F369055

General Info

Members Datasets Scaffolds Average Seq Length
259 118 255 190

Family's Representative Sequence

Representative Sequence 3300046660|Ga0495625_0062532|Ga0495625_0062532_1041_1778
Length 227
Sequence MDAAPVSASSAASAWVARWAPLVPAGEVLDLACGSGRHARLFAALGHPVLALDRDPAALEAATQPVGWTGSPSTRSSGGGRPAHPTGESVVSGALAGPIVPMRHDLEAEGAAWPFAPGRFAGIVVTNYLHRPLMAQLLRSLAPGGVLIYETFALGNEAFGKPSNPAFLLAPGELLEHAAEAGLRAVAYEDGFVAHPKPALVQRLCAAGPAFAPGDARLDQLSGRNEP

Samples

Sample ID Description Type Environment
1 2643221660 Methylibium sp. Root1272 Isolate Unclassified
2 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
3 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
4 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
5 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
6 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
7 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
8 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
9 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
10 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
11 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
12 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
13 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
14 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
15 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
16 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
17 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
18 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
19 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
20 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
21 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
22 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
23 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
24 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
25 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
26 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
27 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
28 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
30 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
31 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
32 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
33 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
34 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
35 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
36 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
37 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
38 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
39 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
40 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
41 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
42 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
43 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
44 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
45 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
46 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
47 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
48 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
49 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
50 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
51 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
52 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
53 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
54 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
55 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
56 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
57 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
58 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
59 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
60 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
61 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
62 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
63 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
64 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
65 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
66 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
67 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
68 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
69 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
70 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
71 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
72 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
73 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
74 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
75 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
76 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
77 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
78 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
79 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
80 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
81 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
82 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
83 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
84 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
85 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
86 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
87 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
88 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
89 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
90 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
91 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
92 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
93 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
94 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
95 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
96 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
97 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
98 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
99 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
100 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
101 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
102 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
103 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
104 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
105 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
106 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
107 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
108 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
109 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
110 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
111 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
112 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
113 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
114 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
115 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
116 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
117 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
118 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.46
Metatranscriptomes 0
Isolates 1.54

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.29
Nodule 0
Rhizoplane 1.54
Rhizosphere 80.69
Stem 0
Stem Tuber 0
Unclassified 3.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1001710 3300002705 Bacteria 8829
2 JGI25158J39367_1000603 3300002739 Bacteria 7152
3 JGI25152J39213_1028987 3300002773 Bacteria 875
4 Ga0055526_1007030 3300003771 Bacteria 5958
5 Ga0055524_1004180 3300003775 Bacteria 6735
6 Ga0055524_1071651 3300003775 Bacteria 665
7 Ga0055534_1013492 3300003784 Bacteria 1568
8 Ga0055534_1023462 3300003784 Bacteria 1010
9 Ga0055528_1009687 3300003790 Bacteria 4003
10 Ga0055530_10001912 3300003791 Bacteria 14247
11 Ga0055531_10011921 3300003794 Bacteria 4138
12 Ga0055543_1002597 3300004625 Bacteria 5841
13 Ga0055543_1009548 3300004625 Bacteria 2079
14 Ga0065165_1000364 3300005262 Bacteria 74307
15 Ga0065165_1006800 3300005262 Bacteria 5841
16 Ga0157369_10258550 3300013105 Bacteria 1816
17 Ga0209436_101585 3300025208 Bacteria 7650
18 Ga0209436_102300 3300025208 Bacteria 5855
19 Ga0209436_119053 3300025208 Bacteria 960
20 Ga0209565_1005639 3300025263 Bacteria 3619
21 Ga0209565_1045742 3300025263 Bacteria 800
22 Ga0209673_1009034 3300025273 Bacteria 4368
23 Ga0209130_1000240 3300025284 Bacteria 70293
24 Ga0209130_1004016 3300025284 Bacteria 5854
25 Ga0209130_1038071 3300025284 Bacteria 945
26 Ga0209675_1001103 3300025291 Bacteria 16511
27 Ga0209675_1007446 3300025291 Bacteria 4192
28 Ga0209564_1002549 3300025295 Bacteria 14022
29 Ga0209564_1053373 3300025295 Bacteria 963
30 Ga0209050_1000339 3300025298 Bacteria 92915
31 Ga0209050_1000384 3300025298 Bacteria 83323
32 Ga0209050_1004048 3300025298 Bacteria 10283
33 Ga0209256_1002671 3300025299 Bacteria 13993
34 Ga0209256_1004954 3300025299 Bacteria 7982
35 Ga0209256_1023618 3300025299 Bacteria 1829
36 Ga0207426_1005256 3300025302 Bacteria 5973
37 Ga0207426_1020183 3300025302 Bacteria 2318
38 Ga0209051_1022276 3300025303 Bacteria 2670
39 Ga0209257_1000107 3300025304 Bacteria 240937
40 Ga0207686_10301975 3300025934 Bacteria 1189
41 Ga0307408_100000231 3300031548 Bacteria 58848
42 Ga0307408_100036155 3300031548 Bacteria 3471
43 Ga0307416_101396346 3300032002 Bacteria 806
44 Ga0395899_0000028 3300037312 Bacteria 334378
45 Ga0395901_0900294 3300038443 Bacteria 867
46 Ga0450904_000419 3300042139 Bacteria 8614
47 Ga0450906_058179 3300042145 Bacteria 686
48 Ga0453684_0394834 3300044712 Bacteria 1550
49 Ga0453684_1189465 3300044712 Bacteria 801
50 Ga0466957_0405102 3300044842 Bacteria 933
51 Ga0466959_0344426 3300045049 Bacteria 1017
52 Ga0495617_011224 3300046452 Bacteria 3057
53 Ga0495617_113682 3300046452 Bacteria 875
54 Ga0495590_0115734 3300046457 Bacteria 959
55 Ga0495591_104749 3300046458 Bacteria 698
56 Ga0495629_0001890 3300046459 Bacteria 16312
57 Ga0495629_0003375 3300046459 Bacteria 12067
58 Ga0495629_0069776 3300046459 Bacteria 2452
59 Ga0495629_0121446 3300046459 Bacteria 1820
60 Ga0495638_0015120 3300046460 Bacteria 5191
61 Ga0495638_0197517 3300046460 Bacteria 1137
62 Ga0495638_0361460 3300046460 Bacteria 763
63 Ga0495651_0147642 3300046462 Bacteria 1698
64 Ga0495653_0022460 3300046463 Bacteria 5106
65 Ga0495653_0155696 3300046463 Bacteria 1592
66 Ga0495653_0288153 3300046463 Bacteria 1075
67 Ga0495650_0000015 3300046471 Bacteria 557595
68 Ga0495650_0013298 3300046471 Bacteria 4362
69 Ga0495580_0016734 3300046472 Bacteria 5503
70 Ga0495580_0017698 3300046472 Bacteria 5320
71 Ga0495580_0358440 3300046472 Bacteria 987
72 Ga0495605_0021788 3300046474 Bacteria 3390
73 Ga0495664_0217492 3300046477 Bacteria 1157
74 Ga0495584_0000008 3300046491 Bacteria 283067
75 Ga0495584_0000305 3300046491 Bacteria 34730
76 Ga0495584_0013720 3300046491 Bacteria 4132
77 Ga0495584_0103663 3300046491 Bacteria 1438
78 Ga0495584_0140229 3300046491 Bacteria 1227
79 Ga0495584_0358717 3300046491 Bacteria 740
80 Ga0495585_0000183 3300046492 Bacteria 66586
81 Ga0495585_0001161 3300046492 Bacteria 21436
82 Ga0495585_0002300 3300046492 Bacteria 13764
83 Ga0495585_0010876 3300046492 Bacteria 5406
84 Ga0495585_0018947 3300046492 Bacteria 3970
85 Ga0495585_0032488 3300046492 Bacteria 2956
86 Ga0495585_0055764 3300046492 Bacteria 2183
87 Ga0495585_0105107 3300046492 Bacteria 1506
88 Ga0495585_0376339 3300046492 Bacteria 686
89 Ga0495594_0003718 3300046499 Bacteria 7827
90 Ga0495594_0010492 3300046499 Bacteria 4804
91 Ga0495596_0002633 3300046500 Bacteria 9504
92 Ga0495596_0004324 3300046500 Bacteria 6954
93 Ga0495596_0004494 3300046500 Bacteria 6779
94 Ga0495596_0012234 3300046500 Bacteria 3679
95 Ga0495607_0006512 3300046501 Bacteria 8209
96 Ga0495607_0160197 3300046501 Bacteria 1144
97 Ga0495583_0000141 3300046506 Bacteria 121899
98 Ga0495583_0001878 3300046506 Bacteria 19527
99 Ga0495583_0001997 3300046506 Bacteria 18694
100 Ga0495583_0002057 3300046506 Bacteria 18214
101 Ga0495583_0011405 3300046506 Bacteria 5104
102 Ga0495583_0020211 3300046506 Bacteria 3456
103 Ga0495583_0050332 3300046506 Bacteria 1904
104 Ga0495583_0098561 3300046506 Bacteria 1249
105 Ga0495606_0006253 3300046507 Bacteria 11054
106 Ga0495606_0026578 3300046507 Bacteria 4123
107 Ga0495606_0141318 3300046507 Bacteria 1421
108 Ga0495606_0151943 3300046507 Bacteria 1358
109 Ga0495606_0173269 3300046507 Bacteria 1250
110 Ga0495606_0221231 3300046507 Bacteria 1066
111 Ga0495616_0001468 3300046513 Bacteria 16368
112 Ga0495616_0002000 3300046513 Bacteria 13716
113 Ga0495616_0004252 3300046513 Bacteria 9050
114 Ga0495616_0068339 3300046513 Bacteria 1725
115 Ga0495616_0072743 3300046513 Bacteria 1659
116 Ga0495620_0062684 3300046515 Bacteria 1543
117 Ga0495620_0064766 3300046515 Bacteria 1510
118 Ga0495628_0131302 3300046516 Bacteria 1915
119 Ga0495630_0006191 3300046517 Bacteria 8488
120 Ga0495630_0031372 3300046517 Bacteria 3957
121 Ga0495630_0317730 3300046517 Bacteria 1190
122 Ga0495631_0068796 3300046518 Bacteria 1531
123 Ga0495631_0108888 3300046518 Bacteria 1191
124 Ga0495631_0165879 3300046518 Bacteria 947
125 Ga0495632_0000094 3300046519 Bacteria 90132
126 Ga0495632_0242371 3300046519 Bacteria 810
127 Ga0495637_0027396 3300046520 Bacteria 2550
128 Ga0495637_0055564 3300046520 Bacteria 1641
129 Ga0495643_0001571 3300046522 Bacteria 20316
130 Ga0495643_0040859 3300046522 Bacteria 2531
131 Ga0495644_0033353 3300046523 Bacteria 1945
132 Ga0495644_0071976 3300046523 Bacteria 1299
133 Ga0495644_0190047 3300046523 Bacteria 790
134 Ga0495648_0000030 3300046524 Bacteria 216178
135 Ga0495648_0012443 3300046524 Bacteria 6348
136 Ga0495663_0027802 3300046525 Bacteria 1662
137 Ga0495663_0051178 3300046525 Bacteria 1279
138 Ga0495666_0018051 3300046526 Bacteria 3513
139 Ga0495666_0139342 3300046526 Bacteria 1131
140 Ga0495642_0004167 3300046528 Bacteria 5642
141 Ga0495642_0021154 3300046528 Bacteria 2557
142 Ga0495642_0077675 3300046528 Bacteria 1394
143 Ga0495642_0099826 3300046528 Bacteria 1234
144 Ga0495652_0075593 3300046529 Bacteria 2797
145 Ga0495665_0119550 3300046531 Bacteria 1380
146 Ga0495598_0184177 3300046537 Bacteria 747
147 Ga0495609_0013630 3300046538 Bacteria 3836
148 Ga0495609_0081173 3300046538 Bacteria 1417
149 Ga0495609_0141985 3300046538 Bacteria 1024
150 Ga0495609_0222598 3300046538 Bacteria 783
151 Ga0495597_0016996 3300046542 Bacteria 3429
152 Ga0495597_0082557 3300046542 Bacteria 1373
153 Ga0495622_0015142 3300046557 Bacteria 3585
154 Ga0495633_0006257 3300046558 Bacteria 7101
155 Ga0495633_0187775 3300046558 Bacteria 950
156 Ga0495633_0271202 3300046558 Bacteria 772
157 Ga0495667_0045499 3300046559 Bacteria 2906
158 Ga0495668_0019201 3300046616 Bacteria 3944
159 Ga0495668_0035838 3300046616 Bacteria 2780
160 Ga0495668_0040692 3300046616 Bacteria 2591
161 Ga0495634_0039446 3300046642 Bacteria 3216
162 Ga0495611_0006822 3300046648 Bacteria 4851
163 Ga0495611_0011158 3300046648 Bacteria 3807
164 Ga0495625_0062532 3300046660 Bacteria 2631
165 Ga0495625_0197442 3300046660 Bacteria 1330
166 Ga0495625_0250895 3300046660 Bacteria 1149
167 Ga0495625_0310835 3300046660 Bacteria 1006
168 Ga0495661_0054379 3300046665 Bacteria 2403
169 Ga0495661_0064947 3300046665 Bacteria 2151
170 Ga0495661_0086955 3300046665 Bacteria 1788
171 Ga0495661_0126028 3300046665 Bacteria 1409
172 Ga0495661_0253346 3300046665 Bacteria 897
173 Ga0495588_0022449 3300046674 Bacteria 3119
174 Ga0495588_0022891 3300046674 Bacteria 3089
175 Ga0495588_0050099 3300046674 Bacteria 2148
176 Ga0495588_0312621 3300046674 Bacteria 827
177 Ga0495623_0016697 3300046679 Bacteria 4742
178 Ga0495623_0053399 3300046679 Bacteria 2551
179 Ga0495623_0275502 3300046679 Bacteria 938
180 Ga0495669_0019577 3300046684 Bacteria 2922
181 Ga0495613_0183272 3300046689 Bacteria 1482
182 Ga0495624_0035472 3300046690 Bacteria 3220
183 Ga0495624_0049165 3300046690 Bacteria 2674
184 Ga0495624_0395916 3300046690 Bacteria 829
185 Ga0495670_0019076 3300046691 Bacteria 3379
186 Ga0495670_0022428 3300046691 Bacteria 3116
187 Ga0495670_0090876 3300046691 Bacteria 1562
188 Ga0495671_0009406 3300046692 Bacteria 5457
189 Ga0495671_0295433 3300046692 Bacteria 779
190 Ga0495671_0348450 3300046692 Bacteria 710
191 Ga0495649_0015210 3300046694 Bacteria 4380
192 Ga0495589_0022990 3300046794 Bacteria 3177
193 Ga0495589_0049630 3300046794 Bacteria 2076
194 Ga0495600_0071320 3300046809 Bacteria 2269
195 Ga0495660_0018014 3300046810 Bacteria 4062
196 Ga0495660_0096024 3300046810 Bacteria 1532
197 Ga0495660_0104484 3300046810 Bacteria 1453
198 Ga0495581_0101150 3300047315 Bacteria 1674
199 Ga0495581_0111042 3300047315 Bacteria 1594
200 Ga0495581_0376651 3300047315 Bacteria 828
201 Ga0495604_0029175 3300047317 Bacteria 4389
202 Ga0495604_0039141 3300047317 Bacteria 3727
203 Ga0495604_0055414 3300047317 Bacteria 3055
204 Ga0495604_0097083 3300047317 Bacteria 2173
205 Ga0495604_0112685 3300047317 Bacteria 1981
206 Ga0495674_0010832 3300047319 Bacteria 8625
207 Ga0495674_0136182 3300047319 Bacteria 2066
208 Ga0495672_0004111 3300047320 Bacteria 12116
209 Ga0495672_0039613 3300047320 Bacteria 2864
210 Ga0495676_0066658 3300047321 Bacteria 2789
211 Ga0495680_0274631 3300047322 Bacteria 1189
212 Ga0495683_0000235 3300047323 Bacteria 50394
213 Ga0495683_0075809 3300047323 Bacteria 1646
214 Ga0495683_0125929 3300047323 Bacteria 1212
215 Ga0495683_0153186 3300047323 Bacteria 1071
216 Ga0495687_046747 3300047443 Bacteria 1866
217 Ga0495687_063403 3300047443 Bacteria 1513
218 Ga0495687_065199 3300047443 Bacteria 1484
219 Ga0495687_143735 3300047443 Bacteria 825
220 Ga0495675_0020157 3300047444 Bacteria 4238
221 Ga0495675_0029156 3300047444 Bacteria 3518
222 Ga0495677_0159717 3300047445 Bacteria 870
223 Ga0495679_001045 3300047446 Bacteria 16874
224 Ga0495679_146553 3300047446 Bacteria 635
225 Ga0495685_005628 3300047447 Bacteria 4095
226 Ga0495681_0018850 3300047470 Bacteria 3787
227 Ga0495681_0095636 3300047470 Bacteria 1305
228 Ga0495684_0197767 3300047471 Bacteria 1483
229 Ga0495686_0000484 3300047472 Bacteria 59015
230 Ga0495593_0005941 3300047673 Bacteria 7193
231 Ga0495593_0021727 3300047673 Bacteria 3580
232 Ga0495593_0212510 3300047673 Bacteria 971
233 Ga0495602_0022728 3300048088 Bacteria 6132
234 Ga0495602_0037808 3300048088 Bacteria 4472
235 Ga0495602_0065391 3300048088 Bacteria 3138
236 Ga0495626_0001840 3300048091 Bacteria 15941
237 Ga0495626_0009659 3300048091 Bacteria 5202
238 Ga0495626_0014495 3300048091 Bacteria 4062
239 Ga0495626_0028031 3300048091 Bacteria 2733
240 Ga0495626_0032227 3300048091 Bacteria 2518
241 Ga0495626_0109360 3300048091 Bacteria 1198
242 Ga0495626_0171690 3300048091 Bacteria 903
243 Ga0496103_0233858 3300048906 Bacteria 1182
244 Ga0496115_0006889 3300048918 Bacteria 8347
245 Ga0496115_0269246 3300048918 Bacteria 1400
246 Ga0496115_0517075 3300048918 Bacteria 957
247 Ga0496117_0059594 3300048920 Bacteria 2635
248 Ga0496118_0018642 3300048921 Bacteria 6243
249 Ga0496121_0167924 3300048924 Bacteria 1597
250 Ga0496126_0008623 3300048929 Bacteria 10963
251 Ga0495678_002026 3300049459 Bacteria 14523
252 Ga0495678_007406 3300049459 Bacteria 5693
253 Ga0495678_008235 3300049459 Bacteria 5287
254 Ga0495682_0005441 3300049460 Bacteria 5291
255 Ga0495682_0054490 3300049460 Bacteria 1451

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003791 Ga0055530_10001912 Ga0055530_100019122 156
2 3300046538 Ga0495609_0222598 Ga0495609_0222598_256_762 160
3 3300046674 Ga0495588_0312621 Ga0495588_0312621_64_564 160
4 3300046518 Ga0495631_0165879 Ga0495631_0165879_144_695 162
5 3300046523 Ga0495644_0190047 Ga0495644_0190047_132_683 162
6 3300046525 Ga0495663_0051178 Ga0495663_0051178_184_735 162
7 3300046691 Ga0495670_0022428 Ga0495670_0022428_1022_1573 162
8 3300047470 Ga0495681_0018850 Ga0495681_0018850_805_1356 162
9 3300042145 Ga0450906_058179 Ga0450906_058179_62_631 166
10 3300046616 Ga0495668_0019201 Ga0495668_0019201_871_1473 166
11 3300047446 Ga0495679_146553 Ga0495679_146553_23_547 168
12 3300046459 Ga0495629_0069776 Ga0495629_0069776_1896_2438 172
13 3300046492 Ga0495585_0010876 Ga0495585_0010876_2777_3319 172
14 3300047315 Ga0495581_0376651 Ga0495581_0376651_12_554 172
15 3300004625 Ga0055543_1009548 Ga0055543_10095482 177
16 3300005262 Ga0065165_1000364 Ga0065165_100036412 177
17 3300025208 Ga0209436_119053 Ga0209436_1190532 177
18 3300025284 Ga0209130_1000240 Ga0209130_100024025 177
19 3300025302 Ga0207426_1020183 Ga0207426_10201832 177
20 3300046499 Ga0495594_0003718 Ga0495594_0003718_6570_7121 177
21 3300046506 Ga0495583_0001878 Ga0495583_0001878_6627_7172 177
22 3300046674 Ga0495588_0022891 Ga0495588_0022891_2155_2706 177
23 3300047445 Ga0495677_0159717 Ga0495677_0159717_135_680 177
24 3300038443 Ga0395901_0900294 Ga0395901_0900294_43_603 178
25 3300046520 Ga0495637_0055564 Ga0495637_0055564_658_1224 178
26 3300046459 Ga0495629_0003375 Ga0495629_0003375_1635_2192 179
27 3300046472 Ga0495580_0358440 Ga0495580_0358440_408_971 179
28 3300046499 Ga0495594_0010492 Ga0495594_0010492_3893_4456 179
29 3300046500 Ga0495596_0004494 Ga0495596_0004494_6119_6670 179
30 3300046506 Ga0495583_0001997 Ga0495583_0001997_15731_16282 179
31 3300046507 Ga0495606_0006253 Ga0495606_0006253_158_715 179
32 3300046513 Ga0495616_0068339 Ga0495616_0068339_1025_1582 179
33 3300046513 Ga0495616_0072743 Ga0495616_0072743_888_1439 179
34 3300046517 Ga0495630_0031372 Ga0495630_0031372_2669_3232 179
35 3300046518 Ga0495631_0068796 Ga0495631_0068796_817_1374 179
36 3300046518 Ga0495631_0108888 Ga0495631_0108888_473_1030 179
37 3300046519 Ga0495632_0000094 Ga0495632_0000094_12746_13297 179
38 3300046525 Ga0495663_0027802 Ga0495663_0027802_590_1147 179
39 3300046526 Ga0495666_0018051 Ga0495666_0018051_2029_2592 179
40 3300046528 Ga0495642_0004167 Ga0495642_0004167_99_656 179
41 3300046528 Ga0495642_0021154 Ga0495642_0021154_93_650 179
42 3300046529 Ga0495652_0075593 Ga0495652_0075593_1356_1919 179
43 3300046537 Ga0495598_0184177 Ga0495598_0184177_108_665 179
44 3300046557 Ga0495622_0015142 Ga0495622_0015142_2560_3123 179
45 3300046558 Ga0495633_0271202 Ga0495633_0271202_118_675 179
46 3300046559 Ga0495667_0045499 Ga0495667_0045499_419_982 179
47 3300046616 Ga0495668_0035838 Ga0495668_0035838_115_666 179
48 3300046642 Ga0495634_0039446 Ga0495634_0039446_528_1091 179
49 3300046665 Ga0495661_0054379 Ga0495661_0054379_1035_1592 179
50 3300046665 Ga0495661_0253346 Ga0495661_0253346_135_686 179
51 3300046674 Ga0495588_0022449 Ga0495588_0022449_178_735 179
52 3300046674 Ga0495588_0050099 Ga0495588_0050099_812_1375 179
53 3300046679 Ga0495623_0016697 Ga0495623_0016697_3512_4075 179
54 3300046684 Ga0495669_0019577 Ga0495669_0019577_811_1362 179
55 3300046689 Ga0495613_0183272 Ga0495613_0183272_347_910 179
56 3300046690 Ga0495624_0035472 Ga0495624_0035472_1354_1917 179
57 3300046690 Ga0495624_0395916 Ga0495624_0395916_186_749 179
58 3300046692 Ga0495671_0295433 Ga0495671_0295433_142_699 179
59 3300046809 Ga0495600_0071320 Ga0495600_0071320_623_1186 179
60 3300046810 Ga0495660_0104484 Ga0495660_0104484_158_709 179
61 3300047315 Ga0495581_0101150 Ga0495581_0101150_126_689 179
62 3300047315 Ga0495581_0111042 Ga0495581_0111042_428_991 179
63 3300047317 Ga0495604_0039141 Ga0495604_0039141_100_663 179
64 3300047317 Ga0495604_0097083 Ga0495604_0097083_1010_1573 179
65 3300047319 Ga0495674_0010832 Ga0495674_0010832_8019_8576 179
66 3300047320 Ga0495672_0004111 Ga0495672_0004111_9264_9818 179
67 3300047443 Ga0495687_046747 Ga0495687_046747_592_1143 179
68 3300047444 Ga0495675_0029156 Ga0495675_0029156_1599_2162 179
69 3300047470 Ga0495681_0095636 Ga0495681_0095636_59_616 179
70 3300047673 Ga0495593_0021727 Ga0495593_0021727_885_1448 179
71 3300048088 Ga0495602_0037808 Ga0495602_0037808_1777_2340 179
72 3300048091 Ga0495626_0014495 Ga0495626_0014495_1879_2436 179
73 3300048091 Ga0495626_0171690 Ga0495626_0171690_89_640 179
74 3300048918 Ga0496115_0269246 Ga0496115_0269246_352_909 179
75 3300048918 Ga0496115_0517075 Ga0496115_0517075_114_671 179
76 3300049459 Ga0495678_008235 Ga0495678_008235_4592_5143 179
77 3300046463 Ga0495653_0155696 Ga0495653_0155696_674_1240 180
78 3300046507 Ga0495606_0173269 Ga0495606_0173269_493_1059 180
79 3300046665 Ga0495661_0064947 Ga0495661_0064947_225_785 180
80 3300047317 Ga0495604_0029175 Ga0495604_0029175_2404_2970 180
81 3300047323 Ga0495683_0153186 Ga0495683_0153186_232_786 180
82 3300047673 Ga0495593_0212510 Ga0495593_0212510_269_835 180
83 3300048918 Ga0496115_0006889 Ga0496115_0006889_1044_1610 180
84 3300002739 JGI25158J39367_1000603 JGI25158J39367_10006039 181
85 3300002773 JGI25152J39213_1028987 JGI25152J39213_10289872 181
86 3300003775 Ga0055524_1071651 Ga0055524_10716511 181
87 3300003784 Ga0055534_1023462 Ga0055534_10234622 181
88 3300003790 Ga0055528_1009687 Ga0055528_10096873 181
89 3300003794 Ga0055531_10011921 Ga0055531_100119214 181
90 3300025208 Ga0209436_101585 Ga0209436_1015854 181
91 3300025263 Ga0209565_1005639 Ga0209565_10056395 181
92 3300025273 Ga0209673_1009034 Ga0209673_10090344 181
93 3300025284 Ga0209130_1038071 Ga0209130_10380711 181
94 3300025291 Ga0209675_1001103 Ga0209675_10011032 181
95 3300025295 Ga0209564_1053373 Ga0209564_10533732 181
96 3300025298 Ga0209050_1000384 Ga0209050_100038428 181
97 3300025298 Ga0209050_1004048 Ga0209050_10040489 181
98 3300025299 Ga0209256_1004954 Ga0209256_100495410 181
99 3300025299 Ga0209256_1023618 Ga0209256_10236181 181
100 3300025302 Ga0207426_1005256 Ga0207426_10052562 181
101 3300025303 Ga0209051_1022276 Ga0209051_10222763 181
102 3300025304 Ga0209257_1000107 Ga0209257_1000107152 181
103 3300044712 Ga0453684_0394834 Ga0453684_0394834_628_1182 181
104 3300044712 Ga0453684_1189465 Ga0453684_1189465_124_678 181
105 3300046471 Ga0495650_0000015 Ga0495650_0000015_8965_9522 181
106 3300032002 Ga0307416_101396346 Ga0307416_1013963462 182
107 3300042139 Ga0450904_000419 Ga0450904_000419_7682_8257 182
108 3300045049 Ga0466959_0344426 Ga0466959_0344426_38_604 182
109 3300046452 Ga0495617_113682 Ga0495617_113682_240_806 182
110 3300046457 Ga0495590_0115734 Ga0495590_0115734_197_763 182
111 3300046458 Ga0495591_104749 Ga0495591_104749_95_661 182
112 3300046460 Ga0495638_0197517 Ga0495638_0197517_11_580 182
113 3300046491 Ga0495584_0013720 Ga0495584_0013720_2176_2742 182
114 3300046492 Ga0495585_0032488 Ga0495585_0032488_1627_2193 182
115 3300046500 Ga0495596_0012234 Ga0495596_0012234_3036_3602 182
116 3300046501 Ga0495607_0006512 Ga0495607_0006512_2178_2744 182
117 3300046506 Ga0495583_0002057 Ga0495583_0002057_7639_8208 182
118 3300046506 Ga0495583_0020211 Ga0495583_0020211_1128_1694 182
119 3300046507 Ga0495606_0026578 Ga0495606_0026578_656_1222 182
120 3300046513 Ga0495616_0001468 Ga0495616_0001468_13497_14066 182
121 3300046519 Ga0495632_0242371 Ga0495632_0242371_201_767 182
122 3300046520 Ga0495637_0027396 Ga0495637_0027396_1841_2407 182
123 3300046522 Ga0495643_0001571 Ga0495643_0001571_2326_2895 182
124 3300046523 Ga0495644_0071976 Ga0495644_0071976_426_992 182
125 3300046524 Ga0495648_0012443 Ga0495648_0012443_3771_4337 182
126 3300046528 Ga0495642_0077675 Ga0495642_0077675_761_1327 182
127 3300046538 Ga0495609_0013630 Ga0495609_0013630_2084_2650 182
128 3300046538 Ga0495609_0081173 Ga0495609_0081173_780_1346 182
129 3300046542 Ga0495597_0016996 Ga0495597_0016996_2823_3392 182
130 3300046616 Ga0495668_0040692 Ga0495668_0040692_1923_2489 182
131 3300046648 Ga0495611_0011158 Ga0495611_0011158_2098_2664 182
132 3300046660 Ga0495625_0250895 Ga0495625_0250895_112_678 182
133 3300046660 Ga0495625_0310835 Ga0495625_0310835_314_883 182
134 3300046665 Ga0495661_0126028 Ga0495661_0126028_423_992 182
135 3300046679 Ga0495623_0053399 Ga0495623_0053399_1465_2013 182
136 3300046679 Ga0495623_0275502 Ga0495623_0275502_10_558 182
137 3300046692 Ga0495671_0348450 Ga0495671_0348450_96_662 182
138 3300046794 Ga0495589_0049630 Ga0495589_0049630_747_1313 182
139 3300046810 Ga0495660_0018014 Ga0495660_0018014_129_695 182
140 3300047317 Ga0495604_0055414 Ga0495604_0055414_1236_1784 182
141 3300047323 Ga0495683_0075809 Ga0495683_0075809_613_1179 182
142 3300047447 Ga0495685_005628 Ga0495685_005628_835_1401 182
143 3300048088 Ga0495602_0022728 Ga0495602_0022728_1282_1830 182
144 3300048091 Ga0495626_0001840 Ga0495626_0001840_13934_14503 182
145 3300048091 Ga0495626_0009659 Ga0495626_0009659_432_998 182
146 3300048091 Ga0495626_0028031 Ga0495626_0028031_1902_2471 182
147 3300049460 Ga0495682_0054490 Ga0495682_0054490_100_666 182
148 3300046491 Ga0495584_0103663 Ga0495584_0103663_686_1258 183
149 3300046492 Ga0495585_0001161 Ga0495585_0001161_13455_14027 183
150 3300046492 Ga0495585_0055764 Ga0495585_0055764_1154_1726 183
151 3300003771 Ga0055526_1007030 Ga0055526_10070307 184
152 3300003775 Ga0055524_1004180 Ga0055524_10041807 184
153 3300003784 Ga0055534_1013492 Ga0055534_10134921 184
154 3300004625 Ga0055543_1002597 Ga0055543_10025977 184
155 3300005262 Ga0065165_1006800 Ga0065165_10068001 184
156 3300025208 Ga0209436_102300 Ga0209436_1023007 184
157 3300025263 Ga0209565_1045742 Ga0209565_10457421 184
158 3300025284 Ga0209130_1004016 Ga0209130_10040161 184
159 3300025291 Ga0209675_1007446 Ga0209675_10074465 184
160 3300025295 Ga0209564_1002549 Ga0209564_100254915 184
161 3300025298 Ga0209050_1000339 Ga0209050_10003391 184
162 3300025299 Ga0209256_1002671 Ga0209256_100267115 184
163 3300031548 Ga0307408_100000231 Ga0307408_10000023114 184
164 3300046492 Ga0495585_0018947 Ga0495585_0018947_2613_3197 184
165 3300046665 Ga0495661_0086955 Ga0495661_0086955_844_1428 184
166 3300046691 Ga0495670_0019076 Ga0495670_0019076_499_1086 185
167 3300049459 Ga0495678_002026 Ga0495678_002026_8849_9436 185
168 3300037312 Ga0395899_0000028 Ga0395899_0000028_55922_56500 186
169 3300046660 Ga0495625_0062532 Ga0495625_0062532_1041_1778 186
170 iso_pu_bacteria 2643221660 2644340715 186
171 3300025934 Ga0207686_10301975 Ga0207686_103019752 187
172 3300046492 Ga0495585_0105107 Ga0495585_0105107_504_1094 187
173 3300046452 Ga0495617_011224 Ga0495617_011224_233_841 188
174 3300046460 Ga0495638_0361460 Ga0495638_0361460_106_714 188
175 3300046491 Ga0495584_0000008 Ga0495584_0000008_200476_201084 188
176 3300046491 Ga0495584_0000305 Ga0495584_0000305_124_726 188
177 3300046491 Ga0495584_0140229 Ga0495584_0140229_116_718 188
178 3300046491 Ga0495584_0358717 Ga0495584_0358717_123_725 188
179 3300046492 Ga0495585_0000183 Ga0495585_0000183_45135_45743 188
180 3300046492 Ga0495585_0002300 Ga0495585_0002300_897_1499 188
181 3300046492 Ga0495585_0376339 Ga0495585_0376339_64_672 188
182 3300046500 Ga0495596_0002633 Ga0495596_0002633_2628_3230 188
183 3300046500 Ga0495596_0004324 Ga0495596_0004324_4012_4614 188
184 3300046501 Ga0495607_0160197 Ga0495607_0160197_347_955 188
185 3300046506 Ga0495583_0000141 Ga0495583_0000141_69929_70531 188
186 3300046506 Ga0495583_0050332 Ga0495583_0050332_1231_1839 188
187 3300046506 Ga0495583_0098561 Ga0495583_0098561_512_1120 188
188 3300046507 Ga0495606_0141318 Ga0495606_0141318_210_818 188
189 3300046507 Ga0495606_0151943 Ga0495606_0151943_130_738 188
190 3300046507 Ga0495606_0221231 Ga0495606_0221231_245_853 188
191 3300046513 Ga0495616_0002000 Ga0495616_0002000_12228_12830 188
192 3300046513 Ga0495616_0004252 Ga0495616_0004252_8131_8739 188
193 3300046515 Ga0495620_0062684 Ga0495620_0062684_266_874 188
194 3300046522 Ga0495643_0040859 Ga0495643_0040859_1298_1900 188
195 3300046523 Ga0495644_0033353 Ga0495644_0033353_513_1115 188
196 3300046524 Ga0495648_0000030 Ga0495648_0000030_48097_48705 188
197 3300046528 Ga0495642_0099826 Ga0495642_0099826_442_1050 188
198 3300046538 Ga0495609_0141985 Ga0495609_0141985_399_1001 188
199 3300046558 Ga0495633_0006257 Ga0495633_0006257_4276_4878 188
200 3300046558 Ga0495633_0187775 Ga0495633_0187775_140_742 188
201 3300046648 Ga0495611_0006822 Ga0495611_0006822_1465_2067 188
202 3300046691 Ga0495670_0090876 Ga0495670_0090876_423_1025 188
203 3300046794 Ga0495589_0022990 Ga0495589_0022990_579_1181 188
204 3300046810 Ga0495660_0096024 Ga0495660_0096024_68_676 188
205 3300047323 Ga0495683_0000235 Ga0495683_0000235_37527_38129 188
206 3300047323 Ga0495683_0125929 Ga0495683_0125929_412_1020 188
207 3300047443 Ga0495687_065199 Ga0495687_065199_513_1121 188
208 3300047443 Ga0495687_143735 Ga0495687_143735_68_670 188
209 3300047472 Ga0495686_0000484 Ga0495686_0000484_57708_58310 188
210 3300048091 Ga0495626_0032227 Ga0495626_0032227_20_622 188
211 3300049460 Ga0495682_0005441 Ga0495682_0005441_4565_5167 188
212 3300046459 Ga0495629_0001890 Ga0495629_0001890_4171_4749 192
213 3300046460 Ga0495638_0015120 Ga0495638_0015120_783_1361 192
214 3300046463 Ga0495653_0022460 Ga0495653_0022460_4169_4747 192
215 3300046471 Ga0495650_0013298 Ga0495650_0013298_488_1066 192
216 3300046474 Ga0495605_0021788 Ga0495605_0021788_1444_2022 192
217 3300046477 Ga0495664_0217492 Ga0495664_0217492_406_984 192
218 3300046506 Ga0495583_0011405 Ga0495583_0011405_3339_3917 192
219 3300046515 Ga0495620_0064766 Ga0495620_0064766_338_916 192
220 3300046516 Ga0495628_0131302 Ga0495628_0131302_1018_1596 192
221 3300046517 Ga0495630_0317730 Ga0495630_0317730_159_737 192
222 3300046526 Ga0495666_0139342 Ga0495666_0139342_246_824 192
223 3300046531 Ga0495665_0119550 Ga0495665_0119550_189_767 192
224 3300046542 Ga0495597_0082557 Ga0495597_0082557_287_865 192
225 3300046660 Ga0495625_0197442 Ga0495625_0197442_550_1128 192
226 3300046692 Ga0495671_0009406 Ga0495671_0009406_3564_4142 192
227 3300046694 Ga0495649_0015210 Ga0495649_0015210_989_1567 192
228 3300047320 Ga0495672_0039613 Ga0495672_0039613_971_1549 192
229 3300047321 Ga0495676_0066658 Ga0495676_0066658_47_625 192
230 3300047443 Ga0495687_063403 Ga0495687_063403_589_1167 192
231 3300047446 Ga0495679_001045 Ga0495679_001045_11574_12152 192
232 3300047673 Ga0495593_0005941 Ga0495593_0005941_1698_2276 192
233 3300048091 Ga0495626_0109360 Ga0495626_0109360_305_883 192
234 3300048906 Ga0496103_0233858 Ga0496103_0233858_396_974 192
235 3300048920 Ga0496117_0059594 Ga0496117_0059594_343_921 192
236 3300048921 Ga0496118_0018642 Ga0496118_0018642_3404_3982 192
237 3300048924 Ga0496121_0167924 Ga0496121_0167924_313_891 192
238 3300049459 Ga0495678_007406 Ga0495678_007406_475_1053 192
239 iso_pu_bacteria 2744054900 2746088720 195
240 iso_pu_bacteria 2744054901 2746097339 195
241 iso_pu_bacteria 2751185846 2753566653 195
242 3300046459 Ga0495629_0121446 Ga0495629_0121446_813_1409 198
243 3300047319 Ga0495674_0136182 Ga0495674_0136182_1039_1635 198
244 3300013105 Ga0157369_10258550 Ga0157369_102585502 199
245 3300044842 Ga0466957_0405102 Ga0466957_0405102_222_821 199
246 3300046462 Ga0495651_0147642 Ga0495651_0147642_55_654 199
247 3300046463 Ga0495653_0288153 Ga0495653_0288153_85_684 199
248 3300046472 Ga0495580_0016734 Ga0495580_0016734_3922_4521 199
249 3300046517 Ga0495630_0006191 Ga0495630_0006191_4196_4795 199
250 3300046690 Ga0495624_0049165 Ga0495624_0049165_1085_1684 199
251 3300047317 Ga0495604_0112685 Ga0495604_0112685_1119_1718 199
252 3300047471 Ga0495684_0197767 Ga0495684_0197767_548_1147 199
253 3300048088 Ga0495602_0065391 Ga0495602_0065391_2295_2894 199
254 3300048929 Ga0496126_0008623 Ga0496126_0008623_9132_9731 199
255 3300002705 JGI25156J39149_1001710 JGI25156J39149_10017106 200
256 3300031548 Ga0307408_100036155 Ga0307408_1000361552 200
257 3300046472 Ga0495580_0017698 Ga0495580_0017698_415_1026 200
258 3300047322 Ga0495680_0274631 Ga0495680_0274631_323_925 200
259 3300047444 Ga0495675_0020157 Ga0495675_0020157_1427_2029 200

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13489

Methyltransf_23

Methyltransferase domain

7

161

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ege-assembly1.cif.gz_A crystal structure of putative methyltransferase from antibiotic biosynthesis pathway (yp_324569.1) from anabaena variabilis atcc 29413 at 2.40 a resolution 0.8387 19 125
3mer-assembly2.cif.gz_B crystal structure of the methyltransferase slr1183 from synechocystis sp. pcc 6803, northeast structural genomics consortium target sgr145 0.8315 14 182
3m70-assembly1.cif.gz_A crystal structure of tehb from haemophilus influenzae 0.8176 15 180
3mer-assembly2.cif.gz_B crystal structure of the methyltransferase slr1183 from synechocystis sp. pcc 6803, northeast structural genomics consortium target sgr145 0.8094 14 182
2i6g-assembly1.cif.gz_A crystal structure of a putative methyltransferase (tehb, stm1608) from salmonella typhimurium lt2 at 1.90 a resolution 0.808 9 181
ID Description Score Start End Superfamily
af_A0A1D6FP61_65_209_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9398 28 65 3.40.50.150
af_Q93574_127_280_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9137 31 65 3.40.50.150
af_Q4D7A8_87_267_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8667 14 179 3.40.50.150
af_Q54Y84_189_377_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8655 30 168 3.40.50.150
af_Q0DEH3_59_207_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8487 28 80 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A1P8K3P7-F1-model_v4 SAM-dependent methyltransferase 0.9739 14 198 GO:0008168
GO:0032259
AF-A0A849K1W8-F1-model_v4 SDR family oxidoreductase 0.9685 14 198 GO:0016020
GO:0016491
AF-A0A0S8C2I9-F1-model_v4 SAM-dependent methyltransferase 0.9684 6 181 GO:0008168
GO:0032259
AF-A0A259RHZ3-F1-model_v4 SAM-dependent methyltransferase 0.9678 12 117 GO:0008168
GO:0032259
AF-A0A2J9HEZ8-F1-model_v4 deleted 0.966 12 200

Feature Viewer

pLDDT pTM Quality
87.32 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map