F369152

General Info

Members Datasets Scaffolds Average Seq Length
259 121 494 371

Family's Representative Sequence

Representative Sequence 3300050507|nmdc:mga05p37_41487_c1|nmdc:mga05p37_41487_c1_419_1693
Length 424
Sequence VDGSGADQQVRERSVGTAEEVKIVSVAVIVNSKRYSGRADDSWREPESRGLAWNWISASAGMTLLAFAIHSLLHVIAIAAEAPKWQTEWQRTIEGAKKEGQLSLYGGQEITHPDIVAAFNKEFPFIKVTTTSGRGGDLLARIISERRADKYLADVIATGPNGPRMLYLAKALDPITPAFILPEVTDTSKWYGRKHWYADPENQYIFIYEGTLNSTGLSYNTKLVNPGEITSYGDLLRPKWKGKILTLDPRGAVPPTQVLTLYHTPTLGPDFVRRFYTDTEITFFRDRRQGTNWLATGKFPLCFLCRDIEKVREQGLPVDVILADRIKEGGTLGGGSASVLALINRAPHANAAKVFINWYLSRQGQMVWQKVMNIRELEGSESMRNDISKEDVLPDGRRVEGKEYQVIGFLDPEPVQKLLQEILK

Samples

Sample ID Description Type Environment
1 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
2 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
35 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
36 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
37 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
38 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
39 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
40 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
41 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
42 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
43 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
44 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
45 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
46 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
47 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
55 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
56 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
59 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
78 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
79 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
80 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
81 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
82 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
83 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
84 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
85 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
86 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
87 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
88 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
89 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
90 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
91 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
92 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
93 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
94 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
95 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
96 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
97 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
98 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
99 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
100 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
101 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
102 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
103 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
104 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
105 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
106 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
107 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
108 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
109 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
110 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
111 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
112 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
113 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
114 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
115 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
116 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
117 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
118 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
119 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
120 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
121 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.16
Rhizosphere 98.84
Stem 0
Stem Tuber 0
Unclassified 25.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga05p37_41487_c1 3300050507 Bacteria 5650
2 JGI25405J52794_10000939 3300003911 Bacteria 4574
3 Ga0065712_10001049 3300005290 Bacteria 13187
4 Ga0065715_10089394 3300005293 Bacteria 10593
5 Ga0065707_10095828 3300005295 Unclassified 3333
6 Ga0070670_100009807 3300005331 Bacteria 8181
7 Ga0070670_100080952 3300005331 Bacteria 2791
8 Ga0070677_10023388 3300005333 Bacteria 2288
9 Ga0070680_100339427 3300005336 Bacteria 1276
10 Ga0068868_100202922 3300005338 Bacteria 1654
11 Ga0070687_100081901 3300005343 Bacteria 1763
12 Ga0070661_100018116 3300005344 Bacteria 5004
13 Ga0070669_100010561 3300005353 Bacteria 6556
14 Ga0070671_100178103 3300005355 Bacteria 1799
15 Ga0070674_100001930 3300005356 Bacteria 11307
16 Ga0070673_100014698 3300005364 Bacteria 5467
17 Ga0070694_100064249 3300005444 Bacteria 2512
18 Ga0070694_100213869 3300005444 Bacteria 1443
19 Ga0070708_100030568 3300005445 Bacteria 4656
20 Ga0070708_100106918 3300005445 Bacteria 2568
21 Ga0070678_100031279 3300005456 Bacteria 3669
22 Ga0070662_100109566 3300005457 Bacteria 2102
23 Ga0070662_100156305 3300005457 Bacteria 1780
24 Ga0070681_10019273 3300005458 Bacteria 6826
25 Ga0070681_10069987 3300005458 Bacteria 3474
26 Ga0070681_10137806 3300005458 Unclassified 2370
27 Ga0068867_100121228 3300005459 Bacteria 2021
28 Ga0070706_100120531 3300005467 Bacteria 2445
29 Ga0070707_100036604 3300005468 Unclassified 4683
30 Ga0070707_100064479 3300005468 Bacteria 3518
31 Ga0070699_100088894 3300005518 Bacteria 2699
32 Ga0070699_100206975 3300005518 Bacteria 1746
33 Ga0070679_100020378 3300005530 Bacteria 6464
34 Ga0070697_100036028 3300005536 Unclassified 3995
35 Ga0070697_100044219 3300005536 Bacteria 3606
36 Ga0070697_100125537 3300005536 Bacteria 2149
37 Ga0070697_100155757 3300005536 Unclassified 1928
38 Ga0070686_100098515 3300005544 Bacteria 1970
39 Ga0070696_100042317 3300005546 Unclassified 3150
40 Ga0070665_100254836 3300005548 Bacteria 1756
41 Ga0068855_100022567 3300005563 Bacteria 7541
42 Ga0070664_100019624 3300005564 Bacteria 5562
43 Ga0068856_100045022 3300005614 Bacteria 4343
44 Ga0068860_100099389 3300005843 Bacteria 2775
45 Ga0081455_10000253 3300005937 Bacteria 70023
46 Ga0081455_10000456 3300005937 Bacteria 53636
47 Ga0081455_10146041 3300005937 Bacteria 1830
48 Ga0081455_10158588 3300005937 Unclassified 1737
49 Ga0081538_10004648 3300005981 Bacteria 12597
50 Ga0081538_10012353 3300005981 Bacteria 6847
51 Ga0081540_1045137 3300005983 Unclassified 2242
52 Ga0075432_10027269 3300006058 Unclassified 1966
53 Ga0070716_100105628 3300006173 Bacteria 1735
54 Ga0068871_100083225 3300006358 Bacteria 2654
55 Ga0075428_100068275 3300006844 Bacteria 3889
56 Ga0075428_100104284 3300006844 Unclassified 3092
57 Ga0075428_100108389 3300006844 Unclassified 3027
58 Ga0075430_100065180 3300006846 Bacteria 3060
59 Ga0075430_100082235 3300006846 Unclassified 2698
60 Ga0075431_100071865 3300006847 Unclassified 3570
61 Ga0075433_10000536 3300006852 Bacteria 24964
62 Ga0075433_10003356 3300006852 Bacteria 12378
63 Ga0075433_10010132 3300006852 Bacteria 7556
64 Ga0075433_10018228 3300006852 Bacteria 5830
65 Ga0075433_10022535 3300006852 Bacteria 5287
66 Ga0075433_10090693 3300006852 Bacteria 2702
67 Ga0075433_10137563 3300006852 Unclassified 2171
68 Ga0075433_10146044 3300006852 Bacteria 2102
69 Ga0075433_10195425 3300006852 Bacteria 1799
70 Ga0075434_100007809 3300006871 Bacteria 9910
71 Ga0075434_100007948 3300006871 Bacteria 9830
72 Ga0075434_100025122 3300006871 Bacteria 5828
73 Ga0075434_100029125 3300006871 Bacteria 5430
74 Ga0075434_100085133 3300006871 Bacteria 3160
75 Ga0075434_100117537 3300006871 Bacteria 2672
76 Ga0075434_100385415 3300006871 Unclassified 1422
77 Ga0075429_100034745 3300006880 Unclassified 4381
78 Ga0075429_100052776 3300006880 Bacteria 3537
79 Ga0075429_100104301 3300006880 Unclassified 2476
80 Ga0075436_100003129 3300006914 Bacteria 11347
81 Ga0075436_100006754 3300006914 Bacteria 7853
82 Ga0075436_100028622 3300006914 Bacteria 3833
83 Ga0075436_100134981 3300006914 Unclassified 1732
84 Ga0075436_100135820 3300006914 Unclassified 1727
85 Ga0075435_100002509 3300007076 Bacteria 12212
86 Ga0075435_100005505 3300007076 Bacteria 8851
87 Ga0075435_100007510 3300007076 Bacteria 7779
88 Ga0075435_100007895 3300007076 Bacteria 7614
89 Ga0075435_100040281 3300007076 Unclassified 3730
90 Ga0075435_100158524 3300007076 Bacteria 1906
91 Ga0075435_100182380 3300007076 Unclassified 1774
92 Ga0075435_100187543 3300007076 Bacteria 1749
93 Ga0111539_10075375 3300009094 Bacteria 3974
94 Ga0111539_10116064 3300009094 Unclassified 3139
95 Ga0114129_10024331 3300009147 Bacteria 8580
96 Ga0114129_10031851 3300009147 Bacteria 7454
97 Ga0114129_10068828 3300009147 Bacteria 4934
98 Ga0114129_10128370 3300009147 Bacteria 3484
99 Ga0114129_10134558 3300009147 Bacteria 3392
100 Ga0114129_10152703 3300009147 Bacteria 3159
101 Ga0114129_10251302 3300009147 Unclassified 2373
102 Ga0114129_10310867 3300009147 Bacteria 2098
103 Ga0114129_10354507 3300009147 Bacteria 1943
104 Ga0114129_10410316 3300009147 Bacteria 1784
105 Ga0114129_10642017 3300009147 Bacteria 1371
106 Ga0105241_10319903 3300009174 Unclassified 1337
107 Ga0105242_10097145 3300009176 Bacteria 2490
108 Ga0105249_10105739 3300009553 Unclassified 2654
109 Ga0105249_10382071 3300009553 Unclassified 1434
110 Ga0105239_10019875 3300010375 Bacteria 7412
111 Ga0157373_10123372 3300013100 Bacteria 1821
112 Ga0157374_10126793 3300013296 Bacteria 2468
113 Ga0157378_10012104 3300013297 Bacteria 7557
114 Ga0157378_10017257 3300013297 Bacteria 6330
115 Ga0157378_10169515 3300013297 Unclassified 2046
116 Ga0163162_10001887 3300013306 Bacteria 19746
117 Ga0163162_10049504 3300013306 Bacteria 4211
118 Ga0157376_10021155 3300014969 Bacteria 5049
119 Ga0207688_10051297 3300025901 Bacteria 2311
120 Ga0207680_10043135 3300025903 Bacteria 2643
121 Ga0207645_10000501 3300025907 Bacteria 32429
122 Ga0207684_10109206 3300025910 Bacteria 2368
123 Ga0207707_10020532 3300025912 Bacteria 5769
124 Ga0207707_10056304 3300025912 Unclassified 3421
125 Ga0207707_10228228 3300025912 Unclassified 1620
126 Ga0207660_10095829 3300025917 Bacteria 2208
127 Ga0207652_10085339 3300025921 Bacteria 2767
128 Ga0207652_10094747 3300025921 Bacteria 2629
129 Ga0207646_10183123 3300025922 Bacteria 1892
130 Ga0207681_10299154 3300025923 Unclassified 1272
131 Ga0207690_10194469 3300025932 Unclassified 1536
132 Ga0207706_10003872 3300025933 Bacteria 14244
133 Ga0207669_10198126 3300025937 Bacteria 1455
134 Ga0207691_10004726 3300025940 Bacteria 13166
135 Ga0207679_10006681 3300025945 Bacteria 7304
136 Ga0207668_10074056 3300025972 Bacteria 2443
137 Ga0207668_10077674 3300025972 Unclassified 2395
138 Ga0207677_10099730 3300026023 Bacteria 2134
139 Ga0207648_10050188 3300026089 Bacteria 3649
140 Ga0207675_100274448 3300026118 Bacteria 1637
141 Ga0207428_10096276 3300027907 Unclassified 2292
142 Ga0207428_10154470 3300027907 Bacteria 1746
143 Ga0307408_100016345 3300031548 Bacteria 4952
144 Ga0307412_10036586 3300031911 Bacteria 3147
145 Ga0307409_100064556 3300031995 Unclassified 2877
146 Ga0307416_100002392 3300032002 Bacteria 10745
147 Ga0307416_100022866 3300032002 Bacteria 4523
148 Ga0373931_0096295 3300035691 Bacteria 1657
149 Ga0451577_0319107 3300042876 Bacteria 1409
150 Ga0495580_0000781 3300046472 Bacteria 27411
151 Ga0495580_0000929 3300046472 Bacteria 25598
152 Ga0496106_0181862 3300048909 Bacteria 1669
153 Ga0496109_0176676 3300048912 Bacteria 2005
154 Ga0496112_0013794 3300048915 Bacteria 7475
155 Ga0501033_0033162 3300049570 Unclassified 3878
156 Ga0501033_0040018 3300049570 Unclassified 3500
157 Ga0501036_0016276 3300049572 Bacteria 6212
158 Ga0501036_0058800 3300049572 Unclassified 3257
159 Ga0501037_0157999 3300049573 Unclassified 1617
160 Ga0501038_0001476 3300049574 Bacteria 21630
161 Ga0501038_0002152 3300049574 Bacteria 18297
162 Ga0501039_0000553 3300049575 Bacteria 27108
163 Ga0501040_0000217 3300049576 Bacteria 33425
164 Ga0501041_0000081 3300049577 Bacteria 37419
165 Ga0501042_0000781 3300049578 Bacteria 17408
166 Ga0501042_0000859 3300049578 Bacteria 16953
167 Ga0501046_0012307 3300049580 Bacteria 7291
168 Ga0501048_0020183 3300049582 Bacteria 4886
169 Ga0501068_0039544 3300049584 Unclassified 2828
170 Ga0501068_0056963 3300049584 Bacteria 2369
171 Ga0501071_0000507 3300049587 Bacteria 19805
172 Ga0501072_0000181 3300049588 Bacteria 45570
173 Ga0501073_0138977 3300049589 Bacteria 1683
174 Ga0501074_0041501 3300049590 Unclassified 3331
175 Ga0501074_0054730 3300049590 Bacteria 2877
176 Ga0501075_0000982 3300049591 Bacteria 18179
177 Ga0501075_0002763 3300049591 Bacteria 11756
178 Ga0501076_0000141 3300049592 Bacteria 41058
179 Ga0501077_0000211 3300049593 Bacteria 34057
180 Ga0501077_0001631 3300049593 Bacteria 13467
181 Ga0501077_0031503 3300049593 Unclassified 3374
182 Ga0501079_0001229 3300049741 Bacteria 17928
183 Ga0501079_0005653 3300049741 Bacteria 9331
184 Ga0501080_0001858 3300049742 Bacteria 18135
185 Ga0501080_0022604 3300049742 Bacteria 5826
186 Ga0501081_0000496 3300049743 Bacteria 22006
187 Ga0501081_0000861 3300049743 Bacteria 17949
188 Ga0501083_0020471 3300049744 Bacteria 4603
189 Ga0501045_0000096 3300049824 Bacteria 42986
190 nmdc:mga05p37_114623_c1 3300050507 Unclassified 3313
191 nmdc:mga05p37_116665_c1 3300050507 Unclassified 3281
192 nmdc:mga05p37_117780_c1 3300050507 Unclassified 3264
193 nmdc:mga05p37_138090_c1 3300050507 Bacteria 2988
194 nmdc:mga05p37_149875_c1 3300050507 Unclassified 2854
195 nmdc:mga05p37_153662_c1 3300050507 Unclassified 2814
196 nmdc:mga05p37_20124_c1 3300050507 Bacteria 8076
197 nmdc:mga05p37_308269_c1 3300050507 Bacteria 1877
198 nmdc:mga05p37_365563_c1 3300050507 Bacteria 1695
199 nmdc:mga05p37_484637_c1 3300050507 Bacteria 1423
200 nmdc:mga05p37_62413_c1 3300050507 Unclassified 4586
201 nmdc:mga05p37_86669_c1 3300050507 Bacteria 3860
202 nmdc:mga09592_186763_c1 3300050508 Unclassified 1794
203 nmdc:mga09592_353762_c1 3300050508 Unclassified 1271
204 nmdc:mga09592_9506_c1 3300050508 Bacteria 7902
205 nmdc:mga0qj67_149733_c1 3300050509 Bacteria 1893
206 nmdc:mga0qj67_172794_c1 3300050509 Unclassified 1755
207 nmdc:mga0qj67_98877_c1 3300050509 Unclassified 2350
208 nmdc:mga06r32_123927_c1 3300050510 Unclassified 2551
209 nmdc:mga06r32_17648_c1 3300050510 Bacteria 6519
210 nmdc:mga08y16_251663_c1 3300050511 Unclassified 1826
211 nmdc:mga0n895_2092_c1 3300050512 Bacteria 15392
212 nmdc:mga0n895_26622_c1 3300050512 Bacteria 5481
213 nmdc:mga0n895_266840_c1 3300050512 Unclassified 1737
214 nmdc:mga0n895_27499_c1 3300050512 Bacteria 5404
215 nmdc:mga0n895_42368_c1 3300050512 Bacteria 4429
216 nmdc:mga0n895_56861_c1 3300050512 Unclassified 3855
217 nmdc:mga0rr50_10429_c1 3300050513 Bacteria 5895
218 nmdc:mga0rr50_11788_c1 3300050513 Bacteria 5613
219 nmdc:mga0rr50_156811_c1 3300050513 Bacteria 1845
220 nmdc:mga0rr50_209048_c1 3300050513 Unclassified 1607
221 nmdc:mga0rr50_30675_c1 3300050513 Bacteria 3809
222 nmdc:mga0rr50_4036_c1 3300050513 Bacteria 8564
223 nmdc:mga0rr50_73626_c1 3300050513 Unclassified 2612
224 nmdc:mga0rr50_8692_c1 3300050513 Bacteria 6332
225 nmdc:mga08x19_129221_c1 3300050514 Unclassified 1698
226 nmdc:mga08x19_31851_c1 3300050514 Unclassified 3320
227 nmdc:mga08x19_32567_c1 3300050514 Bacteria 3286
228 nmdc:mga08x19_359843_c1 3300050514 Bacteria 1017
229 nmdc:mga08x19_49531_c1 3300050514 Bacteria 2694
230 nmdc:mga08x19_6137_c1 3300050514 Bacteria 7108
231 nmdc:mga08x19_78090_c1 3300050514 Unclassified 2169
232 nmdc:mga0a205_13016_c1 3300050515 Bacteria 7723
233 nmdc:mga0a205_13528_c1 3300050515 Bacteria 7601
234 nmdc:mga0a205_1688_c1 3300050515 Bacteria 19057
235 nmdc:mga0a205_172785_c1 3300050515 Bacteria 2057
236 nmdc:mga0a205_28467_c1 3300050515 Bacteria 5343
237 nmdc:mga0a205_3516_c1 3300050515 Bacteria 14001
238 nmdc:mga0a205_46754_c1 3300050515 Bacteria 4174
239 nmdc:mga0a205_50499_c1 3300050515 Unclassified 4015
240 nmdc:mga0a205_60842_c1 3300050515 Bacteria 3647
241 nmdc:mga0a205_64706_c1 3300050515 Unclassified 3533
242 nmdc:mga0a205_65217_c1 3300050515 Unclassified 3518
243 Ga0501084_0000354 3300054114 Bacteria 34974
244 Ga0501082_0000221 3300060353 Bacteria 49677
245 Ga0501082_0123465 3300060353 Unclassified 2245
246 Ga0530510_0000401 3300061734 Bacteria 28125
247 Ga0530510_0023879 3300061734 Unclassified 4360
248 nmdc:mga05p37_41487_c1
249 JGI25405J52794_10000939
250 Ga0065712_10001049
251 Ga0065715_10089394
252 Ga0065707_10095828
253 Ga0070670_100009807
254 Ga0070670_100080952
255 Ga0070677_10023388
256 Ga0070680_100339427
257 Ga0068868_100202922
258 Ga0070687_100081901
259 Ga0070661_100018116
260 Ga0070669_100010561
261 Ga0070671_100178103
262 Ga0070674_100001930
263 Ga0070673_100014698
264 Ga0070694_100064249
265 Ga0070694_100213869
266 Ga0070708_100030568
267 Ga0070708_100106918
268 Ga0070678_100031279
269 Ga0070662_100109566
270 Ga0070662_100156305
271 Ga0070681_10019273
272 Ga0070681_10069987
273 Ga0070681_10137806
274 Ga0068867_100121228
275 Ga0070706_100120531
276 Ga0070707_100036604
277 Ga0070707_100064479
278 Ga0070699_100088894
279 Ga0070699_100206975
280 Ga0070679_100020378
281 Ga0070697_100036028
282 Ga0070697_100044219
283 Ga0070697_100125537
284 Ga0070697_100155757
285 Ga0070686_100098515
286 Ga0070696_100042317
287 Ga0070665_100254836
288 Ga0068855_100022567
289 Ga0070664_100019624
290 Ga0068856_100045022
291 Ga0068860_100099389
292 Ga0081455_10000253
293 Ga0081455_10000456
294 Ga0081455_10146041
295 Ga0081455_10158588
296 Ga0081538_10004648
297 Ga0081538_10012353
298 Ga0081540_1045137
299 Ga0075432_10027269
300 Ga0070716_100105628
301 Ga0068871_100083225
302 Ga0075428_100068275
303 Ga0075428_100104284
304 Ga0075428_100108389
305 Ga0075430_100065180
306 Ga0075430_100082235
307 Ga0075431_100071865
308 Ga0075433_10000536
309 Ga0075433_10003356
310 Ga0075433_10010132
311 Ga0075433_10018228
312 Ga0075433_10022535
313 Ga0075433_10090693
314 Ga0075433_10137563
315 Ga0075433_10146044
316 Ga0075433_10195425
317 Ga0075434_100007809
318 Ga0075434_100007948
319 Ga0075434_100025122
320 Ga0075434_100029125
321 Ga0075434_100085133
322 Ga0075434_100117537
323 Ga0075434_100385415
324 Ga0075429_100034745
325 Ga0075429_100052776
326 Ga0075429_100104301
327 Ga0075436_100003129
328 Ga0075436_100006754
329 Ga0075436_100028622
330 Ga0075436_100134981
331 Ga0075436_100135820
332 Ga0075435_100002509
333 Ga0075435_100005505
334 Ga0075435_100007510
335 Ga0075435_100007895
336 Ga0075435_100040281
337 Ga0075435_100158524
338 Ga0075435_100182380
339 Ga0075435_100187543
340 Ga0111539_10075375
341 Ga0111539_10116064
342 Ga0114129_10024331
343 Ga0114129_10031851
344 Ga0114129_10068828
345 Ga0114129_10128370
346 Ga0114129_10134558
347 Ga0114129_10152703
348 Ga0114129_10251302
349 Ga0114129_10310867
350 Ga0114129_10354507
351 Ga0114129_10410316
352 Ga0114129_10642017
353 Ga0105241_10319903
354 Ga0105242_10097145
355 Ga0105249_10105739
356 Ga0105249_10382071
357 Ga0105239_10019875
358 Ga0157373_10123372
359 Ga0157374_10126793
360 Ga0157378_10012104
361 Ga0157378_10017257
362 Ga0157378_10169515
363 Ga0163162_10001887
364 Ga0163162_10049504
365 Ga0157376_10021155
366 Ga0207688_10051297
367 Ga0207680_10043135
368 Ga0207645_10000501
369 Ga0207684_10109206
370 Ga0207707_10020532
371 Ga0207707_10056304
372 Ga0207707_10228228
373 Ga0207660_10095829
374 Ga0207652_10085339
375 Ga0207652_10094747
376 Ga0207646_10183123
377 Ga0207681_10299154
378 Ga0207690_10194469
379 Ga0207706_10003872
380 Ga0207669_10198126
381 Ga0207691_10004726
382 Ga0207679_10006681
383 Ga0207668_10074056
384 Ga0207668_10077674
385 Ga0207677_10099730
386 Ga0207648_10050188
387 Ga0207675_100274448
388 Ga0207428_10096276
389 Ga0207428_10154470
390 Ga0307408_100016345
391 Ga0307412_10036586
392 Ga0307409_100064556
393 Ga0307416_100002392
394 Ga0307416_100022866
395 Ga0373931_0096295
396 Ga0451577_0319107
397 Ga0495580_0000781
398 Ga0495580_0000929
399 Ga0496106_0181862
400 Ga0496109_0176676
401 Ga0496112_0013794
402 Ga0501033_0033162
403 Ga0501033_0040018
404 Ga0501036_0016276
405 Ga0501036_0058800
406 Ga0501037_0157999
407 Ga0501038_0001476
408 Ga0501038_0002152
409 Ga0501039_0000553
410 Ga0501040_0000217
411 Ga0501041_0000081
412 Ga0501042_0000781
413 Ga0501042_0000859
414 Ga0501046_0012307
415 Ga0501048_0020183
416 Ga0501068_0039544
417 Ga0501068_0056963
418 Ga0501071_0000507
419 Ga0501072_0000181
420 Ga0501073_0138977
421 Ga0501074_0041501
422 Ga0501074_0054730
423 Ga0501075_0000982
424 Ga0501075_0002763
425 Ga0501076_0000141
426 Ga0501077_0000211
427 Ga0501077_0001631
428 Ga0501077_0031503
429 Ga0501079_0001229
430 Ga0501079_0005653
431 Ga0501080_0001858
432 Ga0501080_0022604
433 Ga0501081_0000496
434 Ga0501081_0000861
435 Ga0501083_0020471
436 Ga0501045_0000096
437 nmdc:mga05p37_114623_c1
438 nmdc:mga05p37_116665_c1
439 nmdc:mga05p37_117780_c1
440 nmdc:mga05p37_138090_c1
441 nmdc:mga05p37_149875_c1
442 nmdc:mga05p37_153662_c1
443 nmdc:mga05p37_20124_c1
444 nmdc:mga05p37_308269_c1
445 nmdc:mga05p37_365563_c1
446 nmdc:mga05p37_484637_c1
447 nmdc:mga05p37_62413_c1
448 nmdc:mga05p37_86669_c1
449 nmdc:mga09592_186763_c1
450 nmdc:mga09592_353762_c1
451 nmdc:mga09592_9506_c1
452 nmdc:mga0qj67_149733_c1
453 nmdc:mga0qj67_172794_c1
454 nmdc:mga0qj67_98877_c1
455 nmdc:mga06r32_123927_c1
456 nmdc:mga06r32_17648_c1
457 nmdc:mga08y16_251663_c1
458 nmdc:mga0n895_2092_c1
459 nmdc:mga0n895_26622_c1
460 nmdc:mga0n895_266840_c1
461 nmdc:mga0n895_27499_c1
462 nmdc:mga0n895_42368_c1
463 nmdc:mga0n895_56861_c1
464 nmdc:mga0rr50_10429_c1
465 nmdc:mga0rr50_11788_c1
466 nmdc:mga0rr50_156811_c1
467 nmdc:mga0rr50_209048_c1
468 nmdc:mga0rr50_30675_c1
469 nmdc:mga0rr50_4036_c1
470 nmdc:mga0rr50_73626_c1
471 nmdc:mga0rr50_8692_c1
472 nmdc:mga08x19_129221_c1
473 nmdc:mga08x19_31851_c1
474 nmdc:mga08x19_32567_c1
475 nmdc:mga08x19_359843_c1
476 nmdc:mga08x19_49531_c1
477 nmdc:mga08x19_6137_c1
478 nmdc:mga08x19_78090_c1
479 nmdc:mga0a205_13016_c1
480 nmdc:mga0a205_13528_c1
481 nmdc:mga0a205_1688_c1
482 nmdc:mga0a205_172785_c1
483 nmdc:mga0a205_28467_c1
484 nmdc:mga0a205_3516_c1
485 nmdc:mga0a205_46754_c1
486 nmdc:mga0a205_50499_c1
487 nmdc:mga0a205_60842_c1
488 nmdc:mga0a205_64706_c1
489 nmdc:mga0a205_65217_c1
490 Ga0501084_0000354
491 Ga0501082_0000221
492 Ga0501082_0123465
493 Ga0530510_0000401
494 Ga0530510_0023879

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13416

SBP_bac_8

Bacterial extracellular solute-binding protein

114

375

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
7bg0-assembly2.cif.gz_D fusion of mbp and the backbone of the long-acting amylin analog am833. 0.7132 40 128
6g7q-assembly1.cif.gz_B trichodesmium tery_3377 (idia) (futa) in complex with iron and citrate ligands. 0.6922 41 368
6g7q-assembly1.cif.gz_B trichodesmium tery_3377 (idia) (futa) in complex with iron and citrate ligands. 0.6831 41 368
7li0-assembly1.cif.gz_A crystal structure of apo moraxella catarrhalis ferric binding protein a in an open conformation 0.6737 42 372
7li0-assembly1.cif.gz_A crystal structure of apo moraxella catarrhalis ferric binding protein a in an open conformation 0.6702 42 372
ID Description Score Start End Superfamily
6nioA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8026 42 115 3.40.190.10
3tyhC01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.7939 43 331 3.40.190.10
1y4tD01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.7897 43 331 3.40.190.10
af_P37329_30_103_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.7855 45 85 3.40.190.10
2h5yB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.7798 42 115 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A854C7B3-F1-model_v4 deleted 0.9475 150 366
AF-A0A854C7B3-F1-model_v4 deleted 0.9391 150 366
AF-A0A7C3NKD1-F1-model_v4 Extracellular solute-binding protein 0.9352 121 366
AF-A0A534U627-F1-model_v4 Extracellular solute-binding protein 0.9221 1 366 GO:0016020
AF-A0A7C3NKD1-F1-model_v4 Extracellular solute-binding protein 0.9209 121 366

Map