F368645

General Info

Members Datasets Scaffolds Average Seq Length
259 159 518 214

Family's Representative Sequence

Representative Sequence 3300005468|Ga0070707_100052644|Ga0070707_1000526444
Length 255
Sequence LFRKIYLRGVACQTINLLWSWLVDKSDISGAVEASQGYKSMRKKPEKELFTEPEWKLVEKLQTPAKVQRFFSSMPYNWERERGTMRSFREVIKRNEAHCLEAAVGAAVILEQHGYPPLLLDIESQDLLDHVIFVFQEDGRWGSIGRSRDIGLHGRRPLFRTLRDLAWSYFDPYVDFSGRIKGYGPANLYDLGNYDWRFSPRKMSKIEDYLRALPHRRLHSSDKRYETLLDRYHRFKKRFPDRSPKYYDNRNQWMI

Samples

Sample ID Description Type Environment
1 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
60 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
72 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
73 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
82 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
114 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
115 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
116 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
117 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
118 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
119 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
120 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
121 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
122 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
123 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
124 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
125 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
126 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
127 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
129 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
130 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
131 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
132 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
133 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
134 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
135 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
136 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
137 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
138 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
139 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
140 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
141 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
142 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
143 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
144 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
145 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
146 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
147 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
148 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
149 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
150 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
151 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
152 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
153 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
154 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
155 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
156 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
157 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
158 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
159 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.39
Rhizosphere 99.23
Stem 0
Stem Tuber 0
Unclassified 27.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070707_100052644 3300005468 Bacteria 3903
2 rootH1_10115235 3300003316 Bacteria 1608
3 Ga0065712_10102803 3300005290 Bacteria 1979
4 Ga0065715_10002203 3300005293 Bacteria 5045
5 Ga0065715_10195374 3300005293 Bacteria 1391
6 Ga0065707_10206044 3300005295 Unclassified 1287
7 Ga0070676_10136395 3300005328 Bacteria 1557
8 Ga0070690_100036541 3300005330 Bacteria 3087
9 Ga0070670_100200241 3300005331 Unclassified 1735
10 Ga0070670_100200293 3300005331 Bacteria 1735
11 Ga0068869_100045720 3300005334 Bacteria 3153
12 Ga0068869_100087046 3300005334 Bacteria 2343
13 Ga0068869_100103829 3300005334 Bacteria 2154
14 Ga0068869_100190612 3300005334 Bacteria 1612
15 Ga0070666_10200279 3300005335 Bacteria 1405
16 Ga0070680_100009102 3300005336 Bacteria 7616
17 Ga0068868_100305000 3300005338 Unclassified 1353
18 Ga0070689_100678334 3300005340 Unclassified 898
19 Ga0070687_100019899 3300005343 Bacteria 3130
20 Ga0070687_100043049 3300005343 Bacteria 2292
21 Ga0070692_10402226 3300005345 Bacteria 865
22 Ga0070673_100100763 3300005364 Bacteria 2378
23 Ga0070673_100281797 3300005364 Bacteria 1458
24 Ga0070705_100118838 3300005440 Bacteria 1703
25 Ga0070705_100875721 3300005440 Unclassified 720
26 Ga0070700_100081084 3300005441 Bacteria 2095
27 Ga0070694_100031421 3300005444 Bacteria 3482
28 Ga0070694_100038123 3300005444 Bacteria 3192
29 Ga0070694_100094935 3300005444 Unclassified 2099
30 Ga0070694_100127644 3300005444 Bacteria 1833
31 Ga0070694_100262279 3300005444 Bacteria 1311
32 Ga0070694_100388456 3300005444 Unclassified 1090
33 Ga0070708_100000257 3300005445 Bacteria 39748
34 Ga0070678_100483316 3300005456 Bacteria 1090
35 Ga0070681_10023581 3300005458 Bacteria 6189
36 Ga0070681_10898820 3300005458 Bacteria 804
37 Ga0068867_100141153 3300005459 Unclassified 1883
38 Ga0070685_10010731 3300005466 Bacteria 4769
39 Ga0070685_10387869 3300005466 Unclassified 964
40 Ga0070706_100067283 3300005467 Unclassified 3313
41 Ga0070707_100044176 3300005468 Bacteria 4265
42 Ga0070707_100178817 3300005468 Unclassified 2068
43 Ga0070698_100048348 3300005471 Unclassified 4346
44 Ga0070698_100583923 3300005471 Unclassified 1057
45 Ga0070699_100000196 3300005518 Bacteria 59314
46 Ga0070699_100174638 3300005518 Unclassified 1905
47 Ga0070699_100288591 3300005518 Unclassified 1471
48 Ga0070679_100837477 3300005530 Bacteria 863
49 Ga0070697_100000983 3300005536 Bacteria 21549
50 Ga0070697_100650630 3300005536 Unclassified 928
51 Ga0068853_100304197 3300005539 Bacteria 1475
52 Ga0070686_100011028 3300005544 Bacteria 5117
53 Ga0070686_100016945 3300005544 Bacteria 4247
54 Ga0070695_100018067 3300005545 Bacteria 4281
55 Ga0070695_100274895 3300005545 Bacteria 1235
56 Ga0070695_100314516 3300005545 Bacteria 1162
57 Ga0070696_100046023 3300005546 Bacteria 3025
58 Ga0070696_100094518 3300005546 Unclassified 2133
59 Ga0070696_100163813 3300005546 Bacteria 1640
60 Ga0070693_100178879 3300005547 Bacteria 1364
61 Ga0070704_100085981 3300005549 Bacteria 2329
62 Ga0070704_100117318 3300005549 Bacteria 2037
63 Ga0070704_100517500 3300005549 Bacteria 1038
64 Ga0070664_100135283 3300005564 Unclassified 2167
65 Ga0068857_100164385 3300005577 Bacteria 2015
66 Ga0068854_100218410 3300005578 Bacteria 1507
67 Ga0068854_100223530 3300005578 Unclassified 1491
68 Ga0068854_100353701 3300005578 Bacteria 1203
69 Ga0068856_101278116 3300005614 Bacteria 749
70 Ga0070702_100002112 3300005615 Bacteria 8441
71 Ga0068859_100019346 3300005617 Bacteria 6841
72 Ga0068859_100052957 3300005617 Unclassified 4081
73 Ga0068859_100061584 3300005617 Bacteria 3781
74 Ga0068859_100185928 3300005617 Bacteria 2161
75 Ga0068859_100214639 3300005617 Unclassified 2011
76 Ga0068859_101175217 3300005617 Unclassified 845
77 Ga0068864_100067388 3300005618 Bacteria 3108
78 Ga0068864_100333542 3300005618 Bacteria 1428
79 Ga0068866_10009831 3300005718 Bacteria 4077
80 Ga0068861_100022309 3300005719 Bacteria 4559
81 Ga0068861_100038462 3300005719 Bacteria 3563
82 Ga0068861_100081990 3300005719 Bacteria 2527
83 Ga0068870_10126271 3300005840 Unclassified 1480
84 Ga0068863_100111360 3300005841 Unclassified 2607
85 Ga0068863_100206178 3300005841 Unclassified 1892
86 Ga0068863_100381608 3300005841 Unclassified 1376
87 Ga0068858_100176316 3300005842 Bacteria 2017
88 Ga0068858_100203103 3300005842 Bacteria 1874
89 Ga0068860_100045287 3300005843 Bacteria 4195
90 Ga0068860_100074096 3300005843 Bacteria 3236
91 Ga0068860_100127049 3300005843 Bacteria 2444
92 Ga0068862_100127917 3300005844 Bacteria 2244
93 Ga0081539_10001769 3300005985 Bacteria 34433
94 Ga0097621_100030189 3300006237 Unclassified 4288
95 Ga0068871_100032854 3300006358 Bacteria 4103
96 Ga0075430_100155728 3300006846 Unclassified 1902
97 Ga0075433_10015026 3300006852 Bacteria 6337
98 Ga0075433_10280205 3300006852 Bacteria 1477
99 Ga0075434_100044123 3300006871 Bacteria 4423
100 Ga0075434_100268088 3300006871 Bacteria 1727
101 Ga0075434_100562022 3300006871 Unclassified 1160
102 Ga0075429_100182541 3300006880 Bacteria 1838
103 Ga0075436_100000115 3300006914 Bacteria 47382
104 Ga0097620_100019348 3300006931 Bacteria 6841
105 Ga0097620_100052956 3300006931 Unclassified 4081
106 Ga0097620_100061582 3300006931 Bacteria 3781
107 Ga0097620_100185926 3300006931 Bacteria 2161
108 Ga0097620_100214644 3300006931 Unclassified 2011
109 Ga0097620_101175387 3300006931 Unclassified 845
110 Ga0075435_100000138 3300007076 Bacteria 41051
111 Ga0099794_10089648 3300007265 Bacteria 1525
112 Ga0099794_10188533 3300007265 Bacteria 1054
113 Ga0111539_10237240 3300009094 Bacteria 2123
114 Ga0105245_10117374 3300009098 Bacteria 2482
115 Ga0114129_10003933 3300009147 Bacteria 20982
116 Ga0114129_10025277 3300009147 Bacteria 8415
117 Ga0114129_10066791 3300009147 Bacteria 5015
118 Ga0105243_10040768 3300009148 Bacteria 3628
119 Ga0105243_10204387 3300009148 Bacteria 1734
120 Ga0105243_10547073 3300009148 Bacteria 1105
121 Ga0105241_10285452 3300009174 Bacteria 1411
122 Ga0105241_10299252 3300009174 Bacteria 1380
123 Ga0105242_10003978 3300009176 Bacteria 11487
124 Ga0105242_10088416 3300009176 Bacteria 2603
125 Ga0105248_10167203 3300009177 Bacteria 2479
126 Ga0105248_10246453 3300009177 Bacteria 2011
127 Ga0105249_10062192 3300009553 Bacteria 3427
128 Ga0099796_10026782 3300010159 Bacteria 1835
129 Ga0105239_10127051 3300010375 Unclassified 2835
130 Ga0105239_10166739 3300010375 Unclassified 2463
131 Ga0105246_10438977 3300011119 Unclassified 1094
132 Ga0157373_10006408 3300013100 Bacteria 8793
133 Ga0157373_10451505 3300013100 Bacteria 925
134 Ga0157371_10162253 3300013102 Unclassified 1596
135 Ga0157371_10324518 3300013102 Bacteria 1118
136 Ga0157378_10143169 3300013297 Bacteria 2222
137 Ga0157378_10236486 3300013297 Bacteria 1743
138 Ga0163162_10015819 3300013306 Bacteria 7372
139 Ga0163162_10026530 3300013306 Bacteria 5725
140 Ga0163162_10625123 3300013306 Unclassified 1202
141 Ga0157375_10163189 3300013308 Bacteria 2371
142 Ga0163163_10038168 3300014325 Bacteria 4678
143 Ga0163163_10131085 3300014325 Unclassified 2547
144 Ga0157377_10013089 3300014745 Unclassified 4191
145 Ga0157377_10113379 3300014745 Bacteria 1633
146 Ga0157377_10141842 3300014745 Bacteria 1477
147 Ga0157379_10077765 3300014968 Bacteria 2971
148 Ga0157376_10040634 3300014969 Bacteria 3802
149 Ga0157376_10085337 3300014969 Bacteria 2720
150 Ga0163161_10001678 3300017792 Bacteria 16244
151 Ga0207642_10036868 3300025899 Unclassified 2102
152 Ga0207643_10017042 3300025908 Bacteria 3967
153 Ga0207643_10063664 3300025908 Bacteria 2109
154 Ga0207684_10050933 3300025910 Bacteria 3513
155 Ga0207684_10140191 3300025910 Bacteria 2078
156 Ga0207684_10173597 3300025910 Bacteria 1858
157 Ga0207654_10110847 3300025911 Bacteria 1707
158 Ga0207707_10018656 3300025912 Bacteria 6048
159 Ga0207707_10558787 3300025912 Bacteria 972
160 Ga0207660_10013566 3300025917 Bacteria 5342
161 Ga0207662_10007300 3300025918 Bacteria 6009
162 Ga0207662_10013507 3300025918 Bacteria 4566
163 Ga0207646_10129578 3300025922 Unclassified 2270
164 Ga0207646_10501321 3300025922 Bacteria 1094
165 Ga0207681_10213580 3300025923 Bacteria 1488
166 Ga0207650_10260197 3300025925 Unclassified 1407
167 Ga0207650_10389262 3300025925 Unclassified 1152
168 Ga0207687_10030951 3300025927 Bacteria 3613
169 Ga0207644_10528338 3300025931 Bacteria 975
170 Ga0207686_10000085 3300025934 Bacteria 78672
171 Ga0207686_10255975 3300025934 Bacteria 1281
172 Ga0207709_10061573 3300025935 Bacteria 2346
173 Ga0207709_10741042 3300025935 Unclassified 789
174 Ga0207670_10056139 3300025936 Bacteria 2665
175 Ga0207670_10468603 3300025936 Unclassified 1018
176 Ga0207704_10079082 3300025938 Unclassified 2117
177 Ga0207691_10029596 3300025940 Bacteria 5122
178 Ga0207711_10070242 3300025941 Bacteria 3036
179 Ga0207689_10047836 3300025942 Bacteria 3528
180 Ga0207689_10117457 3300025942 Bacteria 2187
181 Ga0207712_10197426 3300025961 Bacteria 1593
182 Ga0207640_10145155 3300025981 Bacteria 1735
183 Ga0207703_10178705 3300026035 Bacteria 1872
184 Ga0207708_10071278 3300026075 Bacteria 2662
185 Ga0207641_10309993 3300026088 Bacteria 1493
186 Ga0207641_11224423 3300026088 Unclassified 751
187 Ga0207648_10056112 3300026089 Bacteria 3438
188 Ga0207676_10063861 3300026095 Bacteria 2925
189 Ga0207676_10375434 3300026095 Unclassified 1322
190 Ga0207674_10168643 3300026116 Bacteria 2143
191 Ga0207675_100002975 3300026118 Bacteria 16670
192 Ga0207675_100038451 3300026118 Bacteria 4466
193 Ga0207675_100102600 3300026118 Bacteria 2695
194 Ga0207675_100217924 3300026118 Bacteria 1838
195 Ga0207683_10414368 3300026121 Bacteria 1240
196 Ga0207683_10447776 3300026121 Bacteria 1190
197 Ga0268265_10095532 3300028380 Bacteria 2387
198 Ga0268265_10227624 3300028380 Bacteria 1636
199 Ga0268264_10143191 3300028381 Bacteria 2134
200 Ga0268264_10164751 3300028381 Bacteria 2000
201 Ga0268264_10291782 3300028381 Bacteria 1532
202 Ga0307408_100483775 3300031548 Bacteria 1080
203 Ga0307412_10062576 3300031911 Bacteria 2506
204 Ga0307411_10078270 3300032005 Unclassified 2266
205 Ga0307415_100270148 3300032126 Unclassified 1392
206 Ga0395905_0458004 3300037471 Unclassified 1174
207 Ga0439448_0002217 3300042005 Bacteria 5253
208 Ga0439462_0032100 3300042015 Unclassified 1392
209 Ga0439458_0004960 3300042157 Bacteria 3015
210 Ga0496113_0676352 3300048916 Bacteria 825
211 Ga0501296_008954 3300049519 Unclassified 1168
212 Ga0501297_008283 3300049520 Bacteria 1143
213 Ga0501298_005987 3300049521 Bacteria 1974
214 Ga0501298_007646 3300049521 Unclassified 1796
215 Ga0501299_002111 3300049522 Bacteria 2714
216 Ga0501299_021859 3300049522 Unclassified 1176
217 Ga0501300_018231 3300049523 Unclassified 1025
218 Ga0501039_0206167 3300049575 Bacteria 1546
219 Ga0501071_0202272 3300049587 Bacteria 1492
220 Ga0501202_020498 3300049652 Bacteria 1314
221 Ga0501206_030057 3300049653 Unclassified 805
222 Ga0501208_006386 3300049655 Bacteria 1500
223 Ga0501217_002601 3300049661 Bacteria 3573
224 Ga0501217_063156 3300049661 Unclassified 994
225 Ga0501223_007358 3300049663 Bacteria 2254
226 Ga0501233_008122 3300049668 Bacteria 2016
227 Ga0501235_001811 3300049669 Bacteria 4588
228 Ga0501235_006655 3300049669 Bacteria 2516
229 Ga0501243_004316 3300049675 Bacteria 2130
230 Ga0501246_001893 3300049676 Bacteria 1630
231 Ga0501247_011028 3300049677 Unclassified 1085
232 Ga0501253_014755 3300049683 Bacteria 1271
233 Ga0501259_006567 3300049688 Unclassified 1851
234 Ga0501261_001759 3300049690 Unclassified 2667
235 Ga0501221_054368 3300049704 Unclassified 910
236 Ga0501225_0010182 3300049705 Bacteria 2667
237 Ga0501225_0054054 3300049705 Unclassified 1122
238 Ga0501225_0055506 3300049705 Bacteria 1108
239 Ga0501234_002965 3300049707 Bacteria 2666
240 Ga0501262_011195 3300049759 Bacteria 1132
241 Ga0501265_004030 3300049762 Bacteria 1669
242 Ga0501266_003723 3300049763 Unclassified 1889
243 Ga0501270_003318 3300049767 Unclassified 1727
244 Ga0501283_001790 3300049779 Bacteria 2785
245 Ga0501283_007621 3300049779 Unclassified 1545
246 Ga0501212_001066 3300049851 Bacteria 2984
247 Ga0501212_023301 3300049851 Bacteria 969
248 Ga0501226_012145 3300049853 Bacteria 954
249 nmdc:mga05p37_35972_c1 3300050507 Bacteria 6076
250 nmdc:mga05p37_894367_c1 3300050507 Unclassified 958
251 nmdc:mga0qj67_145065_c1 3300050509 Unclassified 1924
252 nmdc:mga0n895_83674_c1 3300050512 Unclassified 3183
253 nmdc:mga0rr50_983_c1 3300050513 Bacteria 15495
254 nmdc:mga08x19_1875_c1 3300050514 Bacteria 12876
255 nmdc:mga08x19_3_c1 3300050514 Bacteria 654433
256 nmdc:mga0a205_278390_c1 3300050515 Bacteria 1549
257 nmdc:mga0a205_52601_c1 3300050515 Bacteria 3930
258 Ga0501084_0190947 3300054114 Unclassified 1728
259 Ga0501082_0136048 3300060353 Unclassified 2132
260 Ga0070707_100052644
261 rootH1_10115235
262 Ga0065712_10102803
263 Ga0065715_10002203
264 Ga0065715_10195374
265 Ga0065707_10206044
266 Ga0070676_10136395
267 Ga0070690_100036541
268 Ga0070670_100200241
269 Ga0070670_100200293
270 Ga0068869_100045720
271 Ga0068869_100087046
272 Ga0068869_100103829
273 Ga0068869_100190612
274 Ga0070666_10200279
275 Ga0070680_100009102
276 Ga0068868_100305000
277 Ga0070689_100678334
278 Ga0070687_100019899
279 Ga0070687_100043049
280 Ga0070692_10402226
281 Ga0070673_100100763
282 Ga0070673_100281797
283 Ga0070705_100118838
284 Ga0070705_100875721
285 Ga0070700_100081084
286 Ga0070694_100031421
287 Ga0070694_100038123
288 Ga0070694_100094935
289 Ga0070694_100127644
290 Ga0070694_100262279
291 Ga0070694_100388456
292 Ga0070708_100000257
293 Ga0070678_100483316
294 Ga0070681_10023581
295 Ga0070681_10898820
296 Ga0068867_100141153
297 Ga0070685_10010731
298 Ga0070685_10387869
299 Ga0070706_100067283
300 Ga0070707_100044176
301 Ga0070707_100178817
302 Ga0070698_100048348
303 Ga0070698_100583923
304 Ga0070699_100000196
305 Ga0070699_100174638
306 Ga0070699_100288591
307 Ga0070679_100837477
308 Ga0070697_100000983
309 Ga0070697_100650630
310 Ga0068853_100304197
311 Ga0070686_100011028
312 Ga0070686_100016945
313 Ga0070695_100018067
314 Ga0070695_100274895
315 Ga0070695_100314516
316 Ga0070696_100046023
317 Ga0070696_100094518
318 Ga0070696_100163813
319 Ga0070693_100178879
320 Ga0070704_100085981
321 Ga0070704_100117318
322 Ga0070704_100517500
323 Ga0070664_100135283
324 Ga0068857_100164385
325 Ga0068854_100218410
326 Ga0068854_100223530
327 Ga0068854_100353701
328 Ga0068856_101278116
329 Ga0070702_100002112
330 Ga0068859_100019346
331 Ga0068859_100052957
332 Ga0068859_100061584
333 Ga0068859_100185928
334 Ga0068859_100214639
335 Ga0068859_101175217
336 Ga0068864_100067388
337 Ga0068864_100333542
338 Ga0068866_10009831
339 Ga0068861_100022309
340 Ga0068861_100038462
341 Ga0068861_100081990
342 Ga0068870_10126271
343 Ga0068863_100111360
344 Ga0068863_100206178
345 Ga0068863_100381608
346 Ga0068858_100176316
347 Ga0068858_100203103
348 Ga0068860_100045287
349 Ga0068860_100074096
350 Ga0068860_100127049
351 Ga0068862_100127917
352 Ga0081539_10001769
353 Ga0097621_100030189
354 Ga0068871_100032854
355 Ga0075430_100155728
356 Ga0075433_10015026
357 Ga0075433_10280205
358 Ga0075434_100044123
359 Ga0075434_100268088
360 Ga0075434_100562022
361 Ga0075429_100182541
362 Ga0075436_100000115
363 Ga0097620_100019348
364 Ga0097620_100052956
365 Ga0097620_100061582
366 Ga0097620_100185926
367 Ga0097620_100214644
368 Ga0097620_101175387
369 Ga0075435_100000138
370 Ga0099794_10089648
371 Ga0099794_10188533
372 Ga0111539_10237240
373 Ga0105245_10117374
374 Ga0114129_10003933
375 Ga0114129_10025277
376 Ga0114129_10066791
377 Ga0105243_10040768
378 Ga0105243_10204387
379 Ga0105243_10547073
380 Ga0105241_10285452
381 Ga0105241_10299252
382 Ga0105242_10003978
383 Ga0105242_10088416
384 Ga0105248_10167203
385 Ga0105248_10246453
386 Ga0105249_10062192
387 Ga0099796_10026782
388 Ga0105239_10127051
389 Ga0105239_10166739
390 Ga0105246_10438977
391 Ga0157373_10006408
392 Ga0157373_10451505
393 Ga0157371_10162253
394 Ga0157371_10324518
395 Ga0157378_10143169
396 Ga0157378_10236486
397 Ga0163162_10015819
398 Ga0163162_10026530
399 Ga0163162_10625123
400 Ga0157375_10163189
401 Ga0163163_10038168
402 Ga0163163_10131085
403 Ga0157377_10013089
404 Ga0157377_10113379
405 Ga0157377_10141842
406 Ga0157379_10077765
407 Ga0157376_10040634
408 Ga0157376_10085337
409 Ga0163161_10001678
410 Ga0207642_10036868
411 Ga0207643_10017042
412 Ga0207643_10063664
413 Ga0207684_10050933
414 Ga0207684_10140191
415 Ga0207684_10173597
416 Ga0207654_10110847
417 Ga0207707_10018656
418 Ga0207707_10558787
419 Ga0207660_10013566
420 Ga0207662_10007300
421 Ga0207662_10013507
422 Ga0207646_10129578
423 Ga0207646_10501321
424 Ga0207681_10213580
425 Ga0207650_10260197
426 Ga0207650_10389262
427 Ga0207687_10030951
428 Ga0207644_10528338
429 Ga0207686_10000085
430 Ga0207686_10255975
431 Ga0207709_10061573
432 Ga0207709_10741042
433 Ga0207670_10056139
434 Ga0207670_10468603
435 Ga0207704_10079082
436 Ga0207691_10029596
437 Ga0207711_10070242
438 Ga0207689_10047836
439 Ga0207689_10117457
440 Ga0207712_10197426
441 Ga0207640_10145155
442 Ga0207703_10178705
443 Ga0207708_10071278
444 Ga0207641_10309993
445 Ga0207641_11224423
446 Ga0207648_10056112
447 Ga0207676_10063861
448 Ga0207676_10375434
449 Ga0207674_10168643
450 Ga0207675_100002975
451 Ga0207675_100038451
452 Ga0207675_100102600
453 Ga0207675_100217924
454 Ga0207683_10414368
455 Ga0207683_10447776
456 Ga0268265_10095532
457 Ga0268265_10227624
458 Ga0268264_10143191
459 Ga0268264_10164751
460 Ga0268264_10291782
461 Ga0307408_100483775
462 Ga0307412_10062576
463 Ga0307411_10078270
464 Ga0307415_100270148
465 Ga0395905_0458004
466 Ga0439448_0002217
467 Ga0439462_0032100
468 Ga0439458_0004960
469 Ga0496113_0676352
470 Ga0501296_008954
471 Ga0501297_008283
472 Ga0501298_005987
473 Ga0501298_007646
474 Ga0501299_002111
475 Ga0501299_021859
476 Ga0501300_018231
477 Ga0501039_0206167
478 Ga0501071_0202272
479 Ga0501202_020498
480 Ga0501206_030057
481 Ga0501208_006386
482 Ga0501217_002601
483 Ga0501217_063156
484 Ga0501223_007358
485 Ga0501233_008122
486 Ga0501235_001811
487 Ga0501235_006655
488 Ga0501243_004316
489 Ga0501246_001893
490 Ga0501247_011028
491 Ga0501253_014755
492 Ga0501259_006567
493 Ga0501261_001759
494 Ga0501221_054368
495 Ga0501225_0010182
496 Ga0501225_0054054
497 Ga0501225_0055506
498 Ga0501234_002965
499 Ga0501262_011195
500 Ga0501265_004030
501 Ga0501266_003723
502 Ga0501270_003318
503 Ga0501283_001790
504 Ga0501283_007621
505 Ga0501212_001066
506 Ga0501212_023301
507 Ga0501226_012145
508 nmdc:mga05p37_35972_c1
509 nmdc:mga05p37_894367_c1
510 nmdc:mga0qj67_145065_c1
511 nmdc:mga0n895_83674_c1
512 nmdc:mga0rr50_983_c1
513 nmdc:mga08x19_1875_c1
514 nmdc:mga08x19_3_c1
515 nmdc:mga0a205_278390_c1
516 nmdc:mga0a205_52601_c1
517 Ga0501084_0190947
518 Ga0501082_0136048

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ob6-assembly1.cif.gz_B cpr-c4 - a conserved novel protease from the candidate phyla radiation 0.8906 6 184
7ob7-assembly1.cif.gz_A-2 cpr-c4 - novel protease from the candidate phyla radiation (cpr) 0.879 6 184
7ob6-assembly1.cif.gz_A cpr-c4 - a conserved novel protease from the candidate phyla radiation 0.8691 6 184
7pjo-assembly1.cif.gz_BBB crystal form 3 of cpr-c4: a cysteine protease from the candidate phyla radiation 0.8627 6 184
7pjo-assembly1.cif.gz_AAA crystal form 3 of cpr-c4: a cysteine protease from the candidate phyla radiation 0.8613 6 184
ID Description Score Start End Superfamily
af_Q565B0_54_138_2.10.60.10 Mainly Beta;Ribbon;CD59;CD59 0.8702 76 89 2.10.60.10
af_Q60294_9_243_3.10.620.30 Alpha Beta;Roll;C8orf32 fold; 0.7732 43 101 3.10.620.30
af_Q58678_134_315_3.10.620.30 Alpha Beta;Roll;C8orf32 fold; 0.7574 2 103 3.10.620.30
af_Q556I6_323_487_3.10.620.30 Alpha Beta;Roll;C8orf32 fold; 0.7554 22 103 3.10.620.30
af_A4HRJ6_1964_2102_3.10.620.30 Alpha Beta;Roll;C8orf32 fold; 0.748 19 102 3.10.620.30
ID Description Score Start End GO Terms
AF-A0A2V8NDI7-F1-model_v4 Uncharacterized protein 0.9903 3 105
AF-A0A383F375-F1-model_v4 Transglutaminase-like domain-containing protein 0.9762 6 175
AF-A0A522AZ10-F1-model_v4 Uncharacterized protein 0.9675 1 213 GO:0005737
GO:0045765
AF-A0A535Q042-F1-model_v4 Transglutaminase-like domain-containing protein 0.9648 1 159
AF-A0A127EXU7-F1-model_v4 Transglutaminase-like domain-containing protein 0.9638 7 213

Map