F369353

General Info

Members Datasets Scaffolds Average Seq Length
260 172 520 153

Family's Representative Sequence

Representative Sequence 3300005406|Ga0070703_10042520|Ga0070703_100425202
Length 172
Sequence MDLRPCLTLDYARMAATTRLYLEDFAPGQRYGTGKVRIDAAAIKAFAAAFDPQPFHLDEEAARASFFGGLSASGWHTAALTMRLLVEGGLRPAGGIIGTRADELKWPRAVRPDDELEVEVEILEVRSSASRPGQGYVKCRTTTLNQRREPVQVLVMNLLVDARSPSPPGPPR

Samples

Sample ID Description Type Environment
1 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
50 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
51 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
52 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
53 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
54 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
55 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
56 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
57 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
88 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
89 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
129 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
132 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
133 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
134 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
135 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
136 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
137 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
138 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
139 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
140 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
141 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
142 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
143 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
144 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
145 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
146 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
147 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
148 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
149 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
150 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
151 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
152 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
153 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
154 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
155 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
156 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
157 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
158 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
159 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
160 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
161 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
162 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
163 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
164 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
165 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
166 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
167 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
168 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
169 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
170 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
171 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
172 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.85
Nodule 0
Rhizoplane 4.23
Rhizosphere 91.15
Stem 0
Stem Tuber 0
Unclassified 3.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070703_10042520 3300005406 Bacteria 1421
2 Ga0070676_10272244 3300005328 Bacteria 1138
3 Ga0070690_100240843 3300005330 Bacteria 1275
4 Ga0068869_100190610 3300005334 Bacteria 1612
5 Ga0068869_100278637 3300005334 Bacteria 1344
6 Ga0070666_10348469 3300005335 Bacteria 1059
7 Ga0070680_100629903 3300005336 Bacteria 921
8 Ga0068868_101128925 3300005338 Bacteria 722
9 Ga0068868_101496446 3300005338 Bacteria 632
10 Ga0070689_100020805 3300005340 Bacteria 4875
11 Ga0070689_100059814 3300005340 Bacteria 2961
12 Ga0070687_100164983 3300005343 Bacteria 1313
13 Ga0070687_100228568 3300005343 Bacteria 1144
14 Ga0070661_100555688 3300005344 Bacteria 924
15 Ga0070661_101541080 3300005344 Bacteria 561
16 Ga0070692_10142916 3300005345 Bacteria 1356
17 Ga0070668_100203822 3300005347 Bacteria 1625
18 Ga0070669_100294955 3300005353 Bacteria 1303
19 Ga0070669_100351158 3300005353 Bacteria 1197
20 Ga0070675_100251326 3300005354 Bacteria 1547
21 Ga0070674_100554565 3300005356 Bacteria 965
22 Ga0070673_100057698 3300005364 Bacteria 3068
23 Ga0070673_100134280 3300005364 Bacteria 2081
24 Ga0070673_100411059 3300005364 Bacteria 1211
25 Ga0070688_100070446 3300005365 Bacteria 2236
26 Ga0070667_100420075 3300005367 Bacteria 1219
27 Ga0070667_101211507 3300005367 Bacteria 707
28 Ga0070701_10044364 3300005438 Bacteria 2277
29 Ga0070700_100045606 3300005441 Bacteria 2704
30 Ga0070694_100338065 3300005444 Bacteria 1163
31 Ga0070708_100003766 3300005445 Bacteria 11903
32 Ga0070708_100065849 3300005445 Bacteria 3250
33 Ga0070708_100101828 3300005445 Bacteria 2631
34 Ga0070708_100278260 3300005445 Unclassified 1575
35 Ga0070708_100287804 3300005445 Unclassified 1547
36 Ga0070708_101274443 3300005445 Bacteria 687
37 Ga0070663_100465906 3300005455 Bacteria 1044
38 Ga0070678_100468975 3300005456 Bacteria 1106
39 Ga0070662_100201775 3300005457 Bacteria 1578
40 Ga0068867_100137320 3300005459 Bacteria 1907
41 Ga0070706_100003898 3300005467 Bacteria 14550
42 Ga0070706_100034719 3300005467 Bacteria 4658
43 Ga0070706_100201494 3300005467 Bacteria 1859
44 Ga0070706_100274295 3300005467 Bacteria 1574
45 Ga0070707_100942804 3300005468 Bacteria 828
46 Ga0070698_100037071 3300005471 Bacteria 5029
47 Ga0070698_100080977 3300005471 Bacteria 3242
48 Ga0070699_100061236 3300005518 Bacteria 3262
49 Ga0070699_100104459 3300005518 Bacteria 2484
50 Ga0070699_100244464 3300005518 Bacteria 1602
51 Ga0070699_100249819 3300005518 Bacteria 1584
52 Ga0070699_100372005 3300005518 Bacteria 1289
53 Ga0070697_101449949 3300005536 Bacteria 613
54 Ga0070672_100019252 3300005543 Bacteria 4951
55 Ga0070672_100239710 3300005543 Bacteria 1525
56 Ga0070686_100045140 3300005544 Bacteria 2774
57 Ga0070686_101066572 3300005544 Unclassified 666
58 Ga0070695_100221674 3300005545 Bacteria 1363
59 Ga0070696_100643056 3300005546 Bacteria 859
60 Ga0070665_100651726 3300005548 Bacteria 1066
61 Ga0070704_100152652 3300005549 Bacteria 1817
62 Ga0070704_100175955 3300005549 Bacteria 1707
63 Ga0070664_100521171 3300005564 Bacteria 1097
64 Ga0068857_100161068 3300005577 Bacteria 2036
65 Ga0068854_100097144 3300005578 Bacteria 2202
66 Ga0068854_100502923 3300005578 Bacteria 1021
67 Ga0068856_100210666 3300005614 Bacteria 1959
68 Ga0068859_100007128 3300005617 Bacteria 11346
69 Ga0068864_100107221 3300005618 Bacteria 2485
70 Ga0068864_100569197 3300005618 Bacteria 1097
71 Ga0068861_100056740 3300005719 Bacteria 2990
72 Ga0068861_100131564 3300005719 Bacteria 2031
73 Ga0068870_10084016 3300005840 Bacteria 1766
74 Ga0068863_100396307 3300005841 Bacteria 1350
75 Ga0068858_100112095 3300005842 Bacteria 2547
76 Ga0068858_100836106 3300005842 Bacteria 899
77 Ga0068858_101117899 3300005842 Bacteria 774
78 Ga0068860_100146142 3300005843 Bacteria 2275
79 Ga0075365_10034196 3300006038 Bacteria 3281
80 Ga0075368_10230823 3300006042 Bacteria 788
81 Ga0075363_100340164 3300006048 Bacteria 875
82 Ga0075364_10021424 3300006051 Bacteria 4073
83 Ga0070716_100190686 3300006173 Bacteria 1354
84 Ga0075362_10031027 3300006177 Bacteria 2311
85 Ga0075367_10001386 3300006178 Bacteria 10355
86 Ga0075366_10002156 3300006195 Bacteria 10028
87 Ga0075370_10332433 3300006353 Bacteria 906
88 Ga0068871_100337053 3300006358 Bacteria 1331
89 Ga0075428_100084695 3300006844 Bacteria 3458
90 Ga0075428_100198429 3300006844 Bacteria 2170
91 Ga0075428_100610614 3300006844 Bacteria 1164
92 Ga0075430_100108604 3300006846 Bacteria 2315
93 Ga0075431_100004916 3300006847 Bacteria 13166
94 Ga0075431_100242290 3300006847 Bacteria 1834
95 Ga0075431_100990151 3300006847 Bacteria 808
96 Ga0075433_10021108 3300006852 Bacteria 5457
97 Ga0075433_10178283 3300006852 Bacteria 1891
98 Ga0075433_10190030 3300006852 Bacteria 1827
99 Ga0075434_100036351 3300006871 Bacteria 4872
100 Ga0075434_100196303 3300006871 Bacteria 2038
101 Ga0075434_100674248 3300006871 Bacteria 1052
102 Ga0075429_100018003 3300006880 Bacteria 6110
103 Ga0068865_100035858 3300006881 Bacteria 3339
104 Ga0075436_100156675 3300006914 Unclassified 1604
105 Ga0097620_100007128 3300006931 Bacteria 11346
106 Ga0075435_100040988 3300007076 Bacteria 3700
107 Ga0075435_100230634 3300007076 Bacteria 1573
108 Ga0075435_100288367 3300007076 Bacteria 1402
109 Ga0099794_10003798 3300007265 Bacteria 5831
110 Ga0105240_10017253 3300009093 Bacteria 9738
111 Ga0111539_10001969 3300009094 Bacteria 27430
112 Ga0111539_10693992 3300009094 Bacteria 1185
113 Ga0111539_13302231 3300009094 Bacteria 519
114 Ga0105245_10367974 3300009098 Bacteria 1428
115 Ga0105245_10472330 3300009098 Bacteria 1266
116 Ga0114129_10022616 3300009147 Bacteria 8917
117 Ga0114129_10070337 3300009147 Bacteria 4880
118 Ga0114129_10177460 3300009147 Bacteria 2901
119 Ga0114129_10371719 3300009147 Bacteria 1889
120 Ga0114129_11774576 3300009147 Bacteria 751
121 Ga0105243_10311322 3300009148 Bacteria 1431
122 Ga0105242_10329669 3300009176 Bacteria 1403
123 Ga0105248_10034184 3300009177 Bacteria 5683
124 Ga0105248_10160687 3300009177 Bacteria 2534
125 Ga0105248_10206041 3300009177 Bacteria 2216
126 Ga0105248_10214596 3300009177 Bacteria 2168
127 Ga0105238_11315556 3300009551 Bacteria 749
128 Ga0105249_10158653 3300009553 Bacteria 2184
129 Ga0105249_10840224 3300009553 Bacteria 983
130 Ga0157378_10189327 3300013297 Bacteria 1940
131 Ga0163162_10145490 3300013306 Bacteria 2486
132 Ga0163162_10446212 3300013306 Bacteria 1426
133 Ga0157375_10506417 3300013308 Bacteria 1371
134 Ga0163163_11648710 3300014325 Bacteria 702
135 Ga0157380_10207681 3300014326 Bacteria 1743
136 Ga0157380_12325204 3300014326 Bacteria 601
137 Ga0157377_10161082 3300014745 Bacteria 1395
138 Ga0157379_10199028 3300014968 Bacteria 1811
139 Ga0157379_10211315 3300014968 Bacteria 1756
140 Ga0157379_10329747 3300014968 Bacteria 1394
141 Ga0157376_11239133 3300014969 Bacteria 775
142 Ga0213872_10000229 3300021361 Bacteria 49150
143 Ga0213871_10018265 3300021441 Bacteria 1714
144 Ga0207653_10167952 3300025885 Bacteria 815
145 Ga0207642_10035118 3300025899 Bacteria 2138
146 Ga0207642_10323527 3300025899 Bacteria 901
147 Ga0207710_10573633 3300025900 Bacteria 589
148 Ga0207680_10380382 3300025903 Bacteria 995
149 Ga0207645_10931670 3300025907 Bacteria 590
150 Ga0207684_10056724 3300025910 Bacteria 3323
151 Ga0207684_10077990 3300025910 Bacteria 2817
152 Ga0207684_10257458 3300025910 Bacteria 1506
153 Ga0207684_11032275 3300025910 Unclassified 687
154 Ga0207660_10593403 3300025917 Bacteria 902
155 Ga0207662_10009766 3300025918 Bacteria 5293
156 Ga0207662_10108115 3300025918 Bacteria 1731
157 Ga0207646_10004223 3300025922 Bacteria 15719
158 Ga0207646_10468219 3300025922 Bacteria 1136
159 Ga0207681_10228798 3300025923 Bacteria 1442
160 Ga0207659_10180176 3300025926 Bacteria 1673
161 Ga0207687_10235543 3300025927 Bacteria 1448
162 Ga0207687_10282904 3300025927 Bacteria 1330
163 Ga0207706_10398963 3300025933 Bacteria 1192
164 Ga0207686_10184484 3300025934 Bacteria 1482
165 Ga0207709_10204709 3300025935 Bacteria 1412
166 Ga0207709_10237718 3300025935 Bacteria 1323
167 Ga0207670_10027585 3300025936 Bacteria 3592
168 Ga0207669_10267844 3300025937 Bacteria 1281
169 Ga0207704_10014697 3300025938 Bacteria 3962
170 Ga0207665_10571534 3300025939 Bacteria 880
171 Ga0207691_10024938 3300025940 Bacteria 5619
172 Ga0207711_10012439 3300025941 Bacteria 7074
173 Ga0207711_10235118 3300025941 Bacteria 1679
174 Ga0207711_10242940 3300025941 Bacteria 1651
175 Ga0207689_10294013 3300025942 Bacteria 1346
176 Ga0207651_10001997 3300025960 Bacteria 9592
177 Ga0207651_10031379 3300025960 Bacteria 3396
178 Ga0207651_10352849 3300025960 Bacteria 1239
179 Ga0207712_10263135 3300025961 Bacteria 1400
180 Ga0207668_10283269 3300025972 Bacteria 1360
181 Ga0207640_10084482 3300025981 Bacteria 2180
182 Ga0207658_10346579 3300025986 Bacteria 1292
183 Ga0207677_10043437 3300026023 Bacteria 2988
184 Ga0207703_10136323 3300026035 Bacteria 2125
185 Ga0207678_10143672 3300026067 Bacteria 2037
186 Ga0207708_10215182 3300026075 Bacteria 1537
187 Ga0207641_10313577 3300026088 Bacteria 1485
188 Ga0207648_10007697 3300026089 Bacteria 10540
189 Ga0207676_10052272 3300026095 Bacteria 3193
190 Ga0207676_11048113 3300026095 Bacteria 805
191 Ga0207674_10506747 3300026116 Bacteria 1166
192 Ga0207674_11010034 3300026116 Bacteria 801
193 Ga0207675_100084614 3300026118 Bacteria 2976
194 Ga0207675_100243451 3300026118 Bacteria 1738
195 Ga0207675_100300660 3300026118 Bacteria 1563
196 Ga0207683_10390522 3300026121 Bacteria 1280
197 Ga0209588_1010979 3300027671 Unclassified 2730
198 Ga0209588_1020803 3300027671 Bacteria 2055
199 Ga0209974_10070461 3300027876 Bacteria 1192
200 Ga0207428_10003052 3300027907 Bacteria 16484
201 Ga0268265_10258541 3300028380 Bacteria 1546
202 Ga0268264_10190076 3300028381 Bacteria 1871
203 Ga0307515_10226411 3300028794 Bacteria 1674
204 Ga0373938_0106687 3300034957 Bacteria 709
205 Ga0373928_0026770 3300035084 Bacteria 1251
206 Ga0373928_0274006 3300035084 Bacteria 509
207 Ga0373929_0011587 3300035085 Bacteria 1664
208 Ga0373949_0239695 3300035090 Bacteria 557
209 Ga0373951_0014479 3300035091 Bacteria 1774
210 Ga0373932_0033802 3300035112 Bacteria 1438
211 Ga0373960_0104173 3300035121 Bacteria 923
212 Ga0373961_0281341 3300035241 Bacteria 610
213 Ga0373931_0011425 3300035691 Bacteria 4290
214 Ga0436360_0201004 3300039438 Bacteria 507
215 Ga0436360_0352877 3300039438 Bacteria 4435
216 Ga0436361_0590566 3300039447 Bacteria 41611
217 Ga0436361_1003279 3300039447 Bacteria 2464
218 Ga0436363_0124025 3300039450 Bacteria 777
219 Ga0436362_0318448 3300039453 Bacteria 1270
220 Ga0436362_0438714 3300039453 Unclassified 879
221 Ga0439465_0111469 3300041413 Bacteria 953
222 Ga0439449_0019693 3300042007 Bacteria 2529
223 Ga0439458_0156586 3300042157 Bacteria 612
224 Ga0453683_0389308 3300044673 Bacteria 898
225 Ga0451576_0477084 3300045051 Bacteria 1310
226 Ga0495669_0048141 3300046684 Bacteria 1906
227 Ga0495669_0144219 3300046684 Unclassified 1125
228 Ga0496100_0007779 3300048903 Bacteria 5942
229 Ga0496102_0010707 3300048905 Bacteria 7900
230 Ga0496104_0025553 3300048907 Bacteria 5445
231 Ga0496104_0106648 3300048907 Bacteria 2685
232 Ga0496105_0013536 3300048908 Bacteria 6480
233 Ga0496110_0058931 3300048913 Bacteria 3382
234 Ga0496111_0066600 3300048914 Bacteria 2616
235 Ga0496112_0068265 3300048915 Bacteria 3510
236 Ga0496113_0014240 3300048916 Bacteria 5421
237 Ga0496114_0013640 3300048917 Bacteria 6515
238 Ga0496115_0008781 3300048918 Bacteria 7491
239 Ga0501067_0648168 3300049583 Bacteria 593
240 nmdc:mga03683_35284_c1 3300050489 Bacteria 2028
241 nmdc:mga06z11_2114_c1 3300050494 Bacteria 7534
242 nmdc:mga05p37_1157525_c1 3300050507 Bacteria 804
243 nmdc:mga05p37_511861_c1 3300050507 Bacteria 1375
244 nmdc:mga05p37_70736_c1 3300050507 Bacteria 4292
245 nmdc:mga0qj67_109734_c1 3300050509 Bacteria 2227
246 nmdc:mga0qj67_202510_c1 3300050509 Bacteria 1612
247 nmdc:mga06r32_11341_c1 3300050510 Bacteria 8025
248 nmdc:mga06r32_1290344_c1 3300050510 Bacteria 674
249 nmdc:mga06r32_251359_c1 3300050510 Bacteria 1755
250 nmdc:mga08y16_383598_c1 3300050511 Bacteria 1440
251 nmdc:mga08y16_4660_c1 3300050511 Bacteria 14281
252 nmdc:mga0n895_136605_c1 3300050512 Bacteria 2478
253 nmdc:mga0n895_1564582_c1 3300050512 Bacteria 624
254 nmdc:mga0n895_667712_c1 3300050512 Bacteria 1037
255 nmdc:mga0rr50_146398_c1 3300050513 Bacteria 1905
256 nmdc:mga0rr50_61696_c1 3300050513 Bacteria 2825
257 nmdc:mga08x19_72129_c1 3300050514 Bacteria 2252
258 nmdc:mga0a205_126373_c1 3300050515 Bacteria 2457
259 nmdc:mga0a205_7691_c1 3300050515 Bacteria 9778
260 Ga0590075_023356 3300059424 Unclassified 1550
261 Ga0070703_10042520
262 Ga0070676_10272244
263 Ga0070690_100240843
264 Ga0068869_100190610
265 Ga0068869_100278637
266 Ga0070666_10348469
267 Ga0070680_100629903
268 Ga0068868_101128925
269 Ga0068868_101496446
270 Ga0070689_100020805
271 Ga0070689_100059814
272 Ga0070687_100164983
273 Ga0070687_100228568
274 Ga0070661_100555688
275 Ga0070661_101541080
276 Ga0070692_10142916
277 Ga0070668_100203822
278 Ga0070669_100294955
279 Ga0070669_100351158
280 Ga0070675_100251326
281 Ga0070674_100554565
282 Ga0070673_100057698
283 Ga0070673_100134280
284 Ga0070673_100411059
285 Ga0070688_100070446
286 Ga0070667_100420075
287 Ga0070667_101211507
288 Ga0070701_10044364
289 Ga0070700_100045606
290 Ga0070694_100338065
291 Ga0070708_100003766
292 Ga0070708_100065849
293 Ga0070708_100101828
294 Ga0070708_100278260
295 Ga0070708_100287804
296 Ga0070708_101274443
297 Ga0070663_100465906
298 Ga0070678_100468975
299 Ga0070662_100201775
300 Ga0068867_100137320
301 Ga0070706_100003898
302 Ga0070706_100034719
303 Ga0070706_100201494
304 Ga0070706_100274295
305 Ga0070707_100942804
306 Ga0070698_100037071
307 Ga0070698_100080977
308 Ga0070699_100061236
309 Ga0070699_100104459
310 Ga0070699_100244464
311 Ga0070699_100249819
312 Ga0070699_100372005
313 Ga0070697_101449949
314 Ga0070672_100019252
315 Ga0070672_100239710
316 Ga0070686_100045140
317 Ga0070686_101066572
318 Ga0070695_100221674
319 Ga0070696_100643056
320 Ga0070665_100651726
321 Ga0070704_100152652
322 Ga0070704_100175955
323 Ga0070664_100521171
324 Ga0068857_100161068
325 Ga0068854_100097144
326 Ga0068854_100502923
327 Ga0068856_100210666
328 Ga0068859_100007128
329 Ga0068864_100107221
330 Ga0068864_100569197
331 Ga0068861_100056740
332 Ga0068861_100131564
333 Ga0068870_10084016
334 Ga0068863_100396307
335 Ga0068858_100112095
336 Ga0068858_100836106
337 Ga0068858_101117899
338 Ga0068860_100146142
339 Ga0075365_10034196
340 Ga0075368_10230823
341 Ga0075363_100340164
342 Ga0075364_10021424
343 Ga0070716_100190686
344 Ga0075362_10031027
345 Ga0075367_10001386
346 Ga0075366_10002156
347 Ga0075370_10332433
348 Ga0068871_100337053
349 Ga0075428_100084695
350 Ga0075428_100198429
351 Ga0075428_100610614
352 Ga0075430_100108604
353 Ga0075431_100004916
354 Ga0075431_100242290
355 Ga0075431_100990151
356 Ga0075433_10021108
357 Ga0075433_10178283
358 Ga0075433_10190030
359 Ga0075434_100036351
360 Ga0075434_100196303
361 Ga0075434_100674248
362 Ga0075429_100018003
363 Ga0068865_100035858
364 Ga0075436_100156675
365 Ga0097620_100007128
366 Ga0075435_100040988
367 Ga0075435_100230634
368 Ga0075435_100288367
369 Ga0099794_10003798
370 Ga0105240_10017253
371 Ga0111539_10001969
372 Ga0111539_10693992
373 Ga0111539_13302231
374 Ga0105245_10367974
375 Ga0105245_10472330
376 Ga0114129_10022616
377 Ga0114129_10070337
378 Ga0114129_10177460
379 Ga0114129_10371719
380 Ga0114129_11774576
381 Ga0105243_10311322
382 Ga0105242_10329669
383 Ga0105248_10034184
384 Ga0105248_10160687
385 Ga0105248_10206041
386 Ga0105248_10214596
387 Ga0105238_11315556
388 Ga0105249_10158653
389 Ga0105249_10840224
390 Ga0157378_10189327
391 Ga0163162_10145490
392 Ga0163162_10446212
393 Ga0157375_10506417
394 Ga0163163_11648710
395 Ga0157380_10207681
396 Ga0157380_12325204
397 Ga0157377_10161082
398 Ga0157379_10199028
399 Ga0157379_10211315
400 Ga0157379_10329747
401 Ga0157376_11239133
402 Ga0213872_10000229
403 Ga0213871_10018265
404 Ga0207653_10167952
405 Ga0207642_10035118
406 Ga0207642_10323527
407 Ga0207710_10573633
408 Ga0207680_10380382
409 Ga0207645_10931670
410 Ga0207684_10056724
411 Ga0207684_10077990
412 Ga0207684_10257458
413 Ga0207684_11032275
414 Ga0207660_10593403
415 Ga0207662_10009766
416 Ga0207662_10108115
417 Ga0207646_10004223
418 Ga0207646_10468219
419 Ga0207681_10228798
420 Ga0207659_10180176
421 Ga0207687_10235543
422 Ga0207687_10282904
423 Ga0207706_10398963
424 Ga0207686_10184484
425 Ga0207709_10204709
426 Ga0207709_10237718
427 Ga0207670_10027585
428 Ga0207669_10267844
429 Ga0207704_10014697
430 Ga0207665_10571534
431 Ga0207691_10024938
432 Ga0207711_10012439
433 Ga0207711_10235118
434 Ga0207711_10242940
435 Ga0207689_10294013
436 Ga0207651_10001997
437 Ga0207651_10031379
438 Ga0207651_10352849
439 Ga0207712_10263135
440 Ga0207668_10283269
441 Ga0207640_10084482
442 Ga0207658_10346579
443 Ga0207677_10043437
444 Ga0207703_10136323
445 Ga0207678_10143672
446 Ga0207708_10215182
447 Ga0207641_10313577
448 Ga0207648_10007697
449 Ga0207676_10052272
450 Ga0207676_11048113
451 Ga0207674_10506747
452 Ga0207674_11010034
453 Ga0207675_100084614
454 Ga0207675_100243451
455 Ga0207675_100300660
456 Ga0207683_10390522
457 Ga0209588_1010979
458 Ga0209588_1020803
459 Ga0209974_10070461
460 Ga0207428_10003052
461 Ga0268265_10258541
462 Ga0268264_10190076
463 Ga0307515_10226411
464 Ga0373938_0106687
465 Ga0373928_0026770
466 Ga0373928_0274006
467 Ga0373929_0011587
468 Ga0373949_0239695
469 Ga0373951_0014479
470 Ga0373932_0033802
471 Ga0373960_0104173
472 Ga0373961_0281341
473 Ga0373931_0011425
474 Ga0436360_0201004
475 Ga0436360_0352877
476 Ga0436361_0590566
477 Ga0436361_1003279
478 Ga0436363_0124025
479 Ga0436362_0318448
480 Ga0436362_0438714
481 Ga0439465_0111469
482 Ga0439449_0019693
483 Ga0439458_0156586
484 Ga0453683_0389308
485 Ga0451576_0477084
486 Ga0495669_0048141
487 Ga0495669_0144219
488 Ga0496100_0007779
489 Ga0496102_0010707
490 Ga0496104_0025553
491 Ga0496104_0106648
492 Ga0496105_0013536
493 Ga0496110_0058931
494 Ga0496111_0066600
495 Ga0496112_0068265
496 Ga0496113_0014240
497 Ga0496114_0013640
498 Ga0496115_0008781
499 Ga0501067_0648168
500 nmdc:mga03683_35284_c1
501 nmdc:mga06z11_2114_c1
502 nmdc:mga05p37_1157525_c1
503 nmdc:mga05p37_511861_c1
504 nmdc:mga05p37_70736_c1
505 nmdc:mga0qj67_109734_c1
506 nmdc:mga0qj67_202510_c1
507 nmdc:mga06r32_11341_c1
508 nmdc:mga06r32_1290344_c1
509 nmdc:mga06r32_251359_c1
510 nmdc:mga08y16_383598_c1
511 nmdc:mga08y16_4660_c1
512 nmdc:mga0n895_136605_c1
513 nmdc:mga0n895_1564582_c1
514 nmdc:mga0n895_667712_c1
515 nmdc:mga0rr50_146398_c1
516 nmdc:mga0rr50_61696_c1
517 nmdc:mga08x19_72129_c1
518 nmdc:mga0a205_126373_c1
519 nmdc:mga0a205_7691_c1
520 Ga0590075_023356

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01575

MaoC_dehydratas

MaoC like domain

24

143

0.91

PF13452

MaoC_dehydrat_N

N-terminal half of MaoC dehydratase

26

154

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3exz-assembly1.cif.gz_A crystal structure of the maoc-like dehydratase from rhodospirillum rubrum. northeast structural genomics consortium target rrr103a. 0.9734 6 151
3exz-assembly1.cif.gz_A crystal structure of the maoc-like dehydratase from rhodospirillum rubrum. northeast structural genomics consortium target rrr103a. 0.9605 6 151
4ffu-assembly2.cif.gz_K crystal structure of putative maoc-like (monoamine oxidase-like) protein, similar to nodn from sinorhizo bium meliloti 1021 0.8992 4 149
4ffu-assembly2.cif.gz_K crystal structure of putative maoc-like (monoamine oxidase-like) protein, similar to nodn from sinorhizo bium meliloti 1021 0.893 4 149
4o3v-assembly1.cif.gz_B crystal structure of a virb8-like protein of type iv secretion system from rickettsia typhi 0.8836 102 147
ID Description Score Start End Superfamily
3exzC00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9728 6 149 3.10.129.10
3exzC00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9661 6 149 3.10.129.10
4ffuI00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9052 4 151 3.10.129.10
4ffuK00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8907 4 149 3.10.129.10
af_I6Y9H2_24_180_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8894 1 150 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A534YLU8-F1-model_v4 MaoC family dehydratase 0.9976 5 151
AF-A0A536UPD6-F1-model_v4 MaoC family dehydratase 0.9969 5 151
AF-A0A366F3Z5-F1-model_v4 Acyl dehydratase 0.9968 3 151
AF-A0A158FNY3-F1-model_v4 MaoC family dehydratase 0.9962 4 150
AF-A0A158I685-F1-model_v4 MaoC family dehydratase 0.9958 4 150

Map