F368811
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 259 | 192 | 259 | 181 |
Family's Representative Sequence
| Representative Sequence | 3300013104|Ga0157370_10268639|Ga0157370_102686392 |
| Length | 208 |
| Sequence | LRLAITPLAHVSHAYVCNHRTSPSVLVALTATVYNFDVQLSDVDRGVYESLSIRAARHPSETEEYLATRVLAYCLEYTDGITFSKGLSEPDEPALVVRDLTGALKSWIEVGSPTADRLHKASKAAPRVVVYTYRDPAQLVRQLASERIHRAHEIEIYGISRPLIDELVARLDRRTTLDLAVTERHLYVTIAGQTFEGVVQPERLAGQD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 3 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 4 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 6 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 7 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 9 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 30 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 33 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 42 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 43 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 45 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 46 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 47 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 48 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 49 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 50 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 51 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 52 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 54 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 55 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 56 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 58 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 78 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 122 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 123 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 124 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 125 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 126 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 127 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 128 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 129 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 130 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 131 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 132 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 133 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 134 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 135 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 136 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 137 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 138 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 139 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 140 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 141 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 142 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 143 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 144 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 145 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 146 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 147 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 148 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 149 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 150 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 151 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 152 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 153 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 154 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 155 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 156 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 157 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 158 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 159 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 160 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 176 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 177 | 3300049519 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought | Metagenome | Rhizosphere |
| 178 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 179 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 180 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 181 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 182 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 183 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 184 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 185 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 186 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 187 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 188 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 189 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 190 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 191 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 192 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.61 |
| Metatranscriptomes | 0.39 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.39 |
| Nodule | 0 |
| Rhizoplane | 0.77 |
| Rhizosphere | 96.53 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.32 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070658_10419138 | 3300005327 | Unclassified | 1151 |
| 2 | Ga0070683_100008989 | 3300005329 | Bacteria | 8517 |
| 3 | Ga0070683_100016571 | 3300005329 | Bacteria | 6502 |
| 4 | Ga0070683_100286122 | 3300005329 | Bacteria | 1568 |
| 5 | Ga0070683_100544908 | 3300005329 | Bacteria | 1109 |
| 6 | Ga0070690_100000216 | 3300005330 | Bacteria | 30017 |
| 7 | Ga0070690_100053898 | 3300005330 | Bacteria | 2574 |
| 8 | Ga0070677_10024607 | 3300005333 | Bacteria | 2240 |
| 9 | Ga0068869_100009821 | 3300005334 | Bacteria | 6216 |
| 10 | Ga0070680_100000469 | 3300005336 | Bacteria | 27578 |
| 11 | Ga0070680_100024170 | 3300005336 | Bacteria | 4849 |
| 12 | Ga0070680_100365210 | 3300005336 | Bacteria | 1228 |
| 13 | Ga0070682_100004786 | 3300005337 | Bacteria | 7521 |
| 14 | Ga0068868_100004312 | 3300005338 | Bacteria | 9964 |
| 15 | Ga0068868_100517803 | 3300005338 | Bacteria | 1047 |
| 16 | Ga0070660_101197156 | 3300005339 | Bacteria | 644 |
| 17 | Ga0070689_100006563 | 3300005340 | Bacteria | 8068 |
| 18 | Ga0070691_10000528 | 3300005341 | Bacteria | 14397 |
| 19 | Ga0070687_100000604 | 3300005343 | Bacteria | 11929 |
| 20 | Ga0070692_10013366 | 3300005345 | Bacteria | 3824 |
| 21 | Ga0070669_100000563 | 3300005353 | Bacteria | 27598 |
| 22 | Ga0070669_100271123 | 3300005353 | Bacteria | 1357 |
| 23 | Ga0070669_100272830 | 3300005353 | Bacteria | 1353 |
| 24 | Ga0070669_100699089 | 3300005353 | Bacteria | 856 |
| 25 | Ga0070675_100024039 | 3300005354 | Bacteria | 4877 |
| 26 | Ga0070671_100093567 | 3300005355 | Unclassified | 2519 |
| 27 | Ga0070674_100265253 | 3300005356 | Unclassified | 1355 |
| 28 | Ga0070674_101054238 | 3300005356 | Bacteria | 716 |
| 29 | Ga0070673_100010545 | 3300005364 | Bacteria | 6259 |
| 30 | Ga0070673_100046021 | 3300005364 | Unclassified | 3387 |
| 31 | Ga0070688_100187771 | 3300005365 | Unclassified | 1438 |
| 32 | Ga0070659_100422632 | 3300005366 | Bacteria | 1127 |
| 33 | Ga0070659_100455645 | 3300005366 | Bacteria | 1086 |
| 34 | Ga0070667_100126217 | 3300005367 | Bacteria | 2230 |
| 35 | Ga0070667_100299505 | 3300005367 | Bacteria | 1448 |
| 36 | Ga0070701_10002596 | 3300005438 | Bacteria | 6998 |
| 37 | Ga0070705_100000554 | 3300005440 | Bacteria | 21689 |
| 38 | Ga0070700_100000281 | 3300005441 | Bacteria | 27271 |
| 39 | Ga0070694_100000565 | 3300005444 | Bacteria | 20475 |
| 40 | Ga0070678_100090063 | 3300005456 | Unclassified | 2350 |
| 41 | Ga0070662_101221934 | 3300005457 | Bacteria | 646 |
| 42 | Ga0070681_10000319 | 3300005458 | Bacteria | 39102 |
| 43 | Ga0068867_100000206 | 3300005459 | Bacteria | 39309 |
| 44 | Ga0068867_100559146 | 3300005459 | Bacteria | 992 |
| 45 | Ga0070679_100034844 | 3300005530 | Bacteria | 4992 |
| 46 | Ga0070679_100066916 | 3300005530 | Bacteria | 3582 |
| 47 | Ga0070679_100101925 | 3300005530 | Unclassified | 2857 |
| 48 | Ga0070679_100158856 | 3300005530 | Bacteria | 2235 |
| 49 | Ga0070679_100198875 | 3300005530 | Bacteria | 1971 |
| 50 | Ga0070684_100014361 | 3300005535 | Bacteria | 6412 |
| 51 | Ga0070684_101162704 | 3300005535 | Bacteria | 726 |
| 52 | Ga0068853_100359448 | 3300005539 | Bacteria | 1356 |
| 53 | Ga0070672_100245987 | 3300005543 | Bacteria | 1505 |
| 54 | Ga0070686_100000711 | 3300005544 | Bacteria | 19359 |
| 55 | Ga0070695_100000281 | 3300005545 | Bacteria | 25630 |
| 56 | Ga0070696_100004140 | 3300005546 | Bacteria | 9667 |
| 57 | Ga0070693_100000162 | 3300005547 | Bacteria | 30827 |
| 58 | Ga0070665_100956009 | 3300005548 | Bacteria | 869 |
| 59 | Ga0070704_100010913 | 3300005549 | Bacteria | 5540 |
| 60 | Ga0070664_100878502 | 3300005564 | Bacteria | 840 |
| 61 | Ga0068854_100004064 | 3300005578 | Bacteria | 9188 |
| 62 | Ga0068856_100040331 | 3300005614 | Bacteria | 4585 |
| 63 | Ga0070702_100000093 | 3300005615 | Bacteria | 26493 |
| 64 | Ga0068852_100064759 | 3300005616 | Bacteria | 3187 |
| 65 | Ga0068859_100003333 | 3300005617 | Bacteria | 16329 |
| 66 | Ga0068859_100003739 | 3300005617 | Bacteria | 15512 |
| 67 | Ga0068859_100839597 | 3300005617 | Bacteria | 1005 |
| 68 | Ga0068866_10000256 | 3300005718 | Bacteria | 24958 |
| 69 | Ga0068861_100000355 | 3300005719 | Bacteria | 26109 |
| 70 | Ga0068870_10012596 | 3300005840 | Bacteria | 3955 |
| 71 | Ga0068870_10079855 | 3300005840 | Bacteria | 1806 |
| 72 | Ga0068858_100026157 | 3300005842 | Bacteria | 5425 |
| 73 | Ga0068858_101504243 | 3300005842 | Bacteria | 664 |
| 74 | Ga0068860_100002594 | 3300005843 | Bacteria | 18905 |
| 75 | Ga0068862_100000381 | 3300005844 | Bacteria | 47919 |
| 76 | Ga0097621_100000303 | 3300006237 | Bacteria | 33347 |
| 77 | Ga0068871_100006128 | 3300006358 | Bacteria | 8473 |
| 78 | Ga0075434_100283608 | 3300006871 | Bacteria | 1676 |
| 79 | Ga0068865_100034139 | 3300006881 | Bacteria | 3411 |
| 80 | Ga0097620_100003333 | 3300006931 | Bacteria | 16329 |
| 81 | Ga0097620_100003738 | 3300006931 | Bacteria | 15512 |
| 82 | Ga0097620_100839396 | 3300006931 | Bacteria | 1005 |
| 83 | Ga0075435_100074900 | 3300007076 | Bacteria | 2770 |
| 84 | Ga0105250_10062567 | 3300009092 | Bacteria | 1498 |
| 85 | Ga0105240_10363216 | 3300009093 | Unclassified | 1639 |
| 86 | Ga0111539_10578804 | 3300009094 | Bacteria | 1308 |
| 87 | Ga0105245_10002702 | 3300009098 | Bacteria | 15962 |
| 88 | Ga0114129_11975015 | 3300009147 | Bacteria | 706 |
| 89 | Ga0105243_10000631 | 3300009148 | Bacteria | 34959 |
| 90 | Ga0105241_10033493 | 3300009174 | Bacteria | 3857 |
| 91 | Ga0105242_10003476 | 3300009176 | Bacteria | 12246 |
| 92 | Ga0105248_10216328 | 3300009177 | Bacteria | 2158 |
| 93 | Ga0105248_10217539 | 3300009177 | Bacteria | 2151 |
| 94 | Ga0105237_10078678 | 3300009545 | Bacteria | 3287 |
| 95 | Ga0105238_10456525 | 3300009551 | Unclassified | 1275 |
| 96 | Ga0105249_10003937 | 3300009553 | Bacteria | 12818 |
| 97 | Ga0105249_10336171 | 3300009553 | Bacteria | 1526 |
| 98 | Ga0105239_10052100 | 3300010375 | Bacteria | 4487 |
| 99 | Ga0157370_10000364 | 3300013104 | Bacteria | 57195 |
| 100 | Ga0157370_10266672 | 3300013104 | Unclassified | 1582 |
| 101 | Ga0157370_10268639 | 3300013104 | Unclassified | 1576 |
| 102 | Ga0157369_10055717 | 3300013105 | Bacteria | 4267 |
| 103 | Ga0157378_10005443 | 3300013297 | Bacteria | 11158 |
| 104 | Ga0157372_10005471 | 3300013307 | Bacteria | 13496 |
| 105 | Ga0157377_10038555 | 3300014745 | Bacteria | 2639 |
| 106 | Ga0157377_10376220 | 3300014745 | Bacteria | 960 |
| 107 | Ga0157379_10103658 | 3300014968 | Bacteria | 2553 |
| 108 | Ga0213876_10109359 | 3300021384 | Bacteria | 1467 |
| 109 | Ga0207642_10000588 | 3300025899 | Bacteria | 11204 |
| 110 | Ga0207647_10101566 | 3300025904 | Bacteria | 1706 |
| 111 | Ga0207643_10015114 | 3300025908 | Bacteria | 4199 |
| 112 | Ga0207643_10210341 | 3300025908 | Bacteria | 1187 |
| 113 | Ga0207643_10520275 | 3300025908 | Bacteria | 762 |
| 114 | Ga0207654_10537955 | 3300025911 | Unclassified | 829 |
| 115 | Ga0207707_10001048 | 3300025912 | Bacteria | 26537 |
| 116 | Ga0207695_10006196 | 3300025913 | Bacteria | 15589 |
| 117 | Ga0207660_10003314 | 3300025917 | Bacteria | 10518 |
| 118 | Ga0207660_10004653 | 3300025917 | Bacteria | 8942 |
| 119 | Ga0207660_10132786 | 3300025917 | Bacteria | 1897 |
| 120 | Ga0207662_10000257 | 3300025918 | Bacteria | 24677 |
| 121 | Ga0207662_10311039 | 3300025918 | Bacteria | 1049 |
| 122 | Ga0207662_10766376 | 3300025918 | Bacteria | 679 |
| 123 | Ga0207652_10006262 | 3300025921 | Bacteria | 9603 |
| 124 | Ga0207652_10038255 | 3300025921 | Bacteria | 4065 |
| 125 | Ga0207652_10108589 | 3300025921 | Bacteria | 2459 |
| 126 | Ga0207652_10109000 | 3300025921 | Bacteria | 2454 |
| 127 | Ga0207652_10374417 | 3300025921 | Bacteria | 1285 |
| 128 | Ga0207681_10600520 | 3300025923 | Bacteria | 909 |
| 129 | Ga0207694_10889864 | 3300025924 | Bacteria | 753 |
| 130 | Ga0207659_10060953 | 3300025926 | Bacteria | 2717 |
| 131 | Ga0207687_10002535 | 3300025927 | Bacteria | 12403 |
| 132 | Ga0207644_10044538 | 3300025931 | Bacteria | 3153 |
| 133 | Ga0207690_10403555 | 3300025932 | Bacteria | 1090 |
| 134 | Ga0207686_10007586 | 3300025934 | Bacteria | 5843 |
| 135 | Ga0207709_10061611 | 3300025935 | Unclassified | 2345 |
| 136 | Ga0207670_10002665 | 3300025936 | Bacteria | 9390 |
| 137 | Ga0207670_10746818 | 3300025936 | Bacteria | 812 |
| 138 | Ga0207669_10832738 | 3300025937 | Bacteria | 767 |
| 139 | Ga0207704_10000798 | 3300025938 | Bacteria | 13929 |
| 140 | Ga0207691_10017308 | 3300025940 | Bacteria | 6836 |
| 141 | Ga0207711_10175298 | 3300025941 | Bacteria | 1948 |
| 142 | Ga0207689_10001220 | 3300025942 | Bacteria | 24704 |
| 143 | Ga0207661_10014694 | 3300025944 | Bacteria | 5744 |
| 144 | Ga0207661_10140558 | 3300025944 | Bacteria | 2077 |
| 145 | Ga0207661_10525688 | 3300025944 | Unclassified | 1082 |
| 146 | Ga0207679_10148217 | 3300025945 | Bacteria | 1906 |
| 147 | Ga0207667_10086720 | 3300025949 | Unclassified | 3239 |
| 148 | Ga0207667_10397505 | 3300025949 | Unclassified | 1403 |
| 149 | Ga0207651_10419302 | 3300025960 | Bacteria | 1142 |
| 150 | Ga0207712_10013923 | 3300025961 | Bacteria | 5159 |
| 151 | Ga0207658_10134997 | 3300025986 | Bacteria | 1988 |
| 152 | Ga0207677_10011010 | 3300026023 | Bacteria | 5138 |
| 153 | Ga0207677_10665646 | 3300026023 | Bacteria | 920 |
| 154 | Ga0207703_10010158 | 3300026035 | Bacteria | 7380 |
| 155 | Ga0207639_10097816 | 3300026041 | Bacteria | 2364 |
| 156 | Ga0207708_10008364 | 3300026075 | Bacteria | 7659 |
| 157 | Ga0207702_10048596 | 3300026078 | Bacteria | 3578 |
| 158 | Ga0207702_10389129 | 3300026078 | Bacteria | 1342 |
| 159 | Ga0207648_10001304 | 3300026089 | Bacteria | 27765 |
| 160 | Ga0207676_10121947 | 3300026095 | Unclassified | 2200 |
| 161 | Ga0207674_10060494 | 3300026116 | Bacteria | 3829 |
| 162 | Ga0207674_10461024 | 3300026116 | Bacteria | 1228 |
| 163 | Ga0207675_100000900 | 3300026118 | Bacteria | 29714 |
| 164 | Ga0207683_10278214 | 3300026121 | Bacteria | 1529 |
| 165 | Ga0207698_10051196 | 3300026142 | Bacteria | 3156 |
| 166 | Ga0268266_10320384 | 3300028379 | Bacteria | 1451 |
| 167 | Ga0268265_10012740 | 3300028380 | Bacteria | 5707 |
| 168 | Ga0268264_10023040 | 3300028381 | Bacteria | 5081 |
| 169 | Ga0265762_1037871 | 3300030760 | Unclassified | 935 |
| 170 | Ga0307408_100407755 | 3300031548 | Bacteria | 1169 |
| 171 | Ga0307408_100627841 | 3300031548 | Bacteria | 958 |
| 172 | Ga0316576_10219970 | 3300031727 | Bacteria | 1429 |
| 173 | Ga0307405_10895198 | 3300031731 | Unclassified | 750 |
| 174 | Ga0307413_10000154 | 3300031824 | Bacteria | 18659 |
| 175 | Ga0307413_10313844 | 3300031824 | Unclassified | 1195 |
| 176 | Ga0307410_10003342 | 3300031852 | Bacteria | 8031 |
| 177 | Ga0307410_10261789 | 3300031852 | Bacteria | 1349 |
| 178 | Ga0307406_10004953 | 3300031901 | Bacteria | 7256 |
| 179 | Ga0307406_10586690 | 3300031901 | Bacteria | 917 |
| 180 | Ga0307407_10002140 | 3300031903 | Bacteria | 7598 |
| 181 | Ga0307407_10085951 | 3300031903 | Bacteria | 1915 |
| 182 | Ga0307412_10060429 | 3300031911 | Bacteria | 2543 |
| 183 | Ga0307409_100239175 | 3300031995 | Unclassified | 1652 |
| 184 | Ga0307416_100001413 | 3300032002 | Bacteria | 13018 |
| 185 | Ga0307416_100123644 | 3300032002 | Bacteria | 2313 |
| 186 | Ga0307416_100218970 | 3300032002 | Bacteria | 1824 |
| 187 | Ga0307414_10004651 | 3300032004 | Bacteria | 7474 |
| 188 | Ga0307411_10003999 | 3300032005 | Bacteria | 6966 |
| 189 | Ga0307415_100005170 | 3300032126 | Bacteria | 6888 |
| 190 | Ga0307415_100103135 | 3300032126 | Bacteria | 2098 |
| 191 | Ga0307415_100180466 | 3300032126 | Unclassified | 1656 |
| 192 | Ga0373944_0079884 | 3300035089 | Bacteria | 1078 |
| 193 | Ga0373932_0070652 | 3300035112 | Unclassified | 1082 |
| 194 | Ga0373939_0035533 | 3300035114 | Unclassified | 1469 |
| 195 | Ga0373945_0173615 | 3300035116 | Bacteria | 884 |
| 196 | Ga0373943_0077798 | 3300035170 | Bacteria | 1695 |
| 197 | Ga0373946_0026079 | 3300035171 | Bacteria | 2302 |
| 198 | Ga0373961_0043995 | 3300035241 | Bacteria | 1301 |
| 199 | Ga0373924_0032884 | 3300035410 | Bacteria | 2091 |
| 200 | Ga0373931_0028143 | 3300035691 | Bacteria | 2874 |
| 201 | Ga0373931_0693776 | 3300035691 | Bacteria | 672 |
| 202 | Ga0373935_0011763 | 3300035692 | Bacteria | 5257 |
| 203 | Ga0373927_0014275 | 3300035695 | Bacteria | 5264 |
| 204 | Ga0373927_0236043 | 3300035695 | Bacteria | 1201 |
| 205 | Ga0373947_0132519 | 3300035725 | Unclassified | 1592 |
| 206 | Ga0373925_0038054 | 3300037068 | Bacteria | 3554 |
| 207 | Ga0395900_0043098 | 3300037418 | Bacteria | 4650 |
| 208 | Ga0395905_0034926 | 3300037471 | Bacteria | 4720 |
| 209 | Ga0395901_0002411 | 3300038443 | Bacteria | 18976 |
| 210 | Ga0436365_0082756 | 3300039437 | Bacteria | 1411 |
| 211 | Ga0436365_0960080 | 3300039437 | Bacteria | 2162 |
| 212 | Ga0436365_0987495 | 3300039437 | Unclassified | 1485 |
| 213 | Ga0436365_1610390 | 3300039437 | Bacteria | 1430 |
| 214 | Ga0436365_1691578 | 3300039437 | Bacteria | 1071 |
| 215 | Ga0439431_0127953 | 3300041997 | Bacteria | 712 |
| 216 | Ga0439446_0036643 | 3300042156 | Unclassified | 1434 |
| 217 | Ga0439434_0234197 | 3300042435 | Bacteria | 625 |
| 218 | Ga0439460_0026238 | 3300042461 | Unclassified | 1628 |
| 219 | Ga0466961_0055606 | 3300044693 | Bacteria | 2523 |
| 220 | Ga0466959_0700525 | 3300045049 | Bacteria | 679 |
| 221 | Ga0451576_0007143 | 3300045051 | Bacteria | 13475 |
| 222 | Ga0466967_1263028 | 3300045976 | Unclassified | 736 |
| 223 | Ga0495582_0121717 | 3300046473 | Unclassified | 1470 |
| 224 | Ga0495639_0062048 | 3300046475 | Bacteria | 1714 |
| 225 | Ga0495664_0101582 | 3300046477 | Bacteria | 1733 |
| 226 | Ga0495594_0005168 | 3300046499 | Bacteria | 6710 |
| 227 | Ga0495594_0093213 | 3300046499 | Bacteria | 1689 |
| 228 | Ga0495594_0205185 | 3300046499 | Bacteria | 1123 |
| 229 | Ga0495630_0015200 | 3300046517 | Bacteria | 5616 |
| 230 | Ga0495640_0278591 | 3300046533 | Bacteria | 1042 |
| 231 | Ga0495586_0003196 | 3300046535 | Bacteria | 8810 |
| 232 | Ga0495586_0004551 | 3300046535 | Bacteria | 7410 |
| 233 | Ga0495635_0053198 | 3300046663 | Bacteria | 2790 |
| 234 | Ga0495659_0115699 | 3300046664 | Unclassified | 1051 |
| 235 | Ga0495599_0019845 | 3300046678 | Bacteria | 4186 |
| 236 | Ga0495658_0026196 | 3300046683 | Bacteria | 3123 |
| 237 | Ga0495581_0008987 | 3300047315 | Bacteria | 5782 |
| 238 | Ga0495674_0105439 | 3300047319 | Bacteria | 2395 |
| 239 | Ga0495674_0120559 | 3300047319 | Unclassified | 2216 |
| 240 | Ga0495672_0007958 | 3300047320 | Bacteria | 7903 |
| 241 | Ga0495593_0056081 | 3300047673 | Unclassified | 2072 |
| 242 | Ga0496108_1117411 | 3300048911 | Unclassified | 669 |
| 243 | Ga0496112_0265147 | 3300048915 | Unclassified | 1667 |
| 244 | Ga0501296_023861 | 3300049519 | Unclassified | 795 |
| 245 | Ga0501031_0768135 | 3300049568 | Unclassified | 618 |
| 246 | Ga0501033_0009428 | 3300049570 | Bacteria | 7515 |
| 247 | Ga0501034_0091114 | 3300049571 | Bacteria | 3047 |
| 248 | Ga0501036_0064050 | 3300049572 | Bacteria | 3112 |
| 249 | Ga0501073_0094897 | 3300049589 | Bacteria | 2072 |
| 250 | Ga0501259_033797 | 3300049688 | Bacteria | 978 |
| 251 | Ga0501221_092380 | 3300049704 | Bacteria | 742 |
| 252 | Ga0501245_023806 | 3300049708 | Bacteria | 975 |
| 253 | Ga0501080_0077034 | 3300049742 | Bacteria | 3101 |
| 254 | Ga0501035_0047178 | 3300049822 | Bacteria | 3869 |
| 255 | Ga0501044_0090633 | 3300049823 | Bacteria | 3084 |
| 256 | nmdc:mga08y16_534957_c1 | 3300050511 | Bacteria | 1187 |
| 257 | nmdc:mga0n895_969638_c1 | 3300050512 | Bacteria | 833 |
| 258 | nmdc:mga0rr50_118577_c1 | 3300050513 | Bacteria | 2103 |
| 259 | Ga0500637_0152599 | 3300053178 | Bacteria | 1334 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005330 | Ga0070690_100053898 | Ga0070690_1000538984 | 178 |
| 2 | 3300005333 | Ga0070677_10024607 | Ga0070677_100246071 | 178 |
| 3 | 3300005338 | Ga0068868_100517803 | Ga0068868_1005178031 | 178 |
| 4 | 3300005339 | Ga0070660_101197156 | Ga0070660_1011971561 | 178 |
| 5 | 3300005353 | Ga0070669_100000563 | Ga0070669_1000005639 | 178 |
| 6 | 3300005354 | Ga0070675_100024039 | Ga0070675_1000240391 | 178 |
| 7 | 3300005356 | Ga0070674_101054238 | Ga0070674_1010542381 | 178 |
| 8 | 3300005364 | Ga0070673_100010545 | Ga0070673_1000105451 | 178 |
| 9 | 3300005366 | Ga0070659_100455645 | Ga0070659_1004556451 | 178 |
| 10 | 3300005367 | Ga0070667_100126217 | Ga0070667_1001262174 | 178 |
| 11 | 3300005543 | Ga0070672_100245987 | Ga0070672_1002459871 | 178 |
| 12 | 3300005548 | Ga0070665_100956009 | Ga0070665_1009560091 | 178 |
| 13 | 3300005617 | Ga0068859_100003333 | Ga0068859_1000033339 | 178 |
| 14 | 3300005840 | Ga0068870_10012596 | Ga0068870_100125964 | 178 |
| 15 | 3300006931 | Ga0097620_100003333 | Ga0097620_1000033337 | 178 |
| 16 | 3300009094 | Ga0111539_10578804 | Ga0111539_105788041 | 178 |
| 17 | 3300009177 | Ga0105248_10217539 | Ga0105248_102175392 | 178 |
| 18 | 3300014745 | Ga0157377_10038555 | Ga0157377_100385554 | 178 |
| 19 | 3300025908 | Ga0207643_10015114 | Ga0207643_100151143 | 178 |
| 20 | 3300025908 | Ga0207643_10520275 | Ga0207643_105202751 | 178 |
| 21 | 3300025918 | Ga0207662_10311039 | Ga0207662_103110392 | 178 |
| 22 | 3300025926 | Ga0207659_10060953 | Ga0207659_100609531 | 178 |
| 23 | 3300025932 | Ga0207690_10403555 | Ga0207690_104035552 | 178 |
| 24 | 3300025936 | Ga0207670_10746818 | Ga0207670_107468181 | 178 |
| 25 | 3300025940 | Ga0207691_10017308 | Ga0207691_100173081 | 178 |
| 26 | 3300025945 | Ga0207679_10148217 | Ga0207679_101482174 | 178 |
| 27 | 3300026023 | Ga0207677_10665646 | Ga0207677_106656461 | 178 |
| 28 | 3300028379 | Ga0268266_10320384 | Ga0268266_103203843 | 178 |
| 29 | 3300031824 | Ga0307413_10313844 | Ga0307413_103138442 | 178 |
| 30 | 3300032126 | Ga0307415_100180466 | Ga0307415_1001804662 | 178 |
| 31 | 3300041997 | Ga0439431_0127953 | Ga0439431_0127953_128_664 | 178 |
| 32 | 3300042156 | Ga0439446_0036643 | Ga0439446_0036643_722_1258 | 178 |
| 33 | 3300050511 | nmdc:mga08y16_534957_c1 | nmdc:mga08y16_534957_c1_145_681 | 178 |
| 34 | 3300005330 | Ga0070690_100000216 | Ga0070690_1000002163 | 179 |
| 35 | 3300005334 | Ga0068869_100009821 | Ga0068869_1000098213 | 179 |
| 36 | 3300005336 | Ga0070680_100024170 | Ga0070680_1000241701 | 179 |
| 37 | 3300005337 | Ga0070682_100004786 | Ga0070682_1000047867 | 179 |
| 38 | 3300005338 | Ga0068868_100004312 | Ga0068868_1000043123 | 179 |
| 39 | 3300005340 | Ga0070689_100006563 | Ga0070689_1000065635 | 179 |
| 40 | 3300005341 | Ga0070691_10000528 | Ga0070691_1000052812 | 179 |
| 41 | 3300005343 | Ga0070687_100000604 | Ga0070687_10000060410 | 179 |
| 42 | 3300005345 | Ga0070692_10013366 | Ga0070692_100133663 | 179 |
| 43 | 3300005353 | Ga0070669_100271123 | Ga0070669_1002711233 | 179 |
| 44 | 3300005353 | Ga0070669_100272830 | Ga0070669_1002728301 | 179 |
| 45 | 3300005353 | Ga0070669_100699089 | Ga0070669_1006990891 | 179 |
| 46 | 3300005355 | Ga0070671_100093567 | Ga0070671_1000935672 | 179 |
| 47 | 3300005356 | Ga0070674_100265253 | Ga0070674_1002652533 | 179 |
| 48 | 3300005364 | Ga0070673_100046021 | Ga0070673_1000460213 | 179 |
| 49 | 3300005365 | Ga0070688_100187771 | Ga0070688_1001877713 | 179 |
| 50 | 3300005366 | Ga0070659_100422632 | Ga0070659_1004226322 | 179 |
| 51 | 3300005438 | Ga0070701_10002596 | Ga0070701_100025964 | 179 |
| 52 | 3300005440 | Ga0070705_100000554 | Ga0070705_10000055413 | 179 |
| 53 | 3300005441 | Ga0070700_100000281 | Ga0070700_1000002818 | 179 |
| 54 | 3300005444 | Ga0070694_100000565 | Ga0070694_10000056512 | 179 |
| 55 | 3300005456 | Ga0070678_100090063 | Ga0070678_1000900633 | 179 |
| 56 | 3300005457 | Ga0070662_101221934 | Ga0070662_1012219341 | 179 |
| 57 | 3300005459 | Ga0068867_100000206 | Ga0068867_1000002064 | 179 |
| 58 | 3300005459 | Ga0068867_100559146 | Ga0068867_1005591462 | 179 |
| 59 | 3300005530 | Ga0070679_100034844 | Ga0070679_1000348443 | 179 |
| 60 | 3300005530 | Ga0070679_100158856 | Ga0070679_1001588562 | 179 |
| 61 | 3300005539 | Ga0068853_100359448 | Ga0068853_1003594482 | 179 |
| 62 | 3300005544 | Ga0070686_100000711 | Ga0070686_10000071112 | 179 |
| 63 | 3300005545 | Ga0070695_100000281 | Ga0070695_1000002818 | 179 |
| 64 | 3300005546 | Ga0070696_100004140 | Ga0070696_1000041404 | 179 |
| 65 | 3300005547 | Ga0070693_100000162 | Ga0070693_10000016222 | 179 |
| 66 | 3300005549 | Ga0070704_100010913 | Ga0070704_1000109136 | 179 |
| 67 | 3300005578 | Ga0068854_100004064 | Ga0068854_1000040644 | 179 |
| 68 | 3300005614 | Ga0068856_100040331 | Ga0068856_1000403315 | 179 |
| 69 | 3300005615 | Ga0070702_100000093 | Ga0070702_10000009322 | 179 |
| 70 | 3300005616 | Ga0068852_100064759 | Ga0068852_1000647593 | 179 |
| 71 | 3300005617 | Ga0068859_100003739 | Ga0068859_1000037399 | 179 |
| 72 | 3300005617 | Ga0068859_100839597 | Ga0068859_1008395972 | 179 |
| 73 | 3300005718 | Ga0068866_10000256 | Ga0068866_1000025611 | 179 |
| 74 | 3300005719 | Ga0068861_100000355 | Ga0068861_1000003557 | 179 |
| 75 | 3300005840 | Ga0068870_10079855 | Ga0068870_100798552 | 179 |
| 76 | 3300005842 | Ga0068858_100026157 | Ga0068858_1000261574 | 179 |
| 77 | 3300005842 | Ga0068858_101504243 | Ga0068858_1015042431 | 179 |
| 78 | 3300005843 | Ga0068860_100002594 | Ga0068860_10000259413 | 179 |
| 79 | 3300005844 | Ga0068862_100000381 | Ga0068862_10000038112 | 179 |
| 80 | 3300006237 | Ga0097621_100000303 | Ga0097621_1000003039 | 179 |
| 81 | 3300006358 | Ga0068871_100006128 | Ga0068871_10000612810 | 179 |
| 82 | 3300006871 | Ga0075434_100283608 | Ga0075434_1002836082 | 179 |
| 83 | 3300006881 | Ga0068865_100034139 | Ga0068865_1000341395 | 179 |
| 84 | 3300006931 | Ga0097620_100003738 | Ga0097620_1000037389 | 179 |
| 85 | 3300006931 | Ga0097620_100839396 | Ga0097620_1008393962 | 179 |
| 86 | 3300007076 | Ga0075435_100074900 | Ga0075435_1000749003 | 179 |
| 87 | 3300009092 | Ga0105250_10062567 | Ga0105250_100625672 | 179 |
| 88 | 3300009098 | Ga0105245_10002702 | Ga0105245_1000270211 | 179 |
| 89 | 3300009148 | Ga0105243_10000631 | Ga0105243_1000063113 | 179 |
| 90 | 3300009174 | Ga0105241_10033493 | Ga0105241_100334934 | 179 |
| 91 | 3300009176 | Ga0105242_10003476 | Ga0105242_1000347610 | 179 |
| 92 | 3300009177 | Ga0105248_10216328 | Ga0105248_102163283 | 179 |
| 93 | 3300009553 | Ga0105249_10003937 | Ga0105249_1000393710 | 179 |
| 94 | 3300009553 | Ga0105249_10336171 | Ga0105249_103361712 | 179 |
| 95 | 3300010375 | Ga0105239_10052100 | Ga0105239_100521004 | 179 |
| 96 | 3300013297 | Ga0157378_10005443 | Ga0157378_100054431 | 179 |
| 97 | 3300014745 | Ga0157377_10376220 | Ga0157377_103762202 | 179 |
| 98 | 3300014968 | Ga0157379_10103658 | Ga0157379_101036582 | 179 |
| 99 | 3300025899 | Ga0207642_10000588 | Ga0207642_1000058812 | 179 |
| 100 | 3300025904 | Ga0207647_10101566 | Ga0207647_101015662 | 179 |
| 101 | 3300025908 | Ga0207643_10210341 | Ga0207643_102103411 | 179 |
| 102 | 3300025911 | Ga0207654_10537955 | Ga0207654_105379552 | 179 |
| 103 | 3300025917 | Ga0207660_10003314 | Ga0207660_100033144 | 179 |
| 104 | 3300025918 | Ga0207662_10000257 | Ga0207662_100002577 | 179 |
| 105 | 3300025921 | Ga0207652_10038255 | Ga0207652_100382551 | 179 |
| 106 | 3300025921 | Ga0207652_10109000 | Ga0207652_101090003 | 179 |
| 107 | 3300025923 | Ga0207681_10600520 | Ga0207681_106005202 | 179 |
| 108 | 3300025927 | Ga0207687_10002535 | Ga0207687_100025355 | 179 |
| 109 | 3300025931 | Ga0207644_10044538 | Ga0207644_100445382 | 179 |
| 110 | 3300025934 | Ga0207686_10007586 | Ga0207686_100075862 | 179 |
| 111 | 3300025935 | Ga0207709_10061611 | Ga0207709_100616111 | 179 |
| 112 | 3300025936 | Ga0207670_10002665 | Ga0207670_100026659 | 179 |
| 113 | 3300025938 | Ga0207704_10000798 | Ga0207704_1000079810 | 179 |
| 114 | 3300025941 | Ga0207711_10175298 | Ga0207711_101752982 | 179 |
| 115 | 3300025942 | Ga0207689_10001220 | Ga0207689_1000122021 | 179 |
| 116 | 3300025960 | Ga0207651_10419302 | Ga0207651_104193021 | 179 |
| 117 | 3300025961 | Ga0207712_10013923 | Ga0207712_100139237 | 179 |
| 118 | 3300026023 | Ga0207677_10011010 | Ga0207677_100110104 | 179 |
| 119 | 3300026035 | Ga0207703_10010158 | Ga0207703_100101582 | 179 |
| 120 | 3300026041 | Ga0207639_10097816 | Ga0207639_100978162 | 179 |
| 121 | 3300026075 | Ga0207708_10008364 | Ga0207708_100083645 | 179 |
| 122 | 3300026078 | Ga0207702_10048596 | Ga0207702_100485963 | 179 |
| 123 | 3300026089 | Ga0207648_10001304 | Ga0207648_1000130421 | 179 |
| 124 | 3300026095 | Ga0207676_10121947 | Ga0207676_101219473 | 179 |
| 125 | 3300026118 | Ga0207675_100000900 | Ga0207675_10000090021 | 179 |
| 126 | 3300026121 | Ga0207683_10278214 | Ga0207683_102782143 | 179 |
| 127 | 3300026142 | Ga0207698_10051196 | Ga0207698_100511963 | 179 |
| 128 | 3300028380 | Ga0268265_10012740 | Ga0268265_100127401 | 179 |
| 129 | 3300028381 | Ga0268264_10023040 | Ga0268264_100230404 | 179 |
| 130 | 3300032002 | Ga0307416_100218970 | Ga0307416_1002189702 | 179 |
| 131 | 3300035089 | Ga0373944_0079884 | Ga0373944_0079884_224_763 | 179 |
| 132 | 3300035112 | Ga0373932_0070652 | Ga0373932_0070652_161_700 | 179 |
| 133 | 3300035114 | Ga0373939_0035533 | Ga0373939_0035533_270_809 | 179 |
| 134 | 3300035116 | Ga0373945_0173615 | Ga0373945_0173615_252_803 | 179 |
| 135 | 3300035170 | Ga0373943_0077798 | Ga0373943_0077798_192_743 | 179 |
| 136 | 3300035171 | Ga0373946_0026079 | Ga0373946_0026079_1660_2199 | 179 |
| 137 | 3300035241 | Ga0373961_0043995 | Ga0373961_0043995_270_809 | 179 |
| 138 | 3300035410 | Ga0373924_0032884 | Ga0373924_0032884_1017_1556 | 179 |
| 139 | 3300035691 | Ga0373931_0028143 | Ga0373931_0028143_632_1171 | 179 |
| 140 | 3300035691 | Ga0373931_0693776 | Ga0373931_0693776_115_654 | 179 |
| 141 | 3300035695 | Ga0373927_0236043 | Ga0373927_0236043_199_750 | 179 |
| 142 | 3300035725 | Ga0373947_0132519 | Ga0373947_0132519_288_839 | 179 |
| 143 | 3300039437 | Ga0436365_0987495 | Ga0436365_0987495_787_1326 | 179 |
| 144 | 3300045051 | Ga0451576_0007143 | Ga0451576_0007143_4561_5100 | 179 |
| 145 | 3300046473 | Ga0495582_0121717 | Ga0495582_0121717_839_1390 | 179 |
| 146 | 3300046475 | Ga0495639_0062048 | Ga0495639_0062048_421_972 | 179 |
| 147 | 3300046499 | Ga0495594_0093213 | Ga0495594_0093213_1005_1556 | 179 |
| 148 | 3300046517 | Ga0495630_0015200 | Ga0495630_0015200_4843_5394 | 179 |
| 149 | 3300046533 | Ga0495640_0278591 | Ga0495640_0278591_355_906 | 179 |
| 150 | 3300046535 | Ga0495586_0003196 | Ga0495586_0003196_742_1293 | 179 |
| 151 | 3300046663 | Ga0495635_0053198 | Ga0495635_0053198_660_1211 | 179 |
| 152 | 3300046683 | Ga0495658_0026196 | Ga0495658_0026196_1424_1975 | 179 |
| 153 | 3300047315 | Ga0495581_0008987 | Ga0495581_0008987_1712_2263 | 179 |
| 154 | 3300047319 | Ga0495674_0120559 | Ga0495674_0120559_523_1074 | 179 |
| 155 | 3300047673 | Ga0495593_0056081 | Ga0495593_0056081_679_1230 | 179 |
| 156 | 3300048911 | Ga0496108_1117411 | Ga0496108_1117411_65_607 | 179 |
| 157 | 3300048915 | Ga0496112_0265147 | Ga0496112_0265147_1061_1603 | 179 |
| 158 | 3300049568 | Ga0501031_0768135 | Ga0501031_0768135_30_569 | 179 |
| 159 | 3300049742 | Ga0501080_0077034 | Ga0501080_0077034_93_632 | 179 |
| 160 | 3300050512 | nmdc:mga0n895_969638_c1 | nmdc:mga0n895_969638_c1_215_757 | 179 |
| 161 | 3300050513 | nmdc:mga0rr50_118577_c1 | nmdc:mga0rr50_118577_c1_617_1159 | 179 |
| 162 | 3300009147 | Ga0114129_11975015 | Ga0114129_119750151 | 180 |
| 163 | 3300013104 | Ga0157370_10000364 | Ga0157370_1000036429 | 180 |
| 164 | 3300025944 | Ga0207661_10014694 | Ga0207661_100146942 | 180 |
| 165 | 3300031727 | Ga0316576_10219970 | Ga0316576_102199702 | 180 |
| 166 | 3300031852 | Ga0307410_10261789 | Ga0307410_102617891 | 180 |
| 167 | 3300031903 | Ga0307407_10085951 | Ga0307407_100859513 | 180 |
| 168 | 3300031995 | Ga0307409_100239175 | Ga0307409_1002391752 | 180 |
| 169 | 3300035692 | Ga0373935_0011763 | Ga0373935_0011763_3391_3939 | 180 |
| 170 | 3300035695 | Ga0373927_0014275 | Ga0373927_0014275_1518_2066 | 180 |
| 171 | 3300037068 | Ga0373925_0038054 | Ga0373925_0038054_2293_2835 | 180 |
| 172 | 3300042461 | Ga0439460_0026238 | Ga0439460_0026238_736_1281 | 180 |
| 173 | 3300044693 | Ga0466961_0055606 | Ga0466961_0055606_440_982 | 180 |
| 174 | 3300045049 | Ga0466959_0700525 | Ga0466959_0700525_11_553 | 180 |
| 175 | 3300049519 | Ga0501296_023861 | Ga0501296_023861_106_648 | 180 |
| 176 | 3300049570 | Ga0501033_0009428 | Ga0501033_0009428_5186_5728 | 180 |
| 177 | 3300049571 | Ga0501034_0091114 | Ga0501034_0091114_1299_1841 | 180 |
| 178 | 3300049572 | Ga0501036_0064050 | Ga0501036_0064050_566_1108 | 180 |
| 179 | 3300049822 | Ga0501035_0047178 | Ga0501035_0047178_719_1261 | 180 |
| 180 | 3300049823 | Ga0501044_0090633 | Ga0501044_0090633_1194_1736 | 180 |
| 181 | 3300053178 | Ga0500637_0152599 | Ga0500637_0152599_358_900 | 180 |
| 182 | 3300005329 | Ga0070683_100016571 | Ga0070683_1000165712 | 181 |
| 183 | 3300005367 | Ga0070667_100299505 | Ga0070667_1002995052 | 181 |
| 184 | 3300005564 | Ga0070664_100878502 | Ga0070664_1008785022 | 181 |
| 185 | 3300009551 | Ga0105238_10456525 | Ga0105238_104565252 | 181 |
| 186 | 3300025924 | Ga0207694_10889864 | Ga0207694_108898641 | 181 |
| 187 | 3300025937 | Ga0207669_10832738 | Ga0207669_108327382 | 181 |
| 188 | 3300025986 | Ga0207658_10134997 | Ga0207658_101349972 | 181 |
| 189 | 3300026116 | Ga0207674_10060494 | Ga0207674_100604942 | 181 |
| 190 | 3300031548 | Ga0307408_100627841 | Ga0307408_1006278411 | 181 |
| 191 | 3300032002 | Ga0307416_100123644 | Ga0307416_1001236443 | 181 |
| 192 | 3300032126 | Ga0307415_100103135 | Ga0307415_1001031354 | 181 |
| 193 | 3300039437 | Ga0436365_1691578 | Ga0436365_1691578_194_739 | 181 |
| 194 | 3300046664 | Ga0495659_0115699 | Ga0495659_0115699_57_602 | 181 |
| 195 | 3300047320 | Ga0495672_0007958 | Ga0495672_0007958_7098_7643 | 181 |
| 196 | 3300049589 | Ga0501073_0094897 | Ga0501073_0094897_347_892 | 181 |
| 197 | 3300049688 | Ga0501259_033797 | Ga0501259_033797_21_566 | 181 |
| 198 | 3300049708 | Ga0501245_023806 | Ga0501245_023806_83_628 | 181 |
| 199 | 3300005329 | Ga0070683_100008989 | Ga0070683_1000089898 | 182 |
| 200 | 3300005329 | Ga0070683_100544908 | Ga0070683_1005449082 | 182 |
| 201 | 3300005336 | Ga0070680_100000469 | Ga0070680_10000046918 | 182 |
| 202 | 3300005458 | Ga0070681_10000319 | Ga0070681_100003193 | 182 |
| 203 | 3300005530 | Ga0070679_100066916 | Ga0070679_1000669163 | 182 |
| 204 | 3300005530 | Ga0070679_100101925 | Ga0070679_1001019255 | 182 |
| 205 | 3300005535 | Ga0070684_100014361 | Ga0070684_1000143613 | 182 |
| 206 | 3300009093 | Ga0105240_10363216 | Ga0105240_103632162 | 182 |
| 207 | 3300009545 | Ga0105237_10078678 | Ga0105237_100786783 | 182 |
| 208 | 3300013104 | Ga0157370_10266672 | Ga0157370_102666722 | 182 |
| 209 | 3300013104 | Ga0157370_10268639 | Ga0157370_102686392 | 182 |
| 210 | 3300013105 | Ga0157369_10055717 | Ga0157369_100557172 | 182 |
| 211 | 3300013307 | Ga0157372_10005471 | Ga0157372_100054713 | 182 |
| 212 | 3300025912 | Ga0207707_10001048 | Ga0207707_1000104818 | 182 |
| 213 | 3300025913 | Ga0207695_10006196 | Ga0207695_100061966 | 182 |
| 214 | 3300025917 | Ga0207660_10004653 | Ga0207660_100046536 | 182 |
| 215 | 3300025921 | Ga0207652_10006262 | Ga0207652_100062628 | 182 |
| 216 | 3300025921 | Ga0207652_10108589 | Ga0207652_101085892 | 182 |
| 217 | 3300025944 | Ga0207661_10140558 | Ga0207661_101405582 | 182 |
| 218 | 3300025944 | Ga0207661_10525688 | Ga0207661_105256883 | 182 |
| 219 | 3300025949 | Ga0207667_10086720 | Ga0207667_100867203 | 182 |
| 220 | 3300025949 | Ga0207667_10397505 | Ga0207667_103975052 | 182 |
| 221 | 3300026078 | Ga0207702_10389129 | Ga0207702_103891292 | 182 |
| 222 | 3300026116 | Ga0207674_10461024 | Ga0207674_104610241 | 182 |
| 223 | 3300030760 | Ga0265762_1037871 | Ga0265762_10378711 | 182 |
| 224 | 3300031548 | Ga0307408_100407755 | Ga0307408_1004077552 | 182 |
| 225 | 3300031731 | Ga0307405_10895198 | Ga0307405_108951981 | 182 |
| 226 | 3300031824 | Ga0307413_10000154 | Ga0307413_100001549 | 182 |
| 227 | 3300031852 | Ga0307410_10003342 | Ga0307410_100033426 | 182 |
| 228 | 3300031901 | Ga0307406_10004953 | Ga0307406_100049532 | 182 |
| 229 | 3300031903 | Ga0307407_10002140 | Ga0307407_100021406 | 182 |
| 230 | 3300031911 | Ga0307412_10060429 | Ga0307412_100604293 | 182 |
| 231 | 3300032002 | Ga0307416_100001413 | Ga0307416_1000014137 | 182 |
| 232 | 3300032004 | Ga0307414_10004651 | Ga0307414_100046514 | 182 |
| 233 | 3300032005 | Ga0307411_10003999 | Ga0307411_100039996 | 182 |
| 234 | 3300032126 | Ga0307415_100005170 | Ga0307415_1000051706 | 182 |
| 235 | 3300046678 | Ga0495599_0019845 | Ga0495599_0019845_485_1033 | 182 |
| 236 | 3300049704 | Ga0501221_092380 | Ga0501221_092380_165_713 | 182 |
| 237 | 3300005327 | Ga0070658_10419138 | Ga0070658_104191382 | 183 |
| 238 | 3300005329 | Ga0070683_100286122 | Ga0070683_1002861221 | 183 |
| 239 | 3300005336 | Ga0070680_100365210 | Ga0070680_1003652103 | 183 |
| 240 | 3300005530 | Ga0070679_100198875 | Ga0070679_1001988753 | 183 |
| 241 | 3300005535 | Ga0070684_101162704 | Ga0070684_1011627041 | 183 |
| 242 | 3300021384 | Ga0213876_10109359 | Ga0213876_101093592 | 183 |
| 243 | 3300025917 | Ga0207660_10132786 | Ga0207660_101327863 | 183 |
| 244 | 3300025918 | Ga0207662_10766376 | Ga0207662_107663761 | 183 |
| 245 | 3300025921 | Ga0207652_10374417 | Ga0207652_103744171 | 183 |
| 246 | 3300031901 | Ga0307406_10586690 | Ga0307406_105866902 | 183 |
| 247 | 3300037418 | Ga0395900_0043098 | Ga0395900_0043098_2185_2742 | 183 |
| 248 | 3300037471 | Ga0395905_0034926 | Ga0395905_0034926_1964_2521 | 183 |
| 249 | 3300038443 | Ga0395901_0002411 | Ga0395901_0002411_3904_4461 | 183 |
| 250 | 3300039437 | Ga0436365_0082756 | Ga0436365_0082756_152_706 | 183 |
| 251 | 3300039437 | Ga0436365_0960080 | Ga0436365_0960080_688_1242 | 183 |
| 252 | 3300039437 | Ga0436365_1610390 | Ga0436365_1610390_507_1061 | 183 |
| 253 | 3300042435 | Ga0439434_0234197 | Ga0439434_0234197_16_567 | 183 |
| 254 | 3300045976 | Ga0466967_1263028 | Ga0466967_1263028_42_599 | 183 |
| 255 | 3300046477 | Ga0495664_0101582 | Ga0495664_0101582_585_1136 | 183 |
| 256 | 3300046499 | Ga0495594_0005168 | Ga0495594_0005168_4444_5007 | 183 |
| 257 | 3300046499 | Ga0495594_0205185 | Ga0495594_0205185_30_581 | 183 |
| 258 | 3300046535 | Ga0495586_0004551 | Ga0495586_0004551_1064_1615 | 183 |
| 259 | 3300047319 | Ga0495674_0105439 | Ga0495674_0105439_23_574 | 183 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2ot9-assembly1.cif.gz_A | crystal structure of yaeq protein from pseudomonas syringae | 0.8883 | 2 | 173 |
| 7tcb-assembly3.cif.gz_C | crystal structure of the yaeq family protein vpa0551 from vibrio parahaemolyticus | 0.8747 | 4 | 182 |
| 3c0u-assembly2.cif.gz_A | crystal structure of e.coli yaeq protein | 0.8734 | 1 | 175 |
| 3c0u-assembly3.cif.gz_B | crystal structure of e.coli yaeq protein | 0.8717 | 1 | 175 |
| 7tcb-assembly3.cif.gz_C | crystal structure of the yaeq family protein vpa0551 from vibrio parahaemolyticus | 0.8699 | 4 | 182 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2g3wB00 | Alpha Beta;Roll;Restriction endonuclease-like alpha-beta roll fold;Restriction endonuclease-like alpha-beta roll domain | 0.8899 | 4 | 174 | 3.10.640.10 |
| 2ot9A01 | Alpha Beta;Roll;Restriction endonuclease-like alpha-beta roll fold;Restriction endonuclease-like alpha-beta roll domain | 0.8765 | 2 | 173 | 3.10.640.10 |
| 3c0uA00 | Alpha Beta;Roll;Restriction endonuclease-like alpha-beta roll fold;Restriction endonuclease-like alpha-beta roll domain | 0.8675 | 1 | 175 | 3.10.640.10 |
| 2g3wB00 | Alpha Beta;Roll;Restriction endonuclease-like alpha-beta roll fold;Restriction endonuclease-like alpha-beta roll domain | 0.8657 | 4 | 174 | 3.10.640.10 |
| 2ot9A01 | Alpha Beta;Roll;Restriction endonuclease-like alpha-beta roll fold;Restriction endonuclease-like alpha-beta roll domain | 0.848 | 2 | 173 | 3.10.640.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7R7Y422-F1-model_v4 | deleted | 0.9823 | 1 | 179 |
|
| AF-A0A4P5XDV1-F1-model_v4 | deleted | 0.9727 | 7 | 180 |
|
| AF-A0A0D0I0H2-F1-model_v4 | YaeQ family protein | 0.9717 | 1 | 179 |
|
| AF-A0A7R7Y422-F1-model_v4 | deleted | 0.9715 | 1 | 179 |
|
| AF-A0A7Y5Q0G9-F1-model_v4 | YaeQ family protein | 0.9706 | 5 | 180 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar