553 Bacteria 3330
87 Ga0105239_10125636 3300010375 Bacteria 2851
88 Ga0105239_10213631 3300010375 Bacteria 2162
89 Ga0105239_11225562 3300010375 Bacteria 865
90 Ga0105246_10038192 3300011119 Bacteria 3226
91 Ga0157371_10231443 3300013102 Bacteria 1328
92 Ga0157369_12071124 3300013105 Bacteria 577
93 Ga0157374_11124397 3300013296 Bacteria 806
94 Ga0157378_10281713 3300013297 Bacteria 1602
95 Ga0157378_11455243 3300013297 Bacteria 729
96 Ga0163162_10043685 3300013306 Bacteria 4487
97 Ga0163162_10593112 3300013306 Bacteria 1235
98 Ga0157372_10440074 3300013307 Bacteria 1519
99 Ga0157375_10357294 3300013308 Bacteria 1627
100 Ga0157375_11610191 3300013308 Bacteria 768
101 Ga0163163_10204835 3300014325 Bacteria 2021
102 Ga0163163_10273630 3300014325 Bacteria 1740
103 Ga0157380_10768542 3300014326 Bacteria 977
104 Ga0182008_10129960 3300014497 Bacteria 1255
105 Ga0157377_10034398 3300014745 Bacteria 2773
106 Ga0157377_11115299 3300014745 Bacteria 605
107 Ga0157379_10005656 3300014968 Bacteria 10742
108 Ga0157379_10089872 3300014968 Bacteria 2755
109 Ga0157376_10294415 3300014969 Bacteria 1534
110 Ga0157376_10539588 3300014969 Bacteria 1152
111 Ga0163161_10203905 3300017792 Bacteria 1525
112 Ga0206350_10154106 3300020080 Bacteria 1640
113 Ga0206354_10419973 3300020081 Bacteria 725
114 Ga0206353_10253719 3300020082 Bacteria 694
115 Ga0206353_10910689 3300020082 Bacteria 922
116 Ga0207692_10015258 3300025898 Bacteria 3376
117 Ga0207642_10064200 3300025899 Bacteria 1720
118 Ga0207710_10068786 3300025900 Bacteria 1620
119 Ga0207685_10159710 3300025905 Bacteria 1028
120 Ga0207699_10428922 3300025906 Bacteria 945
121 Ga0207643_10115416 3300025908 Bacteria 1586
122 Ga0207654_10112381 3300025911 Bacteria 1697
123 Ga0207707_11095195 3300025912 Bacteria 649
124 Ga0207695_10014458 3300025913 Bacteria 9348
125 Ga0207671_10328398 3300025914 Bacteria 1211
126 Ga0207693_10027758 3300025915 Bacteria 4474
127 Ga0207693_10053979 3300025915 Bacteria 3153
128 Ga0207663_10001162 3300025916 Bacteria 12157
129 Ga0207663_10149861 3300025916 Bacteria 1635
130 Ga0207663_10220237 3300025916 Bacteria 1380
131 Ga0207657_10047518 3300025919 Bacteria 3752
132 Ga0207649_10937641 3300025920 Bacteria 680
133 Ga0207687_10053372 3300025927 Bacteria 2824
134 Ga0207687_10240421 3300025927 Bacteria 1435
135 Ga0207644_10749197 3300025931 Bacteria 816
136 Ga0207690_10200706 3300025932 Bacteria 1514
137 Ga0207706_10120341 3300025933 Bacteria 2308
138 Ga0207686_10083731 3300025934 Bacteria 2088
139 Ga0207686_10545298 3300025934 Bacteria 906
140 Ga0207709_10121467 3300025935 Bacteria 1764
141 Ga0207670_10048526 3300025936 Bacteria 2834
142 Ga0207669_10117629 3300025937 Bacteria 1797
143 Ga0207704_11785636 3300025938 Bacteria 529
144 Ga0207711_10596568 3300025941 Bacteria 1030
145 Ga0207689_10398005 3300025942 Bacteria 1148
146 Ga0207661_10634510 3300025944 Bacteria 981
147 Ga0207667_10936252 3300025949 Bacteria 856
148 Ga0207712_10086793 3300025961 Bacteria 2293
149 Ga0207668_10101195 3300025972 Bacteria 2141
150 Ga0207640_10188348 3300025981 Bacteria 1553
151 Ga0207658_10962517 3300025986 Bacteria 778
152 Ga0207677_10171864 3300026023 Bacteria 1695
153 Ga0207678_10397007 3300026067 Bacteria 1194
154 Ga0207708_10022857 3300026075 Bacteria 4722
155 Ga0207702_10651916 3300026078 Bacteria 1035
156 Ga0207641_10321712 3300026088 Bacteria 1467
157 Ga0207648_10248206 3300026089 Bacteria 1586
158 Ga0207676_10499895 3300026095 Bacteria 1154
159 Ga0207674_10166683 3300026116 Bacteria 2157
160 Ga0207675_100010350 3300026118 Bacteria 8741
161 Ga0207675_100310136 3300026118 Bacteria 1539
162 Ga0207675_101009770 3300026118 Bacteria 850
163 Ga0207428_10374843 3300027907 Bacteria 1045
164 Ga0268266_10573506 3300028379 Bacteria 1082
165 Ga0268265_10201871 3300028380 Bacteria 1725
166 Ga0268265_10317977 3300028380 Bacteria 1408
167 Ga0268265_10339841 3300028380 Bacteria 1367
168 Ga0268264_10356315 3300028381 Bacteria 1394
169 Ga0265337_1001815 3300028556 Bacteria 10247
170 Ga0265326_10001279 3300028558 Bacteria 8925
171 Ga0265319_1000796 3300028563 Bacteria 20409
172 Ga0265318_10000961 3300028577 Bacteria 18489
173 Ga0265322_10007430 3300028654 Bacteria 3198
174 Ga0265336_10000060 3300028666 Bacteria 103055
175 Ga0265338_10000234 3300028800 Bacteria 103028
176 Ga0265324_10007611 3300029957 Bacteria 4372
177 Ga0265332_10337313 3300031238 Bacteria 622
178 Ga0265320_10055930 3300031240 Bacteria 1898
179 Ga0265340_10000014 3300031247 Bacteria 103055
180 Ga0265327_10014680 3300031251 Bacteria 5110
181 Ga0265316_10046033 3300031344 Bacteria 3460
182 Ga0307405_10740766 3300031731 Bacteria 818
183 Ga0307406_10180856 3300031901 Bacteria 1535
184 Ga0307406_10421872 3300031901 Bacteria 1063
185 Ga0307406_10511979 3300031901 Bacteria 975
186 Ga0307416_103683404 3300032002 Unclassified 513
187 Ga0307415_100250720 3300032126 Bacteria 1438
188 Ga0307415_101405223 3300032126 Bacteria 665
189 Ga0373935_0395524 3300035692 Bacteria 992
190 Ga0373925_0055658 3300037068 Bacteria 2962
191 Ga0395900_0058250 3300037418 Bacteria 3977
192 Ga0395900_0151175 3300037418 Bacteria 2372
193 Ga0395905_1426011 3300037471 Bacteria 597
194 Ga0395901_0139212 3300038443 Bacteria 2551
195 Ga0395901_0170969 3300038443 Bacteria 2280
196 Ga0395901_0249890 3300038443 Bacteria 1848
197 Ga0436360_1087594 3300039438 Bacteria 767
198 Ga0436362_0524843 3300039453 Bacteria 540
199 Ga0451797_0258303 3300041453 Bacteria 591
200 Ga0466963_1307479 3300044694 Unclassified 509
201 Ga0466960_0009744 3300044901 Bacteria 3973
202 Ga0466960_0081005 3300044901 Bacteria 1636
203 Ga0466960_0206605 3300044901 Bacteria 1075
204 Ga0466967_0074790 3300045976 Bacteria 3043
205 Ga0466967_1221954 3300045976 Bacteria 749
206 Ga0466967_1846537 3300045976 Bacteria 601
207 Ga0495641_0205136 3300046461 Bacteria 884
208 Ga0495653_0000231 3300046463 Bacteria 45492
209 Ga0495664_0000086 3300046477 Bacteria 45525
210 Ga0495608_0457690 3300046511 Bacteria 776
211 Ga0495618_0000054 3300046514 Bacteria 83787
212 Ga0495630_0049784 3300046517 Bacteria 3135
213 Ga0495666_0073461 3300046526 Bacteria 1623
214 Ga0495652_0109720 3300046529 Bacteria 2221
215 Ga0495657_0000006 3300046675 Bacteria 250610
216 Ga0495646_0066231 3300046680 Bacteria 2137
217 Ga0495646_0090741 3300046680 Bacteria 1765
218 Ga0495647_0181415 3300046681 Bacteria 916
219 Ga0495589_0092064 3300046794 Bacteria 1472
220 Ga0495600_0015795 3300046809 Bacteria 4780
221 Ga0495604_0097005 3300047317 Bacteria 2174
222 Ga0495676_0038900 3300047321 Bacteria 3946
223 Ga0495680_0260086 3300047322 Bacteria 1228
224 Ga0495684_0007653 3300047471 Bacteria 8360
225 Ga0496100_0267665 3300048903 Bacteria 1269
226 Ga0496101_0256454 3300048904 Bacteria 1363
227 Ga0496102_0000096 3300048905 Bacteria 124941
228 Ga0496102_0206782 3300048905 Bacteria 1850
229 Ga0496103_0000035 3300048906 Bacteria 182242
230 Ga0496104_0000028 3300048907 Bacteria 203377
231 Ga0496105_0108458 3300048908 Bacteria 2292
232 Ga0496105_0290686 3300048908 Bacteria 1316
233 Ga0496106_0021569 3300048909 Bacteria 4783
234 Ga0496106_0123903 3300048909 Bacteria 2022
235 Ga0496106_0332164 3300048909 Bacteria 1220
236 Ga0496106_0875818 3300048909 Bacteria 710
237 Ga0496106_0928210 3300048909 Unclassified 686
238 Ga0496107_0001197 3300048910 Bacteria 15807
239 Ga0496107_0318033 3300048910 Bacteria 1158
240 Ga0496109_0099041 3300048912 Bacteria 2703
241 Ga0496110_0001995 3300048913 Bacteria 15182
242 Ga0496110_0333662 3300048913 Bacteria 1381
243 Ga0496111_0001859 3300048914 Bacteria 12460
244 Ga0496111_0071374 3300048914 Bacteria 2527
245 Ga0496112_0117109 3300048915 Bacteria 2634
246 Ga0496115_0036332 3300048918 Bacteria 3900
247 Ga0496115_0153018 3300048918 Bacteria 1905
248 Ga0501034_0391467 3300049571 Bacteria 1314
249 Ga0501034_0646148 3300049571 Bacteria 960
250 Ga0501047_0677802 3300049581 Bacteria 849
251 Ga0501070_0446012 3300049586 Bacteria 1044
252 nmdc:mga08y16_225351_c1 3300050511 Bacteria 1940
253 nmdc:mga0n895_861634_c1 3300050512 Bacteria 893
254 nmdc:mga0rr50_972366_c1 3300050513 Bacteria 723
255 nmdc:mga0a205_676916_c1 3300050515 Bacteria 882
256 Ga0495601_0000673 3300053077 Bacteria 18239
257 Ga0495601_0047138 3300053077 Bacteria 2713
258 Ga0495612_0000049 3300053078 Bacteria 54959
259 Ga0495619_0118055 3300053085 Bacteria 1817
260 Ga0587106_166389 3300059605 Bacteria 500

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300059605 Ga0587106_166389 Ga0587106_166389_134_463 102
2 3300005329 Ga0070683_100662272 Ga0070683_1006622721 107
3 3300005458 Ga0070681_10507841 Ga0070681_105078412 107
4 3300025944 Ga0207661_10634510 Ga0207661_106345101 107
5 3300028380 Ga0268265_10339841 Ga0268265_103398413 107
6 3300041453 Ga0451797_0258303 Ga0451797_0258303_219_542 107
7 3300039438 Ga0436360_1087594 Ga0436360_1087594_247_669 119
8 3300044901 Ga0466960_0009744 Ga0466960_0009744_2517_2897 124
9 3300005548 Ga0070665_100606131 Ga0070665_1006061312 125
10 3300014968 Ga0157379_10005656 Ga0157379_100056569 125
11 3300020082 Ga0206353_10910689 Ga0206353_109106892 125
12 3300028379 Ga0268266_10573506 Ga0268266_105735063 125
13 3300048908 Ga0496105_0290686 Ga0496105_0290686_686_1075 125
14 3300049571 Ga0501034_0646148 Ga0501034_0646148_111_494 127
15 3300049581 Ga0501047_0677802 Ga0501047_0677802_260_643 127
16 3300049586 Ga0501070_0446012 Ga0501070_0446012_170_553 127
17 3300045976 Ga0466967_1221954 Ga0466967_1221954_293_679 128
18 3300049571 Ga0501034_0391467 Ga0501034_0391467_492_878 128
19 3300005439 Ga0070711_100001500 Ga0070711_1000015003 129
20 3300005439 Ga0070711_100653827 Ga0070711_1006538272 129
21 3300005535 Ga0070684_100047879 Ga0070684_1000478792 129
22 3300006028 Ga0070717_10610416 Ga0070717_106104161 129
23 3300009545 Ga0105237_12047809 Ga0105237_120478091 129
24 3300013297 Ga0157378_11455243 Ga0157378_114552431 129
25 3300025915 Ga0207693_10053979 Ga0207693_100539794 129
26 3300025916 Ga0207663_10001162 Ga0207663_1000116216 129
27 3300025916 Ga0207663_10220237 Ga0207663_102202373 129
28 3300028556 Ga0265337_1001815 Ga0265337_10018154 129
29 3300028558 Ga0265326_10001279 Ga0265326_100012795 129
30 3300028563 Ga0265319_1000796 Ga0265319_10007966 129
31 3300028577 Ga0265318_10000961 Ga0265318_100009618 129
32 3300028654 Ga0265322_10007430 Ga0265322_100074304 129
33 3300028666 Ga0265336_10000060 Ga0265336_1000006093 129
34 3300028800 Ga0265338_10000234 Ga0265338_1000023494 129
35 3300029957 Ga0265324_10007611 Ga0265324_100076114 129
36 3300031238 Ga0265332_10337313 Ga0265332_103373132 129
37 3300031240 Ga0265320_10055930 Ga0265320_100559302 129
38 3300031247 Ga0265340_10000014 Ga0265340_1000001420 129
39 3300031344 Ga0265316_10046033 Ga0265316_100460332 129
40 3300031731 Ga0307405_10740766 Ga0307405_107407663 129
41 3300031901 Ga0307406_10180856 Ga0307406_101808563 129
42 3300035692 Ga0373935_0395524 Ga0373935_0395524_192_605 129
43 3300037068 Ga0373925_0055658 Ga0373925_0055658_72_485 129
44 3300037418 Ga0395900_0058250 Ga0395900_0058250_3487_3894 129
45 3300037418 Ga0395900_0151175 Ga0395900_0151175_292_693 129
46 3300037471 Ga0395905_1426011 Ga0395905_1426011_133_546 129
47 3300038443 Ga0395901_0170969 Ga0395901_0170969_689_1096 129
48 3300044694 Ga0466963_1307479 Ga0466963_1307479_36_443 129
49 3300046463 Ga0495653_0000231 Ga0495653_0000231_33292_33705 129
50 3300046514 Ga0495618_0000054 Ga0495618_0000054_24984_25397 129
51 3300046517 Ga0495630_0049784 Ga0495630_0049784_2677_3096 129
52 3300046526 Ga0495666_0073461 Ga0495666_0073461_713_1126 129
53 3300046675 Ga0495657_0000006 Ga0495657_0000006_149629_150048 129
54 3300046680 Ga0495646_0090741 Ga0495646_0090741_832_1257 129
55 3300046681 Ga0495647_0181415 Ga0495647_0181415_53_466 129
56 3300047321 Ga0495676_0038900 Ga0495676_0038900_2136_2549 129
57 3300047471 Ga0495684_0007653 Ga0495684_0007653_7733_8152 129
58 3300053078 Ga0495612_0000049 Ga0495612_0000049_47244_47657 129
59 3300006028 Ga0070717_10931590 Ga0070717_109315901 130
60 3300009093 Ga0105240_10046441 Ga0105240_100464413 130
61 3300020081 Ga0206354_10419973 Ga0206354_104199731 130
62 3300025913 Ga0207695_10014458 Ga0207695_100144583 130
63 3300031251 Ga0265327_10014680 Ga0265327_100146804 130
64 3300046477 Ga0495664_0000086 Ga0495664_0000086_22413_22838 130
65 3300046511 Ga0495608_0457690 Ga0495608_0457690_138_593 130
66 3300046529 Ga0495652_0109720 Ga0495652_0109720_881_1303 130
67 3300046680 Ga0495646_0066231 Ga0495646_0066231_1338_1763 130
68 3300046809 Ga0495600_0015795 Ga0495600_0015795_2104_2559 130
69 3300047317 Ga0495604_0097005 Ga0495604_0097005_1248_1673 130
70 3300047322 Ga0495680_0260086 Ga0495680_0260086_797_1216 130
71 3300048905 Ga0496102_0000096 Ga0496102_0000096_71853_72275 130
72 3300048906 Ga0496103_0000035 Ga0496103_0000035_71666_72088 130
73 3300048907 Ga0496104_0000028 Ga0496104_0000028_3828_4253 130
74 3300048913 Ga0496110_0001995 Ga0496110_0001995_361_786 130
75 3300048914 Ga0496111_0001859 Ga0496111_0001859_8302_8727 130
76 3300053077 Ga0495601_0000673 Ga0495601_0000673_14156_14587 130
77 3300053077 Ga0495601_0047138 Ga0495601_0047138_1964_2386 130
78 3300053085 Ga0495619_0118055 Ga0495619_0118055_14_466 130
79 3300003323 rootH1_10180553 rootH1_101805531 131
80 3300045976 Ga0466967_1846537 Ga0466967_1846537_160_564 131
81 3300005353 Ga0070669_100618031 Ga0070669_1006180313 132
82 3300005367 Ga0070667_101638938 Ga0070667_1016389381 132
83 3300005434 Ga0070709_10545685 Ga0070709_105456851 132
84 3300005435 Ga0070714_101178399 Ga0070714_1011783991 132
85 3300005436 Ga0070713_100240989 Ga0070713_1002409892 132
86 3300005458 Ga0070681_11919895 Ga0070681_119198951 132
87 3300009148 Ga0105243_10608659 Ga0105243_106086591 132
88 3300014969 Ga0157376_10539588 Ga0157376_105395882 132
89 3300020082 Ga0206353_10253719 Ga0206353_102537193 132
90 3300025906 Ga0207699_10428922 Ga0207699_104289222 132
91 3300025934 Ga0207686_10545298 Ga0207686_105452983 132
92 3300025938 Ga0207704_11785636 Ga0207704_117856361 132
93 3300032126 Ga0307415_101405223 Ga0307415_1014052232 132
94 3300038443 Ga0395901_0139212 Ga0395901_0139212_296_694 132
95 3300038443 Ga0395901_0249890 Ga0395901_0249890_25_423 132
96 3300039453 Ga0436362_0524843 Ga0436362_0524843_86_517 132
97 3300046794 Ga0495589_0092064 Ga0495589_0092064_196_597 132
98 3300048910 Ga0496107_0001197 Ga0496107_0001197_928_1332 132
99 3300048918 Ga0496115_0036332 Ga0496115_0036332_1803_2207 132
100 3300002073 JGI24745J21846_1034542 JGI24745J21846_10345421 133
101 3300002077 JGI24744J21845_10045551 JGI24744J21845_100455512 133
102 3300005329 Ga0070683_100407141 Ga0070683_1004071412 133
103 3300005330 Ga0070690_100404950 Ga0070690_1004049503 133
104 3300005334 Ga0068869_100090816 Ga0068869_1000908164 133
105 3300005340 Ga0070689_100062254 Ga0070689_1000622545 133
106 3300005341 Ga0070691_10208774 Ga0070691_102087742 133
107 3300005343 Ga0070687_100044085 Ga0070687_1000440852 133
108 3300005344 Ga0070661_100218947 Ga0070661_1002189473 133
109 3300005345 Ga0070692_10192394 Ga0070692_101923941 133
110 3300005347 Ga0070668_100319432 Ga0070668_1003194321 133
111 3300005353 Ga0070669_100561123 Ga0070669_1005611232 133
112 3300005356 Ga0070674_100180627 Ga0070674_1001806273 133
113 3300005365 Ga0070688_101395854 Ga0070688_1013958541 133
114 3300005366 Ga0070659_100062914 Ga0070659_1000629144 133
115 3300005367 Ga0070667_100083799 Ga0070667_1000837992 133
116 3300005437 Ga0070710_10226808 Ga0070710_102268083 133
117 3300005439 Ga0070711_100181399 Ga0070711_1001813993 133
118 3300005440 Ga0070705_100082905 Ga0070705_1000829053 133
119 3300005441 Ga0070700_100187590 Ga0070700_1001875903 133
120 3300005444 Ga0070694_100451854 Ga0070694_1004518542 133
121 3300005455 Ga0070663_100076623 Ga0070663_1000766233 133
122 3300005456 Ga0070678_100044344 Ga0070678_1000443444 133
123 3300005457 Ga0070662_100166480 Ga0070662_1001664803 133
124 3300005458 Ga0070681_11080683 Ga0070681_110806831 133
125 3300005466 Ga0070685_10024228 Ga0070685_100242285 133
126 3300005535 Ga0070684_101995860 Ga0070684_1019958601 133
127 3300005544 Ga0070686_100623026 Ga0070686_1006230262 133
128 3300005547 Ga0070693_100268064 Ga0070693_1002680642 133
129 3300005548 Ga0070665_100114028 Ga0070665_1001140284 133
130 3300005549 Ga0070704_100208328 Ga0070704_1002083284 133
131 3300005564 Ga0070664_100182320 Ga0070664_1001823202 133
132 3300005564 Ga0070664_100520653 Ga0070664_1005206532 133
133 3300005578 Ga0068854_100806650 Ga0068854_1008066502 133
134 3300005614 Ga0068856_100205204 Ga0068856_1002052043 133
135 3300005615 Ga0070702_100140126 Ga0070702_1001401262 133
136 3300005615 Ga0070702_100322947 Ga0070702_1003229472 133
137 3300005616 Ga0068852_100185413 Ga0068852_1001854134 133
138 3300005617 Ga0068859_100043865 Ga0068859_1000438653 133
139 3300005718 Ga0068866_10854601 Ga0068866_108546012 133
140 3300005719 Ga0068861_100060435 Ga0068861_1000604355 133
141 3300005719 Ga0068861_100223907 Ga0068861_1002239072 133
142 3300005719 Ga0068861_100932427 Ga0068861_1009324272 133
143 3300005834 Ga0068851_10045205 Ga0068851_100452053 133
144 3300005840 Ga0068870_10155637 Ga0068870_101556373 133
145 3300005841 Ga0068863_100218274 Ga0068863_1002182743 133
146 3300005842 Ga0068858_100125311 Ga0068858_1001253112 133
147 3300005844 Ga0068862_100409890 Ga0068862_1004098903 133
148 3300006163 Ga0070715_10182553 Ga0070715_101825532 133
149 3300006173 Ga0070716_100809866 Ga0070716_1008098662 133
150 3300006175 Ga0070712_100011732 Ga0070712_1000117324 133
151 3300006358 Ga0068871_100357704 Ga0068871_1003577043 133
152 3300006844 Ga0075428_102610461 Ga0075428_1026104611 133
153 3300006852 Ga0075433_10954097 Ga0075433_109540972 133
154 3300006881 Ga0068865_100120543 Ga0068865_1001205434 133
155 3300006931 Ga0097620_100043865 Ga0097620_1000438653 133
156 3300007076 Ga0075435_101337538 Ga0075435_1013375382 133
157 3300009094 Ga0111539_10322939 Ga0111539_103229393 133
158 3300009094 Ga0111539_10520526 Ga0111539_105205262 133
159 3300009098 Ga0105245_10082027 Ga0105245_100820275 133
160 3300009098 Ga0105245_10157843 Ga0105245_101578432 133
161 3300009148 Ga0105243_10068426 Ga0105243_100684265 133
162 3300009148 Ga0105243_10088188 Ga0105243_100881884 133
163 3300009174 Ga0105241_10142534 Ga0105241_101425344 133
164 3300009176 Ga0105242_10137973 Ga0105242_101379734 133
165 3300009177 Ga0105248_10958112 Ga0105248_109581122 133
166 3300009545 Ga0105237_10343335 Ga0105237_103433353 133
167 3300009553 Ga0105249_10066037 Ga0105249_100660373 133
168 3300010375 Ga0105239_10125636 Ga0105239_101256365 133
169 3300010375 Ga0105239_10213631 Ga0105239_102136313 133
170 3300010375 Ga0105239_11225562 Ga0105239_112255621 133
171 3300011119 Ga0105246_10038192 Ga0105246_100381923 133
172 3300013102 Ga0157371_10231443 Ga0157371_102314432 133
173 3300013105 Ga0157369_12071124 Ga0157369_120711241 133
174 3300013296 Ga0157374_11124397 Ga0157374_111243972 133
175 3300013297 Ga0157378_10281713 Ga0157378_102817132 133
176 3300013306 Ga0163162_10043685 Ga0163162_100436852 133
177 3300013306 Ga0163162_10593112 Ga0163162_105931121 133
178 3300013307 Ga0157372_10440074 Ga0157372_104400743 133
179 3300013308 Ga0157375_10357294 Ga0157375_103572942 133
180 3300013308 Ga0157375_11610191 Ga0157375_116101912 133
181 3300014325 Ga0163163_10204835 Ga0163163_102048353 133
182 3300014325 Ga0163163_10273630 Ga0163163_102736303 133
183 3300014326 Ga0157380_10768542 Ga0157380_107685422 133
184 3300014497 Ga0182008_10129960 Ga0182008_101299602 133
185 3300014745 Ga0157377_10034398 Ga0157377_100343984 133
186 3300014745 Ga0157377_11115299 Ga0157377_111152991 133
187 3300014968 Ga0157379_10089872 Ga0157379_100898722 133
188 3300014969 Ga0157376_10294415 Ga0157376_102944153 133
189 3300017792 Ga0163161_10203905 Ga0163161_102039052 133
190 3300020080 Ga0206350_10154106 Ga0206350_101541063 133
191 3300025898 Ga0207692_10015258 Ga0207692_100152585 133
192 3300025899 Ga0207642_10064200 Ga0207642_100642004 133
193 3300025900 Ga0207710_10068786 Ga0207710_100687863 133
194 3300025905 Ga0207685_10159710 Ga0207685_101597103 133
195 3300025908 Ga0207643_10115416 Ga0207643_101154163 133
196 3300025911 Ga0207654_10112381 Ga0207654_101123811 133
197 3300025912 Ga0207707_11095195 Ga0207707_110951951 133
198 3300025914 Ga0207671_10328398 Ga0207671_103283982 133
199 3300025915 Ga0207693_10027758 Ga0207693_100277582 133
200 3300025916 Ga0207663_10149861 Ga0207663_101498613 133
201 3300025919 Ga0207657_10047518 Ga0207657_100475184 133
202 3300025920 Ga0207649_10937641 Ga0207649_109376411 133
203 3300025927 Ga0207687_10053372 Ga0207687_100533723 133
204 3300025927 Ga0207687_10240421 Ga0207687_102404212 133
205 3300025931 Ga0207644_10749197 Ga0207644_107491972 133
206 3300025932 Ga0207690_10200706 Ga0207690_102007063 133
207 3300025933 Ga0207706_10120341 Ga0207706_101203413 133
208 3300025934 Ga0207686_10083731 Ga0207686_100837313 133
209 3300025935 Ga0207709_10121467 Ga0207709_101214673 133
210 3300025936 Ga0207670_10048526 Ga0207670_100485264 133
211 3300025937 Ga0207669_10117629 Ga0207669_101176293 133
212 3300025941 Ga0207711_10596568 Ga0207711_105965682 133
213 3300025942 Ga0207689_10398005 Ga0207689_103980052 133
214 3300025949 Ga0207667_10936252 Ga0207667_109362521 133
215 3300025961 Ga0207712_10086793 Ga0207712_100867933 133
216 3300025972 Ga0207668_10101195 Ga0207668_101011953 133
217 3300025981 Ga0207640_10188348 Ga0207640_101883482 133
218 3300025986 Ga0207658_10962517 Ga0207658_109625172 133
219 3300026023 Ga0207677_10171864 Ga0207677_101718642 133
220 3300026067 Ga0207678_10397007 Ga0207678_103970073 133
221 3300026075 Ga0207708_10022857 Ga0207708_100228574 133
222 3300026078 Ga0207702_10651916 Ga0207702_106519162 133
223 3300026088 Ga0207641_10321712 Ga0207641_103217123 133
224 3300026089 Ga0207648_10248206 Ga0207648_102482063 133
225 3300026095 Ga0207676_10499895 Ga0207676_104998952 133
226 3300026116 Ga0207674_10166683 Ga0207674_101666834 133
227 3300026118 Ga0207675_100010350 Ga0207675_1000103502 133
228 3300026118 Ga0207675_100310136 Ga0207675_1003101363 133
229 3300026118 Ga0207675_101009770 Ga0207675_1010097702 133
230 3300027907 Ga0207428_10374843 Ga0207428_103748432 133
231 3300028380 Ga0268265_10201871 Ga0268265_102018713 133
232 3300028380 Ga0268265_10317977 Ga0268265_103179772 133
233 3300028381 Ga0268264_10356315 Ga0268264_103563153 133
234 3300031901 Ga0307406_10421872 Ga0307406_104218723 133
235 3300031901 Ga0307406_10511979 Ga0307406_105119792 133
236 3300032002 Ga0307416_103683404 Ga0307416_1036834041 133
237 3300032126 Ga0307415_100250720 Ga0307415_1002507201 133
238 3300044901 Ga0466960_0081005 Ga0466960_0081005_249_653 133
239 3300044901 Ga0466960_0206605 Ga0466960_0206605_240_641 133
240 3300045976 Ga0466967_0074790 Ga0466967_0074790_111_518 133
241 3300046461 Ga0495641_0205136 Ga0495641_0205136_234_635 133
242 3300048903 Ga0496100_0267665 Ga0496100_0267665_624_1025 133
243 3300048904 Ga0496101_0256454 Ga0496101_0256454_663_1067 133
244 3300048905 Ga0496102_0206782 Ga0496102_0206782_180_581 133
245 3300048908 Ga0496105_0108458 Ga0496105_0108458_1312_1713 133
246 3300048909 Ga0496106_0021569 Ga0496106_0021569_3238_3639 133
247 3300048909 Ga0496106_0123903 Ga0496106_0123903_177_578 133
248 3300048909 Ga0496106_0332164 Ga0496106_0332164_502_903 133
249 3300048909 Ga0496106_0875818 Ga0496106_0875818_198_602 133
250 3300048909 Ga0496106_0928210 Ga0496106_0928210_79_480 133
251 3300048910 Ga0496107_0318033 Ga0496107_0318033_367_768 133
252 3300048912 Ga0496109_0099041 Ga0496109_0099041_1313_1714 133
253 3300048913 Ga0496110_0333662 Ga0496110_0333662_253_654 133
254 3300048914 Ga0496111_0071374 Ga0496111_0071374_550_951 133
255 3300048915 Ga0496112_0117109 Ga0496112_0117109_1244_1645 133
256 3300048918 Ga0496115_0153018 Ga0496115_0153018_775_1176 133
257 3300050511 nmdc:mga08y16_225351_c1 nmdc:mga08y16_225351_c1_505_906 133
258 3300050512 nmdc:mga0n895_861634_c1 nmdc:mga0n895_861634_c1_233_634 133
259 3300050513 nmdc:mga0rr50_972366_c1 nmdc:mga0rr50_972366_c1_49_450 133
260 3300050515 nmdc:mga0a205_676916_c1 nmdc:mga0a205_676916_c1_269_670 133

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14464

Prok-JAB

Prokaryotic homologs of the JAB domain

20

141

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
1oi0-assembly3.cif.gz_C crystal structure of af2198, a jab1/mpn domain protein from archaeoglobus fulgidus 0.8593 1 133
5ld9-assembly1.cif.gz_B structure of deubiquitinating enzyme homolog, pyrococcus furiosus jamm1. 0.8524 1 133
1oi0-assembly1.cif.gz_A crystal structure of af2198, a jab1/mpn domain protein from archaeoglobus fulgidus 0.8464 1 133
5ld9-assembly1.cif.gz_A structure of deubiquitinating enzyme homolog, pyrococcus furiosus jamm1. 0.8416 2 133
5ld9-assembly1.cif.gz_B structure of deubiquitinating enzyme homolog, pyrococcus furiosus jamm1. 0.8402 1 133
ID Description Score Start End Superfamily
af_P9WHS1_10_146_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.8986 1 133 3.40.140.10
af_P9WHS1_10_146_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.8923 1 133 3.40.140.10
2kksA00 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.8219 2 133 3.40.140.10
1r5xB00 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.818 1 133 3.40.140.10
af_Q54Z40_718_975_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.8138 2 133 3.40.140.10
ID Description Score Start End GO Terms
AF-A0A537XDZ2-F1-model_v4 M67 family metallopeptidase 0.9664 1 133 GO:0006508
GO:0008235
GO:0008270
AF-A0A537XDZ2-F1-model_v4 M67 family metallopeptidase 0.9592 1 133 GO:0006508
GO:0008235
GO:0008270
AF-D3F2A1-F1-model_v4 Mov34/MPN/PAD-1 family protein 0.9548 1 133 GO:0006508
GO:0008235
GO:0008270
AF-A0A1G1HZ05-F1-model_v4 MPN domain-containing protein 0.9535 4 132 GO:0006508
GO:0008235
GO:0008270
AF-A0A4S1CHJ1-F1-model_v4 M67 family peptidase 0.9532 1 133 GO:0006508
GO:0008235
GO:0008270

Feature Viewer

pLDDT pTM Quality
92.12 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map