F368833

General Info

Members Datasets Scaffolds Average Seq Length
259 150 259 436

Family's Representative Sequence

Representative Sequence 3300014968|Ga0157379_10011936|Ga0157379_100119361
Length 477
Sequence VDHDLPATDQVNFSFGELNRCEFFLVRHDSRIAESISNFIQMTSISKTICIWVATIVVGLFIPLSVAQASTLDVLHYDVTLEPDIAGKSVKGTVRIRFSTDAQEAEFNCGNLAIEAVRLASAGLQFAVIDHRLKVSLPSGAKTREIEIDFHGTPKYGIQFFPDRQQVYTVFSTSQWMVCVDDPADKATLTFKLILPASLTPIANGELVSQHELPNNRRVSEWRQRTAIPTYIFGFAAGPFHVVKEKHRNVEFQYVATNYTPDELRRIFRDTPDILDFFEDRAGVKYSGKTYTQVLATDGVEQEMDSFTALRETYGKEVLKNEQDLWLGAHEFAHQWWGNMVTCRDWNHFWLNEGIASFMAAAYIEHRFGRAAYLREIETYRTNYEKVRSAGKDKSLVFPDWLHPTRDDRTLVYDKGAYVMHLLREEMGERKFWKGLRLFTQRHFGKSVVTSDFVTAMEAANEKSLKEFFAKWVYLQG

Samples

Sample ID Description Type Environment
1 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
120 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
121 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
122 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
123 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
124 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
125 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
126 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
127 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
128 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
129 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
131 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
132 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
133 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
134 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
135 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
136 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
137 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
138 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
139 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
140 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
141 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
142 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
143 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
144 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
145 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
146 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
147 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
148 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
149 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
150 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.39
Nodule 0
Rhizoplane 1.16
Rhizosphere 98.46
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 CNAas_1001910 3300000532 Bacteria 1596
2 JGI24751J29686_10000088 3300002459 Bacteria 51817
3 JGI25406J46586_10002283 3300003203 Bacteria 9045
4 Ga0065712_10072237 3300005290 Unclassified 4844
5 Ga0065715_10006526 3300005293 Bacteria 5415
6 Ga0065715_10092740 3300005293 Unclassified 4961
7 Ga0065707_10006504 3300005295 Bacteria 6402
8 Ga0070676_10088302 3300005328 Unclassified 1894
9 Ga0070670_100000293 3300005331 Bacteria 43949
10 Ga0070670_100036361 3300005331 Unclassified 4237
11 Ga0068869_100048045 3300005334 Bacteria 3084
12 Ga0068869_100084571 3300005334 Bacteria 2375
13 Ga0068869_100170823 3300005334 Bacteria 1698
14 Ga0070666_10051595 3300005335 Bacteria 2770
15 Ga0070666_10060954 3300005335 Bacteria 2554
16 Ga0070680_100000302 3300005336 Bacteria 32984
17 Ga0070682_100020042 3300005337 Bacteria 3930
18 Ga0070689_100000477 3300005340 Bacteria 23646
19 Ga0070689_100155464 3300005340 Bacteria 1846
20 Ga0070687_100015586 3300005343 Bacteria 3442
21 Ga0070687_100047632 3300005343 Bacteria 2200
22 Ga0070669_100013387 3300005353 Bacteria 5833
23 Ga0070671_100009660 3300005355 Bacteria 7750
24 Ga0070674_100055832 3300005356 Bacteria 2737
25 Ga0070673_100119738 3300005364 Unclassified 2194
26 Ga0070673_100148745 3300005364 Unclassified 1982
27 Ga0070659_100003510 3300005366 Bacteria 11172
28 Ga0070659_100084328 3300005366 Bacteria 2541
29 Ga0070667_100083907 3300005367 Bacteria 2730
30 Ga0070701_10052209 3300005438 Bacteria 2123
31 Ga0070705_100002659 3300005440 Bacteria 8944
32 Ga0070700_100000048 3300005441 Bacteria 89854
33 Ga0070694_100010034 3300005444 Bacteria 5824
34 Ga0070694_100027009 3300005444 Unclassified 3724
35 Ga0070694_100042691 3300005444 Bacteria 3030
36 Ga0070694_100043926 3300005444 Bacteria 2990
37 Ga0070708_100002089 3300005445 Bacteria 15414
38 Ga0070708_100223018 3300005445 Bacteria 1768
39 Ga0070663_100145660 3300005455 Unclassified 1812
40 Ga0070681_10000501 3300005458 Bacteria 32020
41 Ga0070681_10008494 3300005458 Bacteria 10053
42 Ga0070681_10015613 3300005458 Bacteria 7562
43 Ga0068867_100012587 3300005459 Bacteria 5983
44 Ga0070706_100090563 3300005467 Bacteria 2836
45 Ga0070707_100049723 3300005468 Unclassified 4019
46 Ga0070698_100004099 3300005471 Bacteria 16010
47 Ga0070698_100031998 3300005471 Bacteria 5451
48 Ga0070699_100000952 3300005518 Bacteria 26967
49 Ga0070699_100010338 3300005518 Bacteria 8070
50 Ga0070699_100215160 3300005518 Bacteria 1711
51 Ga0070679_100000106 3300005530 Bacteria 65572
52 Ga0070679_100013304 3300005530 Bacteria 7877
53 Ga0070697_100143456 3300005536 Bacteria 2009
54 Ga0068853_100034463 3300005539 Unclassified 4297
55 Ga0068853_100064344 3300005539 Bacteria 3180
56 Ga0070686_100006230 3300005544 Bacteria 6624
57 Ga0070686_100035837 3300005544 Unclassified 3066
58 Ga0070695_100014797 3300005545 Unclassified 4707
59 Ga0070695_100023789 3300005545 Bacteria 3771
60 Ga0070696_100197292 3300005546 Bacteria 1501
61 Ga0070693_100003120 3300005547 Bacteria 7690
62 Ga0070693_100018019 3300005547 Bacteria 3682
63 Ga0070693_100020982 3300005547 Bacteria 3454
64 Ga0070693_100021148 3300005547 Bacteria 3444
65 Ga0070704_100046917 3300005549 Bacteria 3017
66 Ga0070664_100007722 3300005564 Bacteria 8686
67 Ga0068857_100037871 3300005577 Bacteria 4273
68 Ga0068854_100038455 3300005578 Bacteria 3365
69 Ga0068856_100005570 3300005614 Bacteria 12401
70 Ga0070702_100037162 3300005615 Bacteria 2704
71 Ga0068859_100000207 3300005617 Bacteria 58182
72 Ga0068859_100012269 3300005617 Bacteria 8619
73 Ga0068859_100014372 3300005617 Bacteria 7942
74 Ga0068859_100049772 3300005617 Bacteria 4209
75 Ga0068859_100084634 3300005617 Unclassified 3216
76 Ga0068859_100085671 3300005617 Unclassified 3196
77 Ga0068859_100135303 3300005617 Bacteria 2537
78 Ga0068864_100009449 3300005618 Bacteria 8048
79 Ga0068864_100089814 3300005618 Bacteria 2707
80 Ga0068864_100111822 3300005618 Bacteria 2434
81 Ga0068864_100168024 3300005618 Bacteria 1998
82 Ga0068866_10009873 3300005718 Unclassified 4071
83 Ga0068861_100009632 3300005719 Bacteria 6674
84 Ga0068851_10044987 3300005834 Bacteria 2230
85 Ga0068870_10013043 3300005840 Bacteria 3895
86 Ga0068863_100075638 3300005841 Bacteria 3186
87 Ga0068863_100089273 3300005841 Bacteria 2922
88 Ga0068858_100098666 3300005842 Bacteria 2723
89 Ga0068860_100021070 3300005843 Bacteria 6314
90 Ga0068860_100023092 3300005843 Bacteria 6015
91 Ga0068860_100050993 3300005843 Bacteria 3938
92 Ga0068860_100064317 3300005843 Bacteria 3484
93 Ga0068860_100149176 3300005843 Bacteria 2251
94 Ga0068860_100208351 3300005843 Bacteria 1896
95 Ga0068862_100312921 3300005844 Bacteria 1447
96 Ga0081539_10006146 3300005985 Bacteria 11680
97 Ga0097621_100001989 3300006237 Bacteria 13935
98 Ga0097621_100023726 3300006237 Unclassified 4779
99 Ga0097621_100033879 3300006237 Bacteria 4071
100 Ga0068871_100013822 3300006358 Bacteria 6002
101 Ga0068871_100016864 3300006358 Bacteria 5513
102 Ga0075433_10035732 3300006852 Unclassified 4276
103 Ga0075433_10130953 3300006852 Bacteria 2228
104 Ga0075434_100090989 3300006871 Unclassified 3052
105 Ga0075434_100209871 3300006871 Bacteria 1968
106 Ga0097620_100000207 3300006931 Bacteria 58182
107 Ga0097620_100012268 3300006931 Bacteria 8619
108 Ga0097620_100014372 3300006931 Bacteria 7942
109 Ga0097620_100049769 3300006931 Bacteria 4209
110 Ga0097620_100084635 3300006931 Unclassified 3216
111 Ga0097620_100085670 3300006931 Unclassified 3196
112 Ga0097620_100135300 3300006931 Bacteria 2537
113 Ga0105240_10044320 3300009093 Bacteria 5653
114 Ga0111539_10014267 3300009094 Bacteria 9925
115 Ga0105245_10285795 3300009098 Bacteria 1614
116 Ga0114129_10032184 3300009147 Bacteria 7414
117 Ga0114129_10056125 3300009147 Bacteria 5518
118 Ga0114129_10066657 3300009147 Bacteria 5022
119 Ga0114129_10242249 3300009147 Unclassified 2424
120 Ga0105243_10010462 3300009148 Bacteria 7045
121 Ga0105243_10054814 3300009148 Bacteria 3166
122 Ga0105243_10055352 3300009148 Bacteria 3152
123 Ga0105241_10086608 3300009174 Bacteria 2464
124 Ga0105241_10148831 3300009174 Bacteria 1913
125 Ga0105242_10030410 3300009176 Unclassified 4312
126 Ga0105242_10066767 3300009176 Bacteria 2972
127 Ga0105242_10150747 3300009176 Bacteria 2027
128 Ga0105248_10003640 3300009177 Bacteria 17111
129 Ga0105248_10013007 3300009177 Bacteria 9173
130 Ga0105248_10019360 3300009177 Bacteria 7532
131 Ga0105248_10041106 3300009177 Bacteria 5183
132 Ga0105237_10158717 3300009545 Bacteria 2259
133 Ga0105238_10000682 3300009551 Bacteria 35582
134 Ga0105238_10073154 3300009551 Bacteria 3423
135 Ga0105249_10001931 3300009553 Bacteria 17999
136 Ga0105249_10042074 3300009553 Bacteria 4154
137 Ga0157373_10001972 3300013100 Bacteria 15557
138 Ga0157373_10010226 3300013100 Bacteria 6912
139 Ga0157373_10014813 3300013100 Bacteria 5712
140 Ga0157374_10034518 3300013296 Bacteria 4621
141 Ga0157378_10023969 3300013297 Bacteria 5368
142 Ga0157378_10026832 3300013297 Bacteria 5079
143 Ga0157378_10083837 3300013297 Unclassified 2885
144 Ga0163162_10003981 3300013306 Bacteria 14166
145 Ga0163162_10008786 3300013306 Bacteria 9821
146 Ga0163162_10010594 3300013306 Bacteria 8965
147 Ga0163162_10032376 3300013306 Bacteria 5193
148 Ga0163162_10044404 3300013306 Bacteria 4451
149 Ga0157372_10003637 3300013307 Bacteria 16590
150 Ga0157372_10020702 3300013307 Bacteria 7099
151 Ga0157372_10219822 3300013307 Unclassified 2202
152 Ga0157375_10034490 3300013308 Bacteria 4822
153 Ga0157375_10040177 3300013308 Bacteria 4508
154 Ga0157375_10190972 3300013308 Bacteria 2203
155 Ga0163163_10006319 3300014325 Bacteria 10345
156 Ga0163163_10025091 3300014325 Bacteria 5679
157 Ga0163163_10034147 3300014325 Bacteria 4924
158 Ga0163163_10040340 3300014325 Unclassified 4558
159 Ga0163163_10040365 3300014325 Bacteria 4557
160 Ga0163163_10069557 3300014325 Bacteria 3505
161 Ga0157380_10012382 3300014326 Bacteria 6188
162 Ga0157380_10018378 3300014326 Bacteria 5188
163 Ga0157379_10011936 3300014968 Bacteria 7591
164 Ga0157379_10103937 3300014968 Bacteria 2549
165 Ga0157379_10112464 3300014968 Bacteria 2447
166 Ga0157376_10012021 3300014969 Bacteria 6407
167 Ga0157376_10018654 3300014969 Bacteria 5326
168 Ga0207697_10009247 3300025315 Unclassified 4263
169 Ga0207710_10000444 3300025900 Bacteria 26937
170 Ga0207647_10010384 3300025904 Bacteria 6576
171 Ga0207643_10001732 3300025908 Bacteria 12228
172 Ga0207654_10044759 3300025911 Unclassified 2515
173 Ga0207707_10000006 3300025912 Bacteria 374131
174 Ga0207707_10059781 3300025912 Unclassified 3316
175 Ga0207671_10002576 3300025914 Bacteria 19182
176 Ga0207660_10005416 3300025917 Bacteria 8282
177 Ga0207662_10026531 3300025918 Bacteria 3341
178 Ga0207652_10000127 3300025921 Bacteria 82231
179 Ga0207646_10169378 3300025922 Bacteria 1972
180 Ga0207681_10055832 3300025923 Bacteria 2692
181 Ga0207694_10001261 3300025924 Bacteria 21831
182 Ga0207694_10012883 3300025924 Bacteria 6297
183 Ga0207650_10000041 3300025925 Bacteria 197115
184 Ga0207644_10017705 3300025931 Bacteria 4817
185 Ga0207690_10055568 3300025932 Bacteria 2667
186 Ga0207706_10049297 3300025933 Bacteria 3722
187 Ga0207686_10000141 3300025934 Bacteria 56428
188 Ga0207670_10000875 3300025936 Bacteria 15855
189 Ga0207691_10072642 3300025940 Unclassified 3103
190 Ga0207711_10042761 3300025941 Bacteria 3861
191 Ga0207711_10048555 3300025941 Unclassified 3630
192 Ga0207689_10012556 3300025942 Bacteria 7238
193 Ga0207689_10044637 3300025942 Unclassified 3665
194 Ga0207689_10130919 3300025942 Bacteria 2065
195 Ga0207689_10192149 3300025942 Bacteria 1684
196 Ga0207679_10189654 3300025945 Unclassified 1708
197 Ga0207712_10025612 3300025961 Bacteria 3921
198 Ga0207712_10133611 3300025961 Bacteria 1895
199 Ga0207640_10034558 3300025981 Bacteria 3156
200 Ga0207640_10144232 3300025981 Bacteria 1740
201 Ga0207703_10052633 3300026035 Bacteria 3307
202 Ga0207703_10182139 3300026035 Bacteria 1854
203 Ga0207703_10268427 3300026035 Unclassified 1545
204 Ga0207639_10134692 3300026041 Bacteria 2050
205 Ga0207708_10000054 3300026075 Bacteria 103599
206 Ga0207708_10019285 3300026075 Bacteria 5139
207 Ga0207708_10101305 3300026075 Unclassified 2229
208 Ga0207702_10036795 3300026078 Bacteria 4095
209 Ga0207641_10008855 3300026088 Bacteria 8310
210 Ga0207648_10045649 3300026089 Bacteria 3842
211 Ga0207676_10001176 3300026095 Bacteria 19643
212 Ga0207676_10068155 3300026095 Unclassified 2845
213 Ga0207676_10106270 3300026095 Unclassified 2338
214 Ga0207674_10008388 3300026116 Bacteria 11948
215 Ga0207674_10037870 3300026116 Bacteria 5011
216 Ga0207675_100001329 3300026118 Bacteria 24766
217 Ga0207675_100128118 3300026118 Unclassified 2405
218 Ga0268265_10176144 3300028380 Bacteria 1833
219 Ga0268264_10112279 3300028381 Bacteria 2389
220 Ga0268264_10133593 3300028381 Bacteria 2203
221 Ga0268264_10166062 3300028381 Bacteria 1993
222 Ga0307412_10133092 3300031911 Unclassified 1809
223 Ga0307416_100049830 3300032002 Unclassified 3333
224 Ga0307415_100060522 3300032126 Unclassified 2617
225 Ga0373949_0016613 3300035090 Bacteria 1651
226 Ga0373942_0006365 3300035207 Bacteria 2726
227 Ga0373937_0117865 3300036401 Bacteria 2473
228 Ga0395900_0342281 3300037418 Bacteria 1471
229 Ga0496102_0093104 3300048905 Bacteria 2792
230 Ga0496104_0278632 3300048907 Bacteria 1585
231 Ga0496108_0147493 3300048911 Bacteria 2029
232 Ga0501038_0000710 3300049574 Bacteria 29744
233 Ga0501202_004937 3300049652 Unclassified 2349
234 Ga0501214_000404 3300049659 Unclassified 2851
235 Ga0501216_003081 3300049660 Bacteria 2413
236 Ga0501217_001408 3300049661 Bacteria 4498
237 Ga0501223_001190 3300049663 Bacteria 6115
238 Ga0501224_000822 3300049664 Bacteria 3941
239 Ga0501227_003670 3300049665 Bacteria 3327
240 Ga0501235_001458 3300049669 Bacteria 5052
241 Ga0501251_004581 3300049681 Unclassified 1432
242 Ga0501221_006598 3300049704 Unclassified 1968
243 Ga0501225_0002398 3300049705 Bacteria 5784
244 Ga0501225_0004179 3300049705 Bacteria 4318
245 Ga0501229_004726 3300049706 Unclassified 1658
246 Ga0501234_003999 3300049707 Bacteria 2315
247 Ga0501283_000227 3300049779 Bacteria 7494
248 Ga0501226_000805 3300049853 Bacteria 4220
249 nmdc:mga05p37_109327_c1 3300050507 Unclassified 3401
250 nmdc:mga05p37_157836_c1 3300050507 Unclassified 2771
251 nmdc:mga06r32_12276_c1 3300050510 Bacteria 7725
252 nmdc:mga08y16_106143_c1 3300050511 Viruses 2924
253 nmdc:mga08y16_90071_c1 3300050511 Bacteria 3197
254 nmdc:mga0n895_320313_c1 3300050512 Unclassified 1571
255 nmdc:mga0a205_102339_c1 3300050515 Bacteria 2763
256 nmdc:mga0a205_114452_c1 3300050515 Bacteria 2596
257 nmdc:mga0a205_13114_c1 3300050515 Bacteria 7698
258 nmdc:mga0a205_42321_c1 3300050515 Bacteria 4389
259 Ga0500641_0006187 3300053096 Bacteria 4243

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300002459 JGI24751J29686_10000088 JGI24751J29686_1000008832 390
2 3300005331 Ga0070670_100000293 Ga0070670_10000029316 390
3 3300014325 Ga0163163_10006319 Ga0163163_100063191 390
4 3300025925 Ga0207650_10000041 Ga0207650_10000041145 390
5 3300025924 Ga0207694_10001261 Ga0207694_100012618 405
6 3300009174 Ga0105241_10086608 Ga0105241_100866082 406
7 3300049681 Ga0501251_004581 Ga0501251_004581_199_1422 407
8 3300049707 Ga0501234_003999 Ga0501234_003999_1082_2305 407
9 3300005547 Ga0070693_100018019 Ga0070693_1000180192 408
10 3300050507 nmdc:mga05p37_157836_c1 nmdc:mga05p37_157836_c1_496_1800 408
11 3300009147 Ga0114129_10032184 Ga0114129_100321847 410
12 3300013100 Ga0157373_10001972 Ga0157373_1000197216 410
13 3300013306 Ga0163162_10044404 Ga0163162_100444042 410
14 3300005545 Ga0070695_100014797 Ga0070695_1000147971 413
15 3300009147 Ga0114129_10242249 Ga0114129_102422493 413
16 3300025904 Ga0207647_10010384 Ga0207647_100103846 417
17 3300049665 Ga0501227_003670 Ga0501227_003670_1778_3037 418
18 3300005843 Ga0068860_100021070 Ga0068860_1000210706 419
19 3300006237 Ga0097621_100001989 Ga0097621_1000019894 419
20 3300006358 Ga0068871_100013822 Ga0068871_1000138225 419
21 3300009551 Ga0105238_10073154 Ga0105238_100731544 419
22 3300025924 Ga0207694_10012883 Ga0207694_100128835 419
23 3300005337 Ga0070682_100020042 Ga0070682_1000200423 420
24 3300026075 Ga0207708_10019285 Ga0207708_100192855 420
25 3300050515 nmdc:mga0a205_114452_c1 nmdc:mga0a205_114452_c1_1059_2324 420
26 3300005618 Ga0068864_100009449 Ga0068864_1000094496 421
27 3300013307 Ga0157372_10219822 Ga0157372_102198222 421
28 3300014968 Ga0157379_10112464 Ga0157379_101124643 421
29 3300026116 Ga0207674_10008388 Ga0207674_100083883 421
30 3300005355 Ga0070671_100009660 Ga0070671_1000096602 422
31 3300005468 Ga0070707_100049723 Ga0070707_1000497232 422
32 3300049660 Ga0501216_003081 Ga0501216_003081_28_1299 422
33 3300048907 Ga0496104_0278632 Ga0496104_0278632_289_1566 423
34 3300005458 Ga0070681_10015613 Ga0070681_100156136 424
35 3300035207 Ga0373942_0006365 Ga0373942_0006365_1334_2608 424
36 3300025932 Ga0207690_10055568 Ga0207690_100555682 425
37 3300025941 Ga0207711_10048555 Ga0207711_100485552 425
38 3300050512 nmdc:mga0n895_320313_c1 nmdc:mga0n895_320313_c1_17_1306 425
39 3300005617 Ga0068859_100135303 Ga0068859_1001353031 426
40 3300006931 Ga0097620_100135300 Ga0097620_1001353001 426
41 3300026035 Ga0207703_10052633 Ga0207703_100526332 426
42 3300035090 Ga0373949_0016613 Ga0373949_0016613_174_1454 426
43 3300049705 Ga0501225_0004179 Ga0501225_0004179_129_1409 426
44 3300049779 Ga0501283_000227 Ga0501283_000227_5233_6513 426
45 3300005293 Ga0065715_10006526 Ga0065715_100065261 427
46 3300005438 Ga0070701_10052209 Ga0070701_100522091 427
47 3300025900 Ga0207710_10000444 Ga0207710_1000044413 427
48 3300025945 Ga0207679_10189654 Ga0207679_101896541 427
49 3300049574 Ga0501038_0000710 Ga0501038_0000710_15094_16386 427
50 3300005364 Ga0070673_100148745 Ga0070673_1001487452 428
51 3300005440 Ga0070705_100002659 Ga0070705_1000026596 428
52 3300005444 Ga0070694_100010034 Ga0070694_1000100347 428
53 3300005458 Ga0070681_10008494 Ga0070681_100084944 428
54 3300005547 Ga0070693_100003120 Ga0070693_1000031202 428
55 3300005547 Ga0070693_100020982 Ga0070693_1000209822 428
56 3300005547 Ga0070693_100021148 Ga0070693_1000211482 428
57 3300005549 Ga0070704_100046917 Ga0070704_1000469172 428
58 3300005615 Ga0070702_100037162 Ga0070702_1000371622 428
59 3300005618 Ga0068864_100089814 Ga0068864_1000898142 428
60 3300005834 Ga0068851_10044987 Ga0068851_100449873 428
61 3300005843 Ga0068860_100050993 Ga0068860_1000509934 428
62 3300005843 Ga0068860_100064317 Ga0068860_1000643172 428
63 3300005844 Ga0068862_100312921 Ga0068862_1003129211 428
64 3300009174 Ga0105241_10148831 Ga0105241_101488312 428
65 3300009176 Ga0105242_10030410 Ga0105242_100304101 428
66 3300009551 Ga0105238_10000682 Ga0105238_1000068220 428
67 3300009553 Ga0105249_10001931 Ga0105249_100019319 428
68 3300013296 Ga0157374_10034518 Ga0157374_100345184 428
69 3300014325 Ga0163163_10069557 Ga0163163_100695572 428
70 3300025911 Ga0207654_10044759 Ga0207654_100447592 428
71 3300025914 Ga0207671_10002576 Ga0207671_100025769 428
72 3300025981 Ga0207640_10144232 Ga0207640_101442322 428
73 3300026095 Ga0207676_10106270 Ga0207676_101062702 428
74 3300028381 Ga0268264_10112279 Ga0268264_101122792 428
75 3300028381 Ga0268264_10133593 Ga0268264_101335932 428
76 3300050515 nmdc:mga0a205_102339_c1 nmdc:mga0a205_102339_c1_581_1882 428
77 3300003203 JGI25406J46586_10002283 JGI25406J46586_100022835 429
78 3300005290 Ga0065712_10072237 Ga0065712_100722373 429
79 3300005295 Ga0065707_10006504 Ga0065707_100065045 429
80 3300005334 Ga0068869_100048045 Ga0068869_1000480452 429
81 3300005335 Ga0070666_10051595 Ga0070666_100515952 429
82 3300005340 Ga0070689_100000477 Ga0070689_10000047712 429
83 3300005353 Ga0070669_100013387 Ga0070669_1000133872 429
84 3300005356 Ga0070674_100055832 Ga0070674_1000558321 429
85 3300005367 Ga0070667_100083907 Ga0070667_1000839071 429
86 3300005444 Ga0070694_100027009 Ga0070694_1000270093 429
87 3300005577 Ga0068857_100037871 Ga0068857_1000378712 429
88 3300005578 Ga0068854_100038455 Ga0068854_1000384552 429
89 3300005617 Ga0068859_100084634 Ga0068859_1000846343 429
90 3300005617 Ga0068859_100085671 Ga0068859_1000856712 429
91 3300005618 Ga0068864_100111822 Ga0068864_1001118222 429
92 3300005841 Ga0068863_100075638 Ga0068863_1000756384 429
93 3300005841 Ga0068863_100089273 Ga0068863_1000892732 429
94 3300005842 Ga0068858_100098666 Ga0068858_1000986662 429
95 3300005843 Ga0068860_100208351 Ga0068860_1002083511 429
96 3300005985 Ga0081539_10006146 Ga0081539_100061466 429
97 3300006237 Ga0097621_100033879 Ga0097621_1000338792 429
98 3300006358 Ga0068871_100016864 Ga0068871_1000168642 429
99 3300006931 Ga0097620_100084635 Ga0097620_1000846352 429
100 3300006931 Ga0097620_100085670 Ga0097620_1000856702 429
101 3300009094 Ga0111539_10014267 Ga0111539_100142672 429
102 3300009176 Ga0105242_10066767 Ga0105242_100667673 429
103 3300009177 Ga0105248_10041106 Ga0105248_100411064 429
104 3300013297 Ga0157378_10023969 Ga0157378_100239697 429
105 3300013306 Ga0163162_10008786 Ga0163162_100087862 429
106 3300013306 Ga0163162_10010594 Ga0163162_100105943 429
107 3300013308 Ga0157375_10034490 Ga0157375_100344907 429
108 3300014969 Ga0157376_10012021 Ga0157376_100120215 429
109 3300025923 Ga0207681_10055832 Ga0207681_100558322 429
110 3300025936 Ga0207670_10000875 Ga0207670_1000087512 429
111 3300025941 Ga0207711_10042761 Ga0207711_100427612 429
112 3300025942 Ga0207689_10044637 Ga0207689_100446372 429
113 3300025981 Ga0207640_10034558 Ga0207640_100345582 429
114 3300026075 Ga0207708_10101305 Ga0207708_101013052 429
115 3300026088 Ga0207641_10008855 Ga0207641_100088556 429
116 3300026095 Ga0207676_10001176 Ga0207676_100011766 429
117 3300026116 Ga0207674_10037870 Ga0207674_100378703 429
118 3300028381 Ga0268264_10166062 Ga0268264_101660621 429
119 3300050511 nmdc:mga08y16_106143_c1 nmdc:mga08y16_106143_c1_719_2011 429
120 3300005441 Ga0070700_100000048 Ga0070700_10000004832 430
121 3300005444 Ga0070694_100043926 Ga0070694_1000439263 430
122 3300005617 Ga0068859_100000207 Ga0068859_10000020726 430
123 3300005719 Ga0068861_100009632 Ga0068861_1000096326 430
124 3300005840 Ga0068870_10013043 Ga0068870_100130433 430
125 3300006871 Ga0075434_100090989 Ga0075434_1000909891 430
126 3300006931 Ga0097620_100000207 Ga0097620_10000020727 430
127 3300009093 Ga0105240_10044320 Ga0105240_100443207 430
128 3300009148 Ga0105243_10055352 Ga0105243_100553523 430
129 3300009177 Ga0105248_10003640 Ga0105248_1000364018 430
130 3300013307 Ga0157372_10003637 Ga0157372_100036373 430
131 3300025908 Ga0207643_10001732 Ga0207643_100017326 430
132 3300026075 Ga0207708_10000054 Ga0207708_1000005440 430
133 3300026089 Ga0207648_10045649 Ga0207648_100456495 430
134 3300026118 Ga0207675_100001329 Ga0207675_10000132916 430
135 3300048911 Ga0496108_0147493 Ga0496108_0147493_613_1905 430
136 3300050515 nmdc:mga0a205_42321_c1 nmdc:mga0a205_42321_c1_2718_4013 430
137 3300005364 Ga0070673_100119738 Ga0070673_1001197381 431
138 3300005445 Ga0070708_100223018 Ga0070708_1002230181 431
139 3300005617 Ga0068859_100014372 Ga0068859_1000143722 431
140 3300006931 Ga0097620_100014372 Ga0097620_1000143722 431
141 3300013100 Ga0157373_10010226 Ga0157373_100102264 431
142 3300025942 Ga0207689_10192149 Ga0207689_101921492 431
143 3300026035 Ga0207703_10182139 Ga0207703_101821391 431
144 3300026041 Ga0207639_10134692 Ga0207639_101346922 431
145 3300031911 Ga0307412_10133092 Ga0307412_101330922 431
146 3300032002 Ga0307416_100049830 Ga0307416_1000498304 431
147 3300032126 Ga0307415_100060522 Ga0307415_1000605221 431
148 3300049652 Ga0501202_004937 Ga0501202_004937_501_1799 431
149 3300049659 Ga0501214_000404 Ga0501214_000404_779_2077 431
150 3300049661 Ga0501217_001408 Ga0501217_001408_1768_3066 431
151 3300049663 Ga0501223_001190 Ga0501223_001190_1972_3270 431
152 3300049664 Ga0501224_000822 Ga0501224_000822_2356_3654 431
153 3300049669 Ga0501235_001458 Ga0501235_001458_1310_2608 431
154 3300049704 Ga0501221_006598 Ga0501221_006598_59_1357 431
155 3300049705 Ga0501225_0002398 Ga0501225_0002398_185_1483 431
156 3300049706 Ga0501229_004726 Ga0501229_004726_39_1337 431
157 3300049853 Ga0501226_000805 Ga0501226_000805_139_1437 431
158 3300050510 nmdc:mga06r32_12276_c1 nmdc:mga06r32_12276_c1_5668_6981 431
159 3300005518 Ga0070699_100215160 Ga0070699_1002151602 432
160 3300005530 Ga0070679_100013304 Ga0070679_1000133048 432
161 3300005617 Ga0068859_100012269 Ga0068859_1000122692 432
162 3300006852 Ga0075433_10035732 Ga0075433_100357323 432
163 3300006931 Ga0097620_100012268 Ga0097620_1000122682 432
164 3300009147 Ga0114129_10056125 Ga0114129_100561253 432
165 3300009177 Ga0105248_10019360 Ga0105248_100193602 432
166 3300013308 Ga0157375_10190972 Ga0157375_101909722 432
167 3300014325 Ga0163163_10040365 Ga0163163_100403652 432
168 3300014968 Ga0157379_10011936 Ga0157379_100119361 432
169 3300025931 Ga0207644_10017705 Ga0207644_100177055 432
170 3300037418 Ga0395900_0342281 Ga0395900_0342281_118_1455 432
171 3300050507 nmdc:mga05p37_109327_c1 nmdc:mga05p37_109327_c1_264_1586 432
172 3300005334 Ga0068869_100084571 Ga0068869_1000845711 433
173 3300005343 Ga0070687_100015586 Ga0070687_1000155865 433
174 3300005444 Ga0070694_100042691 Ga0070694_1000426913 433
175 3300005518 Ga0070699_100000952 Ga0070699_1000009527 433
176 3300005544 Ga0070686_100006230 Ga0070686_1000062306 433
177 3300005545 Ga0070695_100023789 Ga0070695_1000237892 433
178 3300005546 Ga0070696_100197292 Ga0070696_1001972921 433
179 3300005843 Ga0068860_100149176 Ga0068860_1001491763 433
180 3300006852 Ga0075433_10130953 Ga0075433_101309533 433
181 3300006871 Ga0075434_100209871 Ga0075434_1002098712 433
182 3300009148 Ga0105243_10054814 Ga0105243_100548142 433
183 3300009176 Ga0105242_10150747 Ga0105242_101507471 433
184 3300009553 Ga0105249_10042074 Ga0105249_100420742 433
185 3300013297 Ga0157378_10026832 Ga0157378_100268326 433
186 3300013307 Ga0157372_10020702 Ga0157372_100207022 433
187 3300014326 Ga0157380_10012382 Ga0157380_100123824 433
188 3300014326 Ga0157380_10018378 Ga0157380_100183783 433
189 3300025918 Ga0207662_10026531 Ga0207662_100265311 433
190 3300025933 Ga0207706_10049297 Ga0207706_100492971 433
191 3300025942 Ga0207689_10130919 Ga0207689_101309191 433
192 3300025961 Ga0207712_10025612 Ga0207712_100256121 433
193 3300025961 Ga0207712_10133611 Ga0207712_101336111 433
194 3300026035 Ga0207703_10268427 Ga0207703_102684271 433
195 3300028380 Ga0268265_10176144 Ga0268265_101761442 433
196 3300050511 nmdc:mga08y16_90071_c1 nmdc:mga08y16_90071_c1_121_1452 433
197 3300005539 Ga0068853_100064344 Ga0068853_1000643443 434
198 3300005614 Ga0068856_100005570 Ga0068856_1000055706 434
199 3300009545 Ga0105237_10158717 Ga0105237_101587171 434
200 3300026078 Ga0207702_10036795 Ga0207702_100367952 434
201 3300048905 Ga0496102_0093104 Ga0496102_0093104_1436_2758 434
202 3300005293 Ga0065715_10092740 Ga0065715_100927404 435
203 3300005471 Ga0070698_100031998 Ga0070698_1000319983 435
204 3300014325 Ga0163163_10034147 Ga0163163_100341475 435
205 3300005340 Ga0070689_100155464 Ga0070689_1001554641 436
206 3300005343 Ga0070687_100047632 Ga0070687_1000476321 436
207 3300005459 Ga0068867_100012587 Ga0068867_1000125871 436
208 3300005544 Ga0070686_100035837 Ga0070686_1000358373 436
209 3300005617 Ga0068859_100049772 Ga0068859_1000497724 436
210 3300005618 Ga0068864_100168024 Ga0068864_1001680241 436
211 3300005718 Ga0068866_10009873 Ga0068866_100098734 436
212 3300006237 Ga0097621_100023726 Ga0097621_1000237265 436
213 3300006931 Ga0097620_100049769 Ga0097620_1000497694 436
214 3300009098 Ga0105245_10285795 Ga0105245_102857952 436
215 3300009148 Ga0105243_10010462 Ga0105243_100104622 436
216 3300014969 Ga0157376_10018654 Ga0157376_100186544 436
217 3300025315 Ga0207697_10009247 Ga0207697_100092471 436
218 3300025940 Ga0207691_10072642 Ga0207691_100726423 436
219 3300025942 Ga0207689_10012556 Ga0207689_100125562 436
220 3300026118 Ga0207675_100128118 Ga0207675_1001281183 436
221 3300005336 Ga0070680_100000302 Ga0070680_10000030235 437
222 3300005445 Ga0070708_100002089 Ga0070708_10000208911 437
223 3300005458 Ga0070681_10000501 Ga0070681_1000050111 437
224 3300005467 Ga0070706_100090563 Ga0070706_1000905633 437
225 3300005471 Ga0070698_100004099 Ga0070698_10000409914 437
226 3300005518 Ga0070699_100010338 Ga0070699_10001033811 437
227 3300005530 Ga0070679_100000106 Ga0070679_10000010617 437
228 3300005536 Ga0070697_100143456 Ga0070697_1001434562 437
229 3300013308 Ga0157375_10040177 Ga0157375_100401775 437
230 3300025912 Ga0207707_10000006 Ga0207707_1000000620 437
231 3300025917 Ga0207660_10005416 Ga0207660_100054165 437
232 3300025921 Ga0207652_10000127 Ga0207652_1000012759 437
233 3300025922 Ga0207646_10169378 Ga0207646_101693782 437
234 3300005331 Ga0070670_100036361 Ga0070670_1000363612 438
235 3300050515 nmdc:mga0a205_13114_c1 nmdc:mga0a205_13114_c1_4310_5665 438
236 3300009147 Ga0114129_10066657 Ga0114129_100666573 439
237 3300036401 Ga0373937_0117865 Ga0373937_0117865_383_1732 439
238 3300005328 Ga0070676_10088302 Ga0070676_100883022 440
239 3300005334 Ga0068869_100170823 Ga0068869_1001708232 440
240 3300013297 Ga0157378_10083837 Ga0157378_100838372 440
241 3300053096 Ga0500641_0006187 Ga0500641_0006187_1514_2866 440
242 3300005335 Ga0070666_10060954 Ga0070666_100609542 441
243 3300005366 Ga0070659_100003510 Ga0070659_10000351011 441
244 3300005366 Ga0070659_100084328 Ga0070659_1000843282 441
245 3300005455 Ga0070663_100145660 Ga0070663_1001456602 441
246 3300005539 Ga0068853_100034463 Ga0068853_1000344632 441
247 3300005564 Ga0070664_100007722 Ga0070664_1000077228 441
248 3300005843 Ga0068860_100023092 Ga0068860_1000230926 441
249 3300009177 Ga0105248_10013007 Ga0105248_100130075 441
250 3300013100 Ga0157373_10014813 Ga0157373_100148135 441
251 3300013306 Ga0163162_10003981 Ga0163162_1000398113 441
252 3300013306 Ga0163162_10032376 Ga0163162_100323763 441
253 3300014325 Ga0163163_10025091 Ga0163163_100250918 441
254 3300014325 Ga0163163_10040340 Ga0163163_100403406 441
255 3300014968 Ga0157379_10103937 Ga0157379_101039373 441
256 3300025912 Ga0207707_10059781 Ga0207707_100597812 441
257 3300025934 Ga0207686_10000141 Ga0207686_100001419 441
258 3300026095 Ga0207676_10068155 Ga0207676_100681552 441
259 3300000532 CNAas_1001910 CNAas_10019101 444

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF17900

Peptidase_M1_N

Peptidase M1 N-terminal domain

74

232

0.87

PF01433

Peptidase_M1

Peptidase family M1 domain

268

472

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
5c97-assembly2.cif.gz_B insulin regulated aminopeptidase 0.8762 28 436
4pj6-assembly1.cif.gz_B crystal structure of human insulin regulated aminopeptidase with lysine in active site 0.8694 27 437
4p8q-assembly1.cif.gz_B crystal structure of human insulin regulated aminopeptidase with alanine in active site 0.8676 27 437
7zyf-assembly1.cif.gz_A insulin regulated aminopeptidase (irap) in complex with a nanomolar alpha hydroxy beta amino acid based inhibitor. 0.8652 27 437
7eg9-assembly1.cif.gz_B tfiid-based intermediate pic on scp promoter 0.8651 28 437
ID Description Score Start End Superfamily
1gw6A01 Mainly Beta;Sandwich;Immunoglobulin-like;tricorn interacting facor f3 domain 0.9286 29 201 2.60.40.1730
af_P52922_12_202_2.60.40.1730 Mainly Beta;Sandwich;Immunoglobulin-like;tricorn interacting facor f3 domain 0.9151 30 201 2.60.40.1730
af_Q9TYN3_74_293_2.60.40.1730 Mainly Beta;Sandwich;Immunoglobulin-like;tricorn interacting facor f3 domain 0.914 32 201 2.60.40.1730
af_O44183_22_211_2.60.40.1730 Mainly Beta;Sandwich;Immunoglobulin-like;tricorn interacting facor f3 domain 0.9071 30 201 2.60.40.1730
af_Q9U2H2_362_620_1.10.390.10 Mainly Alpha;Orthogonal Bundle;Neutral Protease; domain 2;Neutral Protease Domain 2 0.9023 206 437 1.10.390.10
ID Description Score Start End GO Terms
AF-A0A3B8IQQ8-F1-model_v4 Peptidase M1 membrane alanine aminopeptidase domain-containing protein 0.9771 322 436 GO:0008237
GO:0008270
AF-A0A1G9IKA8-F1-model_v4 Aminopeptidase N (EC 3.4.11.2) 0.9599 20 437 GO:0005615
GO:0005737
GO:0006508
GO:0008270
GO:0016020
GO:0042277
GO:0043171
GO:0070006
AF-A0A3C0UVD6-F1-model_v4 Peptidase M1 0.9436 28 177
AF-A0A0S2FEE6-F1-model_v4 Aminopeptidase N (EC 3.4.11.2) 0.9433 20 444 GO:0005615
GO:0005737
GO:0006508
GO:0008270
GO:0016020
GO:0042277
GO:0043171
GO:0070006
AF-A0A7C2XL87-F1-model_v4 Aminopeptidase 0.943 28 205 GO:0004177
GO:0005829

Feature Viewer

pLDDT pTM Quality
88.72 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map