F368811

General Info

Members Datasets Scaffolds Average Seq Length
259 192 259 181

Family's Representative Sequence

Representative Sequence 3300013104|Ga0157370_10268639|Ga0157370_102686392
Length 208
Sequence LRLAITPLAHVSHAYVCNHRTSPSVLVALTATVYNFDVQLSDVDRGVYESLSIRAARHPSETEEYLATRVLAYCLEYTDGITFSKGLSEPDEPALVVRDLTGALKSWIEVGSPTADRLHKASKAAPRVVVYTYRDPAQLVRQLASERIHRAHEIEIYGISRPLIDELVARLDRRTTLDLAVTERHLYVTIAGQTFEGVVQPERLAGQD

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
58 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
78 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
122 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
123 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
124 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
125 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
126 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
127 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
128 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
129 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
130 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
131 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
132 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
133 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
134 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
135 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
136 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
137 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
138 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
139 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
140 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
141 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
142 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
143 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
144 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
145 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
146 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
147 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
148 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
149 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
150 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
151 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
152 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
153 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
154 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
155 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
156 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
157 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
158 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
159 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
160 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
161 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
162 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
163 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
164 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
165 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
166 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
167 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
168 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
169 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
170 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
171 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
172 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
173 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
174 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
175 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
176 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
177 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
178 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
183 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
184 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
185 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
186 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
187 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
189 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
190 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
191 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
192 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.61
Metatranscriptomes 0.39
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.39
Nodule 0
Rhizoplane 0.77
Rhizosphere 96.53
Stem 0
Stem Tuber 0
Unclassified 2.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10419138 3300005327 Unclassified 1151
2 Ga0070683_100008989 3300005329 Bacteria 8517
3 Ga0070683_100016571 3300005329 Bacteria 6502
4 Ga0070683_100286122 3300005329 Bacteria 1568
5 Ga0070683_100544908 3300005329 Bacteria 1109
6 Ga0070690_100000216 3300005330 Bacteria 30017
7 Ga0070690_100053898 3300005330 Bacteria 2574
8 Ga0070677_10024607 3300005333 Bacteria 2240
9 Ga0068869_100009821 3300005334 Bacteria 6216
10 Ga0070680_100000469 3300005336 Bacteria 27578
11 Ga0070680_100024170 3300005336 Bacteria 4849
12 Ga0070680_100365210 3300005336 Bacteria 1228
13 Ga0070682_100004786 3300005337 Bacteria 7521
14 Ga0068868_100004312 3300005338 Bacteria 9964
15 Ga0068868_100517803 3300005338 Bacteria 1047
16 Ga0070660_101197156 3300005339 Bacteria 644
17 Ga0070689_100006563 3300005340 Bacteria 8068
18 Ga0070691_10000528 3300005341 Bacteria 14397
19 Ga0070687_100000604 3300005343 Bacteria 11929
20 Ga0070692_10013366 3300005345 Bacteria 3824
21 Ga0070669_100000563 3300005353 Bacteria 27598
22 Ga0070669_100271123 3300005353 Bacteria 1357
23 Ga0070669_100272830 3300005353 Bacteria 1353
24 Ga0070669_100699089 3300005353 Bacteria 856
25 Ga0070675_100024039 3300005354 Bacteria 4877
26 Ga0070671_100093567 3300005355 Unclassified 2519
27 Ga0070674_100265253 3300005356 Unclassified 1355
28 Ga0070674_101054238 3300005356 Bacteria 716
29 Ga0070673_100010545 3300005364 Bacteria 6259
30 Ga0070673_100046021 3300005364 Unclassified 3387
31 Ga0070688_100187771 3300005365 Unclassified 1438
32 Ga0070659_100422632 3300005366 Bacteria 1127
33 Ga0070659_100455645 3300005366 Bacteria 1086
34 Ga0070667_100126217 3300005367 Bacteria 2230
35 Ga0070667_100299505 3300005367 Bacteria 1448
36 Ga0070701_10002596 3300005438 Bacteria 6998
37 Ga0070705_100000554 3300005440 Bacteria 21689
38 Ga0070700_100000281 3300005441 Bacteria 27271
39 Ga0070694_100000565 3300005444 Bacteria 20475
40 Ga0070678_100090063 3300005456 Unclassified 2350
41 Ga0070662_101221934 3300005457 Bacteria 646
42 Ga0070681_10000319 3300005458 Bacteria 39102
43 Ga0068867_100000206 3300005459 Bacteria 39309
44 Ga0068867_100559146 3300005459 Bacteria 992
45 Ga0070679_100034844 3300005530 Bacteria 4992
46 Ga0070679_100066916 3300005530 Bacteria 3582
47 Ga0070679_100101925 3300005530 Unclassified 2857
48 Ga0070679_100158856 3300005530 Bacteria 2235
49 Ga0070679_100198875 3300005530 Bacteria 1971
50 Ga0070684_100014361 3300005535 Bacteria 6412
51 Ga0070684_101162704 3300005535 Bacteria 726
52 Ga0068853_100359448 3300005539 Bacteria 1356
53 Ga0070672_100245987 3300005543 Bacteria 1505
54 Ga0070686_100000711 3300005544 Bacteria 19359
55 Ga0070695_100000281 3300005545 Bacteria 25630
56 Ga0070696_100004140 3300005546 Bacteria 9667
57 Ga0070693_100000162 3300005547 Bacteria 30827
58 Ga0070665_100956009 3300005548 Bacteria 869
59 Ga0070704_100010913 3300005549 Bacteria 5540
60 Ga0070664_100878502 3300005564 Bacteria 840
61 Ga0068854_100004064 3300005578 Bacteria 9188
62 Ga0068856_100040331 3300005614 Bacteria 4585
63 Ga0070702_100000093 3300005615 Bacteria 26493
64 Ga0068852_100064759 3300005616 Bacteria 3187
65 Ga0068859_100003333 3300005617 Bacteria 16329
66 Ga0068859_100003739 3300005617 Bacteria 15512
67 Ga0068859_100839597 3300005617 Bacteria 1005
68 Ga0068866_10000256 3300005718 Bacteria 24958
69 Ga0068861_100000355 3300005719 Bacteria 26109
70 Ga0068870_10012596 3300005840 Bacteria 3955
71 Ga0068870_10079855 3300005840 Bacteria 1806
72 Ga0068858_100026157 3300005842 Bacteria 5425
73 Ga0068858_101504243 3300005842 Bacteria 664
74 Ga0068860_100002594 3300005843 Bacteria 18905
75 Ga0068862_100000381 3300005844 Bacteria 47919
76 Ga0097621_100000303 3300006237 Bacteria 33347
77 Ga0068871_100006128 3300006358 Bacteria 8473
78 Ga0075434_100283608 3300006871 Bacteria 1676
79 Ga0068865_100034139 3300006881 Bacteria 3411
80 Ga0097620_100003333 3300006931 Bacteria 16329
81 Ga0097620_100003738 3300006931 Bacteria 15512
82 Ga0097620_100839396 3300006931 Bacteria 1005
83 Ga0075435_100074900 3300007076 Bacteria 2770
84 Ga0105250_10062567 3300009092 Bacteria 1498
85 Ga0105240_10363216 3300009093 Unclassified 1639
86 Ga0111539_10578804 3300009094 Bacteria 1308
87 Ga0105245_10002702 3300009098 Bacteria 15962
88 Ga0114129_11975015 3300009147 Bacteria 706
89 Ga0105243_10000631 3300009148 Bacteria 34959
90 Ga0105241_10033493 3300009174 Bacteria 3857
91 Ga0105242_10003476 3300009176 Bacteria 12246
92 Ga0105248_10216328 3300009177 Bacteria 2158
93 Ga0105248_10217539 3300009177 Bacteria 2151
94 Ga0105237_10078678 3300009545 Bacteria 3287
95 Ga0105238_10456525 3300009551 Unclassified 1275
96 Ga0105249_10003937 3300009553 Bacteria 12818
97 Ga0105249_10336171 3300009553 Bacteria 1526
98 Ga0105239_10052100 3300010375 Bacteria 4487
99 Ga0157370_10000364 3300013104 Bacteria 57195
100 Ga0157370_10266672 3300013104 Unclassified 1582
101 Ga0157370_10268639 3300013104 Unclassified 1576
102 Ga0157369_10055717 3300013105 Bacteria 4267
103 Ga0157378_10005443 3300013297 Bacteria 11158
104 Ga0157372_10005471 3300013307 Bacteria 13496
105 Ga0157377_10038555 3300014745 Bacteria 2639
106 Ga0157377_10376220 3300014745 Bacteria 960
107 Ga0157379_10103658 3300014968 Bacteria 2553
108 Ga0213876_10109359 3300021384 Bacteria 1467
109 Ga0207642_10000588 3300025899 Bacteria 11204
110 Ga0207647_10101566 3300025904 Bacteria 1706
111 Ga0207643_10015114 3300025908 Bacteria 4199
112 Ga0207643_10210341 3300025908 Bacteria 1187
113 Ga0207643_10520275 3300025908 Bacteria 762
114 Ga0207654_10537955 3300025911 Unclassified 829
115 Ga0207707_10001048 3300025912 Bacteria 26537
116 Ga0207695_10006196 3300025913 Bacteria 15589
117 Ga0207660_10003314 3300025917 Bacteria 10518
118 Ga0207660_10004653 3300025917 Bacteria 8942
119 Ga0207660_10132786 3300025917 Bacteria 1897
120 Ga0207662_10000257 3300025918 Bacteria 24677
121 Ga0207662_10311039 3300025918 Bacteria 1049
122 Ga0207662_10766376 3300025918 Bacteria 679
123 Ga0207652_10006262 3300025921 Bacteria 9603
124 Ga0207652_10038255 3300025921 Bacteria 4065
125 Ga0207652_10108589 3300025921 Bacteria 2459
126 Ga0207652_10109000 3300025921 Bacteria 2454
127 Ga0207652_10374417 3300025921 Bacteria 1285
128 Ga0207681_10600520 3300025923 Bacteria 909
129 Ga0207694_10889864 3300025924 Bacteria 753
130 Ga0207659_10060953 3300025926 Bacteria 2717
131 Ga0207687_10002535 3300025927 Bacteria 12403
132 Ga0207644_10044538 3300025931 Bacteria 3153
133 Ga0207690_10403555 3300025932 Bacteria 1090
134 Ga0207686_10007586 3300025934 Bacteria 5843
135 Ga0207709_10061611 3300025935 Unclassified 2345
136 Ga0207670_10002665 3300025936 Bacteria 9390
137 Ga0207670_10746818 3300025936 Bacteria 812
138 Ga0207669_10832738 3300025937 Bacteria 767
139 Ga0207704_10000798 3300025938 Bacteria 13929
140 Ga0207691_10017308 3300025940 Bacteria 6836
141 Ga0207711_10175298 3300025941 Bacteria 1948
142 Ga0207689_10001220 3300025942 Bacteria 24704
143 Ga0207661_10014694 3300025944 Bacteria 5744
144 Ga0207661_10140558 3300025944 Bacteria 2077
145 Ga0207661_10525688 3300025944 Unclassified 1082
146 Ga0207679_10148217 3300025945 Bacteria 1906
147 Ga0207667_10086720 3300025949 Unclassified 3239
148 Ga0207667_10397505 3300025949 Unclassified 1403
149 Ga0207651_10419302 3300025960 Bacteria 1142
150 Ga0207712_10013923 3300025961 Bacteria 5159
151 Ga0207658_10134997 3300025986 Bacteria 1988
152 Ga0207677_10011010 3300026023 Bacteria 5138
153 Ga0207677_10665646 3300026023 Bacteria 920
154 Ga0207703_10010158 3300026035 Bacteria 7380
155 Ga0207639_10097816 3300026041 Bacteria 2364
156 Ga0207708_10008364 3300026075 Bacteria 7659
157 Ga0207702_10048596 3300026078 Bacteria 3578
158 Ga0207702_10389129 3300026078 Bacteria 1342
159 Ga0207648_10001304 3300026089 Bacteria 27765
160 Ga0207676_10121947 3300026095 Unclassified 2200
161 Ga0207674_10060494 3300026116 Bacteria 3829
162 Ga0207674_10461024 3300026116 Bacteria 1228
163 Ga0207675_100000900 3300026118 Bacteria 29714
164 Ga0207683_10278214 3300026121 Bacteria 1529
165 Ga0207698_10051196 3300026142 Bacteria 3156
166 Ga0268266_10320384 3300028379 Bacteria 1451
167 Ga0268265_10012740 3300028380 Bacteria 5707
168 Ga0268264_10023040 3300028381 Bacteria 5081
169 Ga0265762_1037871 3300030760 Unclassified 935
170 Ga0307408_100407755 3300031548 Bacteria 1169
171 Ga0307408_100627841 3300031548 Bacteria 958
172 Ga0316576_10219970 3300031727 Bacteria 1429
173 Ga0307405_10895198 3300031731 Unclassified 750
174 Ga0307413_10000154 3300031824 Bacteria 18659
175 Ga0307413_10313844 3300031824 Unclassified 1195
176 Ga0307410_10003342 3300031852 Bacteria 8031
177 Ga0307410_10261789 3300031852 Bacteria 1349
178 Ga0307406_10004953 3300031901 Bacteria 7256
179 Ga0307406_10586690 3300031901 Bacteria 917
180 Ga0307407_10002140 3300031903 Bacteria 7598
181 Ga0307407_10085951 3300031903 Bacteria 1915
182 Ga0307412_10060429 3300031911 Bacteria 2543
183 Ga0307409_100239175 3300031995 Unclassified 1652
184 Ga0307416_100001413 3300032002 Bacteria 13018
185 Ga0307416_100123644 3300032002 Bacteria 2313
186 Ga0307416_100218970 3300032002 Bacteria 1824
187 Ga0307414_10004651 3300032004 Bacteria 7474
188 Ga0307411_10003999 3300032005 Bacteria 6966
189 Ga0307415_100005170 3300032126 Bacteria 6888
190 Ga0307415_100103135 3300032126 Bacteria 2098
191 Ga0307415_100180466 3300032126 Unclassified 1656
192 Ga0373944_0079884 3300035089 Bacteria 1078
193 Ga0373932_0070652 3300035112 Unclassified 1082
194 Ga0373939_0035533 3300035114 Unclassified 1469
195 Ga0373945_0173615 3300035116 Bacteria 884
196 Ga0373943_0077798 3300035170 Bacteria 1695
197 Ga0373946_0026079 3300035171 Bacteria 2302
198 Ga0373961_0043995 3300035241 Bacteria 1301
199 Ga0373924_0032884 3300035410 Bacteria 2091
200 Ga0373931_0028143 3300035691 Bacteria 2874
201 Ga0373931_0693776 3300035691 Bacteria 672
202 Ga0373935_0011763 3300035692 Bacteria 5257
203 Ga0373927_0014275 3300035695 Bacteria 5264
204 Ga0373927_0236043 3300035695 Bacteria 1201
205 Ga0373947_0132519 3300035725 Unclassified 1592
206 Ga0373925_0038054 3300037068 Bacteria 3554
207 Ga0395900_0043098 3300037418 Bacteria 4650
208 Ga0395905_0034926 3300037471 Bacteria 4720
209 Ga0395901_0002411 3300038443 Bacteria 18976
210 Ga0436365_0082756 3300039437 Bacteria 1411
211 Ga0436365_0960080 3300039437 Bacteria 2162
212 Ga0436365_0987495 3300039437 Unclassified 1485
213 Ga0436365_1610390 3300039437 Bacteria 1430
214 Ga0436365_1691578 3300039437 Bacteria 1071
215 Ga0439431_0127953 3300041997 Bacteria 712
216 Ga0439446_0036643 3300042156 Unclassified 1434
217 Ga0439434_0234197 3300042435 Bacteria 625
218 Ga0439460_0026238 3300042461 Unclassified 1628
219 Ga0466961_0055606 3300044693 Bacteria 2523
220 Ga0466959_0700525 3300045049 Bacteria 679
221 Ga0451576_0007143 3300045051 Bacteria 13475
222 Ga0466967_1263028 3300045976 Unclassified 736
223 Ga0495582_0121717 3300046473 Unclassified 1470
224 Ga0495639_0062048 3300046475 Bacteria 1714
225 Ga0495664_0101582 3300046477 Bacteria 1733
226 Ga0495594_0005168 3300046499 Bacteria 6710
227 Ga0495594_0093213 3300046499 Bacteria 1689
228 Ga0495594_0205185 3300046499 Bacteria 1123
229 Ga0495630_0015200 3300046517 Bacteria 5616
230 Ga0495640_0278591 3300046533 Bacteria 1042
231 Ga0495586_0003196 3300046535 Bacteria 8810
232 Ga0495586_0004551 3300046535 Bacteria 7410
233 Ga0495635_0053198 3300046663 Bacteria 2790
234 Ga0495659_0115699 3300046664 Unclassified 1051
235 Ga0495599_0019845 3300046678 Bacteria 4186
236 Ga0495658_0026196 3300046683 Bacteria 3123
237 Ga0495581_0008987 3300047315 Bacteria 5782
238 Ga0495674_0105439 3300047319 Bacteria 2395
239 Ga0495674_0120559 3300047319 Unclassified 2216
240 Ga0495672_0007958 3300047320 Bacteria 7903
241 Ga0495593_0056081 3300047673 Unclassified 2072
242 Ga0496108_1117411 3300048911 Unclassified 669
243 Ga0496112_0265147 3300048915 Unclassified 1667
244 Ga0501296_023861 3300049519 Unclassified 795
245 Ga0501031_0768135 3300049568 Unclassified 618
246 Ga0501033_0009428 3300049570 Bacteria 7515
247 Ga0501034_0091114 3300049571 Bacteria 3047
248 Ga0501036_0064050 3300049572 Bacteria 3112
249 Ga0501073_0094897 3300049589 Bacteria 2072
250 Ga0501259_033797 3300049688 Bacteria 978
251 Ga0501221_092380 3300049704 Bacteria 742
252 Ga0501245_023806 3300049708 Bacteria 975
253 Ga0501080_0077034 3300049742 Bacteria 3101
254 Ga0501035_0047178 3300049822 Bacteria 3869
255 Ga0501044_0090633 3300049823 Bacteria 3084
256 nmdc:mga08y16_534957_c1 3300050511 Bacteria 1187
257 nmdc:mga0n895_969638_c1 3300050512 Bacteria 833
258 nmdc:mga0rr50_118577_c1 3300050513 Bacteria 2103
259 Ga0500637_0152599 3300053178 Bacteria 1334

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005330 Ga0070690_100053898 Ga0070690_1000538984 178
2 3300005333 Ga0070677_10024607 Ga0070677_100246071 178
3 3300005338 Ga0068868_100517803 Ga0068868_1005178031 178
4 3300005339 Ga0070660_101197156 Ga0070660_1011971561 178
5 3300005353 Ga0070669_100000563 Ga0070669_1000005639 178
6 3300005354 Ga0070675_100024039 Ga0070675_1000240391 178
7 3300005356 Ga0070674_101054238 Ga0070674_1010542381 178
8 3300005364 Ga0070673_100010545 Ga0070673_1000105451 178
9 3300005366 Ga0070659_100455645 Ga0070659_1004556451 178
10 3300005367 Ga0070667_100126217 Ga0070667_1001262174 178
11 3300005543 Ga0070672_100245987 Ga0070672_1002459871 178
12 3300005548 Ga0070665_100956009 Ga0070665_1009560091 178
13 3300005617 Ga0068859_100003333 Ga0068859_1000033339 178
14 3300005840 Ga0068870_10012596 Ga0068870_100125964 178
15 3300006931 Ga0097620_100003333 Ga0097620_1000033337 178
16 3300009094 Ga0111539_10578804 Ga0111539_105788041 178
17 3300009177 Ga0105248_10217539 Ga0105248_102175392 178
18 3300014745 Ga0157377_10038555 Ga0157377_100385554 178
19 3300025908 Ga0207643_10015114 Ga0207643_100151143 178
20 3300025908 Ga0207643_10520275 Ga0207643_105202751 178
21 3300025918 Ga0207662_10311039 Ga0207662_103110392 178
22 3300025926 Ga0207659_10060953 Ga0207659_100609531 178
23 3300025932 Ga0207690_10403555 Ga0207690_104035552 178
24 3300025936 Ga0207670_10746818 Ga0207670_107468181 178
25 3300025940 Ga0207691_10017308 Ga0207691_100173081 178
26 3300025945 Ga0207679_10148217 Ga0207679_101482174 178
27 3300026023 Ga0207677_10665646 Ga0207677_106656461 178
28 3300028379 Ga0268266_10320384 Ga0268266_103203843 178
29 3300031824 Ga0307413_10313844 Ga0307413_103138442 178
30 3300032126 Ga0307415_100180466 Ga0307415_1001804662 178
31 3300041997 Ga0439431_0127953 Ga0439431_0127953_128_664 178
32 3300042156 Ga0439446_0036643 Ga0439446_0036643_722_1258 178
33 3300050511 nmdc:mga08y16_534957_c1 nmdc:mga08y16_534957_c1_145_681 178
34 3300005330 Ga0070690_100000216 Ga0070690_1000002163 179
35 3300005334 Ga0068869_100009821 Ga0068869_1000098213 179
36 3300005336 Ga0070680_100024170 Ga0070680_1000241701 179
37 3300005337 Ga0070682_100004786 Ga0070682_1000047867 179
38 3300005338 Ga0068868_100004312 Ga0068868_1000043123 179
39 3300005340 Ga0070689_100006563 Ga0070689_1000065635 179
40 3300005341 Ga0070691_10000528 Ga0070691_1000052812 179
41 3300005343 Ga0070687_100000604 Ga0070687_10000060410 179
42 3300005345 Ga0070692_10013366 Ga0070692_100133663 179
43 3300005353 Ga0070669_100271123 Ga0070669_1002711233 179
44 3300005353 Ga0070669_100272830 Ga0070669_1002728301 179
45 3300005353 Ga0070669_100699089 Ga0070669_1006990891 179
46 3300005355 Ga0070671_100093567 Ga0070671_1000935672 179
47 3300005356 Ga0070674_100265253 Ga0070674_1002652533 179
48 3300005364 Ga0070673_100046021 Ga0070673_1000460213 179
49 3300005365 Ga0070688_100187771 Ga0070688_1001877713 179
50 3300005366 Ga0070659_100422632 Ga0070659_1004226322 179
51 3300005438 Ga0070701_10002596 Ga0070701_100025964 179
52 3300005440 Ga0070705_100000554 Ga0070705_10000055413 179
53 3300005441 Ga0070700_100000281 Ga0070700_1000002818 179
54 3300005444 Ga0070694_100000565 Ga0070694_10000056512 179
55 3300005456 Ga0070678_100090063 Ga0070678_1000900633 179
56 3300005457 Ga0070662_101221934 Ga0070662_1012219341 179
57 3300005459 Ga0068867_100000206 Ga0068867_1000002064 179
58 3300005459 Ga0068867_100559146 Ga0068867_1005591462 179
59 3300005530 Ga0070679_100034844 Ga0070679_1000348443 179
60 3300005530 Ga0070679_100158856 Ga0070679_1001588562 179
61 3300005539 Ga0068853_100359448 Ga0068853_1003594482 179
62 3300005544 Ga0070686_100000711 Ga0070686_10000071112 179
63 3300005545 Ga0070695_100000281 Ga0070695_1000002818 179
64 3300005546 Ga0070696_100004140 Ga0070696_1000041404 179
65 3300005547 Ga0070693_100000162 Ga0070693_10000016222 179
66 3300005549 Ga0070704_100010913 Ga0070704_1000109136 179
67 3300005578 Ga0068854_100004064 Ga0068854_1000040644 179
68 3300005614 Ga0068856_100040331 Ga0068856_1000403315 179
69 3300005615 Ga0070702_100000093 Ga0070702_10000009322 179
70 3300005616 Ga0068852_100064759 Ga0068852_1000647593 179
71 3300005617 Ga0068859_100003739 Ga0068859_1000037399 179
72 3300005617 Ga0068859_100839597 Ga0068859_1008395972 179
73 3300005718 Ga0068866_10000256 Ga0068866_1000025611 179
74 3300005719 Ga0068861_100000355 Ga0068861_1000003557 179
75 3300005840 Ga0068870_10079855 Ga0068870_100798552 179
76 3300005842 Ga0068858_100026157 Ga0068858_1000261574 179
77 3300005842 Ga0068858_101504243 Ga0068858_1015042431 179
78 3300005843 Ga0068860_100002594 Ga0068860_10000259413 179
79 3300005844 Ga0068862_100000381 Ga0068862_10000038112 179
80 3300006237 Ga0097621_100000303 Ga0097621_1000003039 179
81 3300006358 Ga0068871_100006128 Ga0068871_10000612810 179
82 3300006871 Ga0075434_100283608 Ga0075434_1002836082 179
83 3300006881 Ga0068865_100034139 Ga0068865_1000341395 179
84 3300006931 Ga0097620_100003738 Ga0097620_1000037389 179
85 3300006931 Ga0097620_100839396 Ga0097620_1008393962 179
86 3300007076 Ga0075435_100074900 Ga0075435_1000749003 179
87 3300009092 Ga0105250_10062567 Ga0105250_100625672 179
88 3300009098 Ga0105245_10002702 Ga0105245_1000270211 179
89 3300009148 Ga0105243_10000631 Ga0105243_1000063113 179
90 3300009174 Ga0105241_10033493 Ga0105241_100334934 179
91 3300009176 Ga0105242_10003476 Ga0105242_1000347610 179
92 3300009177 Ga0105248_10216328 Ga0105248_102163283 179
93 3300009553 Ga0105249_10003937 Ga0105249_1000393710 179
94 3300009553 Ga0105249_10336171 Ga0105249_103361712 179
95 3300010375 Ga0105239_10052100 Ga0105239_100521004 179
96 3300013297 Ga0157378_10005443 Ga0157378_100054431 179
97 3300014745 Ga0157377_10376220 Ga0157377_103762202 179
98 3300014968 Ga0157379_10103658 Ga0157379_101036582 179
99 3300025899 Ga0207642_10000588 Ga0207642_1000058812 179
100 3300025904 Ga0207647_10101566 Ga0207647_101015662 179
101 3300025908 Ga0207643_10210341 Ga0207643_102103411 179
102 3300025911 Ga0207654_10537955 Ga0207654_105379552 179
103 3300025917 Ga0207660_10003314 Ga0207660_100033144 179
104 3300025918 Ga0207662_10000257 Ga0207662_100002577 179
105 3300025921 Ga0207652_10038255 Ga0207652_100382551 179
106 3300025921 Ga0207652_10109000 Ga0207652_101090003 179
107 3300025923 Ga0207681_10600520 Ga0207681_106005202 179
108 3300025927 Ga0207687_10002535 Ga0207687_100025355 179
109 3300025931 Ga0207644_10044538 Ga0207644_100445382 179
110 3300025934 Ga0207686_10007586 Ga0207686_100075862 179
111 3300025935 Ga0207709_10061611 Ga0207709_100616111 179
112 3300025936 Ga0207670_10002665 Ga0207670_100026659 179
113 3300025938 Ga0207704_10000798 Ga0207704_1000079810 179
114 3300025941 Ga0207711_10175298 Ga0207711_101752982 179
115 3300025942 Ga0207689_10001220 Ga0207689_1000122021 179
116 3300025960 Ga0207651_10419302 Ga0207651_104193021 179
117 3300025961 Ga0207712_10013923 Ga0207712_100139237 179
118 3300026023 Ga0207677_10011010 Ga0207677_100110104 179
119 3300026035 Ga0207703_10010158 Ga0207703_100101582 179
120 3300026041 Ga0207639_10097816 Ga0207639_100978162 179
121 3300026075 Ga0207708_10008364 Ga0207708_100083645 179
122 3300026078 Ga0207702_10048596 Ga0207702_100485963 179
123 3300026089 Ga0207648_10001304 Ga0207648_1000130421 179
124 3300026095 Ga0207676_10121947 Ga0207676_101219473 179
125 3300026118 Ga0207675_100000900 Ga0207675_10000090021 179
126 3300026121 Ga0207683_10278214 Ga0207683_102782143 179
127 3300026142 Ga0207698_10051196 Ga0207698_100511963 179
128 3300028380 Ga0268265_10012740 Ga0268265_100127401 179
129 3300028381 Ga0268264_10023040 Ga0268264_100230404 179
130 3300032002 Ga0307416_100218970 Ga0307416_1002189702 179
131 3300035089 Ga0373944_0079884 Ga0373944_0079884_224_763 179
132 3300035112 Ga0373932_0070652 Ga0373932_0070652_161_700 179
133 3300035114 Ga0373939_0035533 Ga0373939_0035533_270_809 179
134 3300035116 Ga0373945_0173615 Ga0373945_0173615_252_803 179
135 3300035170 Ga0373943_0077798 Ga0373943_0077798_192_743 179
136 3300035171 Ga0373946_0026079 Ga0373946_0026079_1660_2199 179
137 3300035241 Ga0373961_0043995 Ga0373961_0043995_270_809 179
138 3300035410 Ga0373924_0032884 Ga0373924_0032884_1017_1556 179
139 3300035691 Ga0373931_0028143 Ga0373931_0028143_632_1171 179
140 3300035691 Ga0373931_0693776 Ga0373931_0693776_115_654 179
141 3300035695 Ga0373927_0236043 Ga0373927_0236043_199_750 179
142 3300035725 Ga0373947_0132519 Ga0373947_0132519_288_839 179
143 3300039437 Ga0436365_0987495 Ga0436365_0987495_787_1326 179
144 3300045051 Ga0451576_0007143 Ga0451576_0007143_4561_5100 179
145 3300046473 Ga0495582_0121717 Ga0495582_0121717_839_1390 179
146 3300046475 Ga0495639_0062048 Ga0495639_0062048_421_972 179
147 3300046499 Ga0495594_0093213 Ga0495594_0093213_1005_1556 179
148 3300046517 Ga0495630_0015200 Ga0495630_0015200_4843_5394 179
149 3300046533 Ga0495640_0278591 Ga0495640_0278591_355_906 179
150 3300046535 Ga0495586_0003196 Ga0495586_0003196_742_1293 179
151 3300046663 Ga0495635_0053198 Ga0495635_0053198_660_1211 179
152 3300046683 Ga0495658_0026196 Ga0495658_0026196_1424_1975 179
153 3300047315 Ga0495581_0008987 Ga0495581_0008987_1712_2263 179
154 3300047319 Ga0495674_0120559 Ga0495674_0120559_523_1074 179
155 3300047673 Ga0495593_0056081 Ga0495593_0056081_679_1230 179
156 3300048911 Ga0496108_1117411 Ga0496108_1117411_65_607 179
157 3300048915 Ga0496112_0265147 Ga0496112_0265147_1061_1603 179
158 3300049568 Ga0501031_0768135 Ga0501031_0768135_30_569 179
159 3300049742 Ga0501080_0077034 Ga0501080_0077034_93_632 179
160 3300050512 nmdc:mga0n895_969638_c1 nmdc:mga0n895_969638_c1_215_757 179
161 3300050513 nmdc:mga0rr50_118577_c1 nmdc:mga0rr50_118577_c1_617_1159 179
162 3300009147 Ga0114129_11975015 Ga0114129_119750151 180
163 3300013104 Ga0157370_10000364 Ga0157370_1000036429 180
164 3300025944 Ga0207661_10014694 Ga0207661_100146942 180
165 3300031727 Ga0316576_10219970 Ga0316576_102199702 180
166 3300031852 Ga0307410_10261789 Ga0307410_102617891 180
167 3300031903 Ga0307407_10085951 Ga0307407_100859513 180
168 3300031995 Ga0307409_100239175 Ga0307409_1002391752 180
169 3300035692 Ga0373935_0011763 Ga0373935_0011763_3391_3939 180
170 3300035695 Ga0373927_0014275 Ga0373927_0014275_1518_2066 180
171 3300037068 Ga0373925_0038054 Ga0373925_0038054_2293_2835 180
172 3300042461 Ga0439460_0026238 Ga0439460_0026238_736_1281 180
173 3300044693 Ga0466961_0055606 Ga0466961_0055606_440_982 180
174 3300045049 Ga0466959_0700525 Ga0466959_0700525_11_553 180
175 3300049519 Ga0501296_023861 Ga0501296_023861_106_648 180
176 3300049570 Ga0501033_0009428 Ga0501033_0009428_5186_5728 180
177 3300049571 Ga0501034_0091114 Ga0501034_0091114_1299_1841 180
178 3300049572 Ga0501036_0064050 Ga0501036_0064050_566_1108 180
179 3300049822 Ga0501035_0047178 Ga0501035_0047178_719_1261 180
180 3300049823 Ga0501044_0090633 Ga0501044_0090633_1194_1736 180
181 3300053178 Ga0500637_0152599 Ga0500637_0152599_358_900 180
182 3300005329 Ga0070683_100016571 Ga0070683_1000165712 181
183 3300005367 Ga0070667_100299505 Ga0070667_1002995052 181
184 3300005564 Ga0070664_100878502 Ga0070664_1008785022 181
185 3300009551 Ga0105238_10456525 Ga0105238_104565252 181
186 3300025924 Ga0207694_10889864 Ga0207694_108898641 181
187 3300025937 Ga0207669_10832738 Ga0207669_108327382 181
188 3300025986 Ga0207658_10134997 Ga0207658_101349972 181
189 3300026116 Ga0207674_10060494 Ga0207674_100604942 181
190 3300031548 Ga0307408_100627841 Ga0307408_1006278411 181
191 3300032002 Ga0307416_100123644 Ga0307416_1001236443 181
192 3300032126 Ga0307415_100103135 Ga0307415_1001031354 181
193 3300039437 Ga0436365_1691578 Ga0436365_1691578_194_739 181
194 3300046664 Ga0495659_0115699 Ga0495659_0115699_57_602 181
195 3300047320 Ga0495672_0007958 Ga0495672_0007958_7098_7643 181
196 3300049589 Ga0501073_0094897 Ga0501073_0094897_347_892 181
197 3300049688 Ga0501259_033797 Ga0501259_033797_21_566 181
198 3300049708 Ga0501245_023806 Ga0501245_023806_83_628 181
199 3300005329 Ga0070683_100008989 Ga0070683_1000089898 182
200 3300005329 Ga0070683_100544908 Ga0070683_1005449082 182
201 3300005336 Ga0070680_100000469 Ga0070680_10000046918 182
202 3300005458 Ga0070681_10000319 Ga0070681_100003193 182
203 3300005530 Ga0070679_100066916 Ga0070679_1000669163 182
204 3300005530 Ga0070679_100101925 Ga0070679_1001019255 182
205 3300005535 Ga0070684_100014361 Ga0070684_1000143613 182
206 3300009093 Ga0105240_10363216 Ga0105240_103632162 182
207 3300009545 Ga0105237_10078678 Ga0105237_100786783 182
208 3300013104 Ga0157370_10266672 Ga0157370_102666722 182
209 3300013104 Ga0157370_10268639 Ga0157370_102686392 182
210 3300013105 Ga0157369_10055717 Ga0157369_100557172 182
211 3300013307 Ga0157372_10005471 Ga0157372_100054713 182
212 3300025912 Ga0207707_10001048 Ga0207707_1000104818 182
213 3300025913 Ga0207695_10006196 Ga0207695_100061966 182
214 3300025917 Ga0207660_10004653 Ga0207660_100046536 182
215 3300025921 Ga0207652_10006262 Ga0207652_100062628 182
216 3300025921 Ga0207652_10108589 Ga0207652_101085892 182
217 3300025944 Ga0207661_10140558 Ga0207661_101405582 182
218 3300025944 Ga0207661_10525688 Ga0207661_105256883 182
219 3300025949 Ga0207667_10086720 Ga0207667_100867203 182
220 3300025949 Ga0207667_10397505 Ga0207667_103975052 182
221 3300026078 Ga0207702_10389129 Ga0207702_103891292 182
222 3300026116 Ga0207674_10461024 Ga0207674_104610241 182
223 3300030760 Ga0265762_1037871 Ga0265762_10378711 182
224 3300031548 Ga0307408_100407755 Ga0307408_1004077552 182
225 3300031731 Ga0307405_10895198 Ga0307405_108951981 182
226 3300031824 Ga0307413_10000154 Ga0307413_100001549 182
227 3300031852 Ga0307410_10003342 Ga0307410_100033426 182
228 3300031901 Ga0307406_10004953 Ga0307406_100049532 182
229 3300031903 Ga0307407_10002140 Ga0307407_100021406 182
230 3300031911 Ga0307412_10060429 Ga0307412_100604293 182
231 3300032002 Ga0307416_100001413 Ga0307416_1000014137 182
232 3300032004 Ga0307414_10004651 Ga0307414_100046514 182
233 3300032005 Ga0307411_10003999 Ga0307411_100039996 182
234 3300032126 Ga0307415_100005170 Ga0307415_1000051706 182
235 3300046678 Ga0495599_0019845 Ga0495599_0019845_485_1033 182
236 3300049704 Ga0501221_092380 Ga0501221_092380_165_713 182
237 3300005327 Ga0070658_10419138 Ga0070658_104191382 183
238 3300005329 Ga0070683_100286122 Ga0070683_1002861221 183
239 3300005336 Ga0070680_100365210 Ga0070680_1003652103 183
240 3300005530 Ga0070679_100198875 Ga0070679_1001988753 183
241 3300005535 Ga0070684_101162704 Ga0070684_1011627041 183
242 3300021384 Ga0213876_10109359 Ga0213876_101093592 183
243 3300025917 Ga0207660_10132786 Ga0207660_101327863 183
244 3300025918 Ga0207662_10766376 Ga0207662_107663761 183
245 3300025921 Ga0207652_10374417 Ga0207652_103744171 183
246 3300031901 Ga0307406_10586690 Ga0307406_105866902 183
247 3300037418 Ga0395900_0043098 Ga0395900_0043098_2185_2742 183
248 3300037471 Ga0395905_0034926 Ga0395905_0034926_1964_2521 183
249 3300038443 Ga0395901_0002411 Ga0395901_0002411_3904_4461 183
250 3300039437 Ga0436365_0082756 Ga0436365_0082756_152_706 183
251 3300039437 Ga0436365_0960080 Ga0436365_0960080_688_1242 183
252 3300039437 Ga0436365_1610390 Ga0436365_1610390_507_1061 183
253 3300042435 Ga0439434_0234197 Ga0439434_0234197_16_567 183
254 3300045976 Ga0466967_1263028 Ga0466967_1263028_42_599 183
255 3300046477 Ga0495664_0101582 Ga0495664_0101582_585_1136 183
256 3300046499 Ga0495594_0005168 Ga0495594_0005168_4444_5007 183
257 3300046499 Ga0495594_0205185 Ga0495594_0205185_30_581 183
258 3300046535 Ga0495586_0004551 Ga0495586_0004551_1064_1615 183
259 3300047319 Ga0495674_0105439 Ga0495674_0105439_23_574 183

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07152

YaeQ

YaeQ protein

27

199

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ot9-assembly1.cif.gz_A crystal structure of yaeq protein from pseudomonas syringae 0.8883 2 173
7tcb-assembly3.cif.gz_C crystal structure of the yaeq family protein vpa0551 from vibrio parahaemolyticus 0.8747 4 182
3c0u-assembly2.cif.gz_A crystal structure of e.coli yaeq protein 0.8734 1 175
3c0u-assembly3.cif.gz_B crystal structure of e.coli yaeq protein 0.8717 1 175
7tcb-assembly3.cif.gz_C crystal structure of the yaeq family protein vpa0551 from vibrio parahaemolyticus 0.8699 4 182
ID Description Score Start End Superfamily
2g3wB00 Alpha Beta;Roll;Restriction endonuclease-like alpha-beta roll fold;Restriction endonuclease-like alpha-beta roll domain 0.8899 4 174 3.10.640.10
2ot9A01 Alpha Beta;Roll;Restriction endonuclease-like alpha-beta roll fold;Restriction endonuclease-like alpha-beta roll domain 0.8765 2 173 3.10.640.10
3c0uA00 Alpha Beta;Roll;Restriction endonuclease-like alpha-beta roll fold;Restriction endonuclease-like alpha-beta roll domain 0.8675 1 175 3.10.640.10
2g3wB00 Alpha Beta;Roll;Restriction endonuclease-like alpha-beta roll fold;Restriction endonuclease-like alpha-beta roll domain 0.8657 4 174 3.10.640.10
2ot9A01 Alpha Beta;Roll;Restriction endonuclease-like alpha-beta roll fold;Restriction endonuclease-like alpha-beta roll domain 0.848 2 173 3.10.640.10
ID Description Score Start End GO Terms
AF-A0A7R7Y422-F1-model_v4 deleted 0.9823 1 179
AF-A0A4P5XDV1-F1-model_v4 deleted 0.9727 7 180
AF-A0A0D0I0H2-F1-model_v4 YaeQ family protein 0.9717 1 179
AF-A0A7R7Y422-F1-model_v4 deleted 0.9715 1 179
AF-A0A7Y5Q0G9-F1-model_v4 YaeQ family protein 0.9706 5 180

Feature Viewer

pLDDT pTM Quality
90.67 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map