F368637

General Info

Members Datasets Scaffolds Average Seq Length
259 131 518 474

Family's Representative Sequence

Representative Sequence 3300005458|Ga0070681_10181106|Ga0070681_101811062
Length 533
Sequence MSTRDLQGAKKLSSGGDGGVNPRSDGAEAVSGISSRPAIVSLLPPSARIAGLAAFGAALALTGCKPVGPNYKRPAYQAPAVYKDTGATSVVAPPPNPAGGGWSSANPSDGMLKGKWWQIYNDPELNRLEDRIATNNVQLQQAYETYQAARAQAAAVRANLFPVLSSSASVSRSRVSGNRPLAASGSRTTANDFYIAGQASWEPDFWGRVRRGIEAAHANAQATAAQMANVDLSLHAEMATDYFEIRGLDSQEQLLTRTVNDMQHQFDLTEQRLRGGVATESDVALASTQLETTRAQVVDISAAXXXXEHAIATLANYDVSTFTLPAAPLDLPLPKIPTGVPSQLLERRPDISAAERLADAANAQIGIAVSAFYPTITLGGTGGFESSHPGAWIQGPSSLWSLGAQAAELLFDAGQRRAVAEEARHNDLAQAAAYRNTVFQAFNDVEDQLSTLQILEQEAAVEGLAVSAAQNSFAVSNNRYKGGVTSYLEVLTAEATLLDNQRTAIDILTRRFAASVGLVRSLGGGWDATQLPK

Samples

Sample ID Description Type Environment
1 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
27 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
28 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
29 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
30 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
31 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
32 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
33 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
34 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
35 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
39 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
40 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
41 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
42 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
43 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
44 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
45 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
46 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
47 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
48 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
74 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
75 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
76 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
77 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
78 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
79 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
80 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
81 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
82 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
83 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
84 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
85 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
86 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
87 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
88 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
89 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
90 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
91 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
92 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
93 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
94 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
95 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
96 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
97 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
98 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
99 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
100 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
101 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
102 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
103 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
104 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
105 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
106 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
107 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
108 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
109 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
110 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
111 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
112 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
113 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
114 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
115 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
116 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
117 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
118 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
119 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
120 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
121 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
126 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
127 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
128 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
129 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
130 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
131 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.23
Metatranscriptomes 0.77
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.54
Rhizosphere 94.59
Stem 0
Stem Tuber 0
Unclassified 5.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070681_10181106 3300005458 Unclassified 2029
2 rootH2_10040954 3300003320 Bacteria 11636
3 rootH2_10045572 3300003320 Bacteria 5901
4 rootH2_10150537 3300003320 Bacteria 3547
5 rootL2_10037490 3300003322 Bacteria 5191
6 rootL2_10069029 3300003322 Bacteria 2320
7 Ga0065707_10126844 3300005295 Bacteria 1995
8 Ga0070658_10003167 3300005327 Bacteria 13590
9 Ga0070658_10003618 3300005327 Bacteria 12662
10 Ga0070680_100020064 3300005336 Bacteria 5300
11 Ga0070680_100036724 3300005336 Bacteria 3959
12 Ga0070682_100007749 3300005337 Bacteria 6049
13 Ga0070660_100014084 3300005339 Bacteria 5757
14 Ga0070661_100022303 3300005344 Bacteria 4532
15 Ga0070668_100090420 3300005347 Bacteria 2412
16 Ga0070714_100034550 3300005435 Bacteria 4234
17 Ga0070714_100038875 3300005435 Bacteria 4003
18 Ga0070714_100077406 3300005435 Unclassified 2889
19 Ga0070713_100000118 3300005436 Bacteria 51698
20 Ga0070713_100024421 3300005436 Bacteria 4707
21 Ga0070710_10008865 3300005437 Bacteria 4910
22 Ga0070711_100000168 3300005439 Bacteria 35269
23 Ga0070711_100110065 3300005439 Unclassified 2020
24 Ga0070708_100013487 3300005445 Bacteria 6694
25 Ga0070708_100019863 3300005445 Bacteria 5653
26 Ga0070708_100040323 3300005445 Plasmid 4089
27 Ga0070681_10047072 3300005458 Bacteria 4311
28 Ga0070681_10127389 3300005458 Bacteria 2479
29 Ga0070706_100013012 3300005467 Bacteria 7699
30 Ga0070679_100035807 3300005530 Bacteria 4924
31 Ga0070679_100041861 3300005530 Bacteria 4560
32 Ga0070697_100000467 3300005536 Bacteria 30923
33 Ga0068853_100010704 3300005539 Bacteria 7429
34 Ga0070686_100001178 3300005544 Bacteria 14854
35 Ga0070665_100101693 3300005548 Bacteria 2878
36 Ga0068855_100004012 3300005563 Bacteria 17977
37 Ga0068855_100049119 3300005563 Bacteria 4977
38 Ga0068855_100084705 3300005563 Bacteria 3669
39 Ga0068855_100146334 3300005563 Bacteria 2689
40 Ga0068857_100172662 3300005577 Unclassified 1965
41 Ga0068856_100020969 3300005614 Bacteria 6350
42 Ga0068852_100004002 3300005616 Bacteria 10362
43 Ga0068852_100019075 3300005616 Bacteria 5419
44 Ga0068852_100081367 3300005616 Bacteria 2874
45 Ga0068863_100032327 3300005841 Bacteria 4988
46 Ga0070717_10001647 3300006028 Bacteria 15524
47 Ga0070717_10004697 3300006028 Bacteria 9923
48 Ga0070717_10148598 3300006028 Bacteria 2026
49 Ga0070715_10031216 3300006163 Unclassified 2161
50 Ga0070716_100002495 3300006173 Bacteria 8506
51 Ga0070716_100015469 3300006173 Bacteria 3920
52 Ga0070716_100025708 3300006173 Unclassified 3145
53 Ga0070712_100001749 3300006175 Bacteria 13283
54 Ga0070712_100036353 3300006175 Bacteria 3350
55 Ga0075433_10012902 3300006852 Bacteria 6772
56 Ga0075433_10030891 3300006852 Bacteria 4574
57 Ga0075433_10053567 3300006852 Bacteria 3518
58 Ga0075434_100000129 3300006871 Bacteria 45092
59 Ga0075434_100004257 3300006871 Bacteria 12831
60 Ga0075436_100000949 3300006914 Bacteria 19406
61 Ga0075436_100010420 3300006914 Bacteria 6372
62 Ga0075435_100014747 3300007076 Bacteria 5857
63 Ga0075435_100120593 3300007076 Bacteria 2188
64 Ga0099794_10052996 3300007265 Bacteria 1956
65 Ga0105240_10000880 3300009093 Bacteria 53929
66 Ga0105240_10002491 3300009093 Bacteria 29573
67 Ga0105240_10003115 3300009093 Bacteria 26102
68 Ga0105240_10007867 3300009093 Bacteria 15383
69 Ga0105240_10010473 3300009093 Bacteria 13035
70 Ga0105240_10010853 3300009093 Bacteria 12759
71 Ga0105240_10020026 3300009093 Bacteria 8931
72 Ga0105240_10054812 3300009093 Bacteria 4994
73 Ga0105240_10092555 3300009093 Bacteria 3691
74 Ga0105240_10211528 3300009093 Bacteria 2266
75 Ga0105240_10341402 3300009093 Unclassified 1701
76 Ga0114129_10105970 3300009147 Bacteria 3884
77 Ga0105248_10000131 3300009177 Bacteria 87376
78 Ga0105248_10002771 3300009177 Bacteria 19482
79 Ga0105237_10000081 3300009545 Bacteria 127733
80 Ga0105237_10002342 3300009545 Bacteria 23547
81 Ga0105237_10106585 3300009545 Bacteria 2794
82 Ga0105238_10000793 3300009551 Bacteria 32745
83 Ga0105238_10006469 3300009551 Bacteria 11653
84 Ga0105238_10009248 3300009551 Bacteria 9863
85 Ga0105238_10057646 3300009551 Bacteria 3894
86 Ga0105249_10160048 3300009553 Bacteria 2175
87 Ga0105239_10229413 3300010375 Bacteria 2083
88 Ga0157369_10021420 3300013105 Bacteria 7232
89 Ga0157369_10033270 3300013105 Bacteria 5666
90 Ga0157369_10047245 3300013105 Bacteria 4676
91 Ga0157369_10348247 3300013105 Bacteria 1539
92 Ga0157372_10005215 3300013307 Bacteria 13812
93 Ga0157372_10014466 3300013307 Bacteria 8444
94 Ga0157372_10048567 3300013307 Bacteria 4718
95 Ga0157372_10130278 3300013307 Bacteria 2893
96 Ga0157376_10056074 3300014969 Unclassified 3290
97 Ga0213872_10000186 3300021361 Bacteria 55142
98 Ga0213872_10002391 3300021361 Bacteria 11082
99 Ga0213872_10014997 3300021361 Bacteria 3604
100 Ga0213872_10023963 3300021361 Bacteria 2807
101 Ga0228598_1000135 3300024227 Bacteria 12495
102 Ga0207692_10028476 3300025898 Unclassified 2643
103 Ga0207685_10024155 3300025905 Unclassified 2080
104 Ga0207699_10028223 3300025906 Bacteria 3117
105 Ga0207705_10007516 3300025909 Bacteria 8007
106 Ga0207705_10009856 3300025909 Bacteria 6955
107 Ga0207705_10115728 3300025909 Bacteria 1984
108 Ga0207684_10004728 3300025910 Bacteria 12771
109 Ga0207707_10070749 3300025912 Bacteria 3040
110 Ga0207695_10000348 3300025913 Bacteria 107006
111 Ga0207695_10011129 3300025913 Bacteria 10919
112 Ga0207695_10022430 3300025913 Bacteria 7165
113 Ga0207695_10084021 3300025913 Bacteria 3215
114 Ga0207695_10124995 3300025913 Bacteria 2536
115 Ga0207695_10142628 3300025913 Bacteria 2342
116 Ga0207671_10000077 3300025914 Bacteria 150801
117 Ga0207671_10007230 3300025914 Bacteria 9667
118 Ga0207693_10000353 3300025915 Bacteria 42212
119 Ga0207693_10026761 3300025915 Bacteria 4563
120 Ga0207693_10052345 3300025915 Bacteria 3202
121 Ga0207663_10016472 3300025916 Bacteria 4100
122 Ga0207660_10021863 3300025917 Bacteria 4305
123 Ga0207657_10037847 3300025919 Bacteria 4303
124 Ga0207652_10015223 3300025921 Bacteria 6241
125 Ga0207652_10039190 3300025921 Bacteria 4021
126 Ga0207652_10064540 3300025921 Bacteria 3168
127 Ga0207694_10005740 3300025924 Bacteria 9508
128 Ga0207700_10000210 3300025928 Bacteria 34895
129 Ga0207664_10022019 3300025929 Bacteria 4750
130 Ga0207664_10031632 3300025929 Bacteria 4050
131 Ga0207664_10042801 3300025929 Bacteria 3538
132 Ga0207690_10021575 3300025932 Bacteria 3996
133 Ga0207690_10059200 3300025932 Bacteria 2595
134 Ga0207665_10000108 3300025939 Bacteria 54035
135 Ga0207665_10000267 3300025939 Bacteria 36262
136 Ga0207665_10024734 3300025939 Bacteria 3961
137 Ga0207665_10031636 3300025939 Bacteria 3501
138 Ga0207665_10032747 3300025939 Bacteria 3442
139 Ga0207711_10000010 3300025941 Bacteria 557970
140 Ga0207711_10013362 3300025941 Bacteria 6820
141 Ga0207667_10000760 3300025949 Bacteria 41939
142 Ga0207667_10007364 3300025949 Bacteria 13242
143 Ga0207667_10019141 3300025949 Bacteria 7656
144 Ga0207639_10006560 3300026041 Bacteria 7913
145 Ga0207702_10078912 3300026078 Bacteria 2851
146 Ga0207698_10006506 3300026142 Bacteria 7296
147 Ga0209588_1014197 3300027671 Unclassified 2437
148 Ga0268266_10005001 3300028379 Bacteria 12525
149 Ga0268266_10017234 3300028379 Bacteria 6169
150 Ga0265318_10007524 3300028577 Bacteria 4916
151 Ga0265338_10003090 3300028800 Bacteria 23880
152 Ga0265338_10005005 3300028800 Bacteria 17523
153 Ga0265338_10022194 3300028800 Bacteria 6582
154 Ga0265338_10030226 3300028800 Bacteria 5345
155 Ga0265338_10087741 3300028800 Bacteria 2583
156 Ga0265760_10000182 3300031090 Bacteria 16421
157 Ga0265760_10017701 3300031090 Bacteria 2047
158 Ga0265330_10000109 3300031235 Bacteria 69230
159 Ga0265330_10000843 3300031235 Bacteria 19210
160 Ga0265328_10000319 3300031239 Bacteria 22450
161 Ga0265328_10003262 3300031239 Bacteria 7190
162 Ga0265328_10015093 3300031239 Bacteria 3032
163 Ga0265320_10005649 3300031240 Bacteria 7986
164 Ga0265325_10003400 3300031241 Bacteria 10400
165 Ga0265325_10007040 3300031241 Bacteria 6780
166 Ga0265325_10018358 3300031241 Bacteria 3877
167 Ga0265340_10010054 3300031247 Bacteria 5067
168 Ga0265340_10012265 3300031247 Bacteria 4528
169 Ga0265340_10014874 3300031247 Bacteria 4052
170 Ga0265339_10000309 3300031249 Bacteria 39911
171 Ga0265339_10000818 3300031249 Bacteria 24003
172 Ga0265339_10001396 3300031249 Bacteria 17979
173 Ga0265339_10002368 3300031249 Bacteria 13534
174 Ga0265339_10011492 3300031249 Bacteria 5447
175 Ga0265339_10012175 3300031249 Bacteria 5263
176 Ga0265339_10025638 3300031249 Bacteria 3382
177 Ga0265339_10073108 3300031249 Bacteria 1823
178 Ga0265327_10000890 3300031251 Bacteria 44050
179 Ga0265316_10000987 3300031344 Bacteria 30900
180 Ga0265316_10009228 3300031344 Bacteria 9081
181 Ga0265316_10010712 3300031344 Bacteria 8331
182 Ga0265316_10016197 3300031344 Bacteria 6476
183 Ga0265316_10019561 3300031344 Bacteria 5784
184 Ga0265316_10119609 3300031344 Bacteria 1990
185 Ga0265313_10002847 3300031595 Bacteria 14516
186 Ga0265313_10003484 3300031595 Bacteria 12697
187 Ga0265313_10015435 3300031595 Bacteria 4446
188 Ga0265313_10020125 3300031595 Bacteria 3690
189 Ga0265314_10000027 3300031711 Bacteria 278331
190 Ga0265314_10002531 3300031711 Bacteria 18592
191 Ga0265314_10042575 3300031711 Bacteria 3237
192 Ga0265314_10061854 3300031711 Unclassified 2547
193 Ga0265342_10000383 3300031712 Bacteria 48973
194 Ga0265342_10002309 3300031712 Bacteria 16578
195 Ga0265342_10002457 3300031712 Bacteria 15975
196 Ga0265342_10002776 3300031712 Bacteria 14831
197 Ga0265342_10003942 3300031712 Bacteria 11903
198 Ga0265342_10006105 3300031712 Bacteria 9026
199 Ga0265342_10054831 3300031712 Bacteria 2368
200 Ga0265342_10089295 3300031712 Bacteria 1769
201 Ga0373955_0001154 3300035172 Bacteria 11204
202 Ga0373942_0006394 3300035207 Bacteria 2720
203 Ga0373937_0004479 3300036401 Bacteria 11864
204 Ga0436365_0125936 3300039437 Bacteria 1987
205 Ga0436360_0487763 3300039438 Bacteria 13224
206 Ga0436361_0026290 3300039447 Bacteria 20885
207 Ga0436361_0048586 3300039447 Bacteria 11646
208 Ga0436361_0496449 3300039447 Bacteria 2124
209 Ga0436361_0507643 3300039447 Bacteria 24043
210 Ga0436361_0900144 3300039447 Bacteria 143515
211 Ga0439448_0022465 3300042005 Bacteria 1961
212 Ga0466969_0007757 3300044656 Bacteria 5706
213 Ga0453683_0058903 3300044673 Bacteria 2402
214 Ga0466966_0012263 3300044684 Bacteria 5678
215 Ga0466966_0027157 3300044684 Bacteria 3733
216 Ga0466961_0002934 3300044693 Bacteria 10591
217 Ga0466971_0056908 3300044719 Bacteria 1764
218 Ga0466970_0063455 3300044765 Bacteria 1980
219 Ga0495603_0015966 3300046455 Bacteria 4539
220 Ga0495629_0037934 3300046459 Bacteria 3396
221 Ga0495638_0000073 3300046460 Bacteria 164378
222 Ga0495580_0000470 3300046472 Bacteria 33520
223 Ga0495580_0002438 3300046472 Bacteria 16262
224 Ga0495580_0004286 3300046472 Bacteria 11997
225 Ga0495594_0023814 3300046499 Bacteria 3283
226 Ga0495583_0000087 3300046506 Bacteria 164974
227 Ga0495630_0089231 3300046517 Bacteria 2329
228 Ga0495648_0000049 3300046524 Bacteria 164366
229 Ga0495622_0001121 3300046557 Bacteria 14019
230 Ga0495659_0033727 3300046664 Unclassified 1798
231 Ga0495658_0016180 3300046683 Bacteria 3839
232 Ga0495671_0000042 3300046692 Bacteria 165201
233 Ga0495649_0009698 3300046694 Bacteria 5706
234 Ga0495672_0005793 3300047320 Bacteria 9708
235 Ga0495673_0000111 3300047469 Bacteria 164974
236 Ga0496100_0070311 3300048903 Bacteria 2334
237 Ga0496106_0000140 3300048909 Bacteria 53893
238 Ga0496112_0234727 3300048915 Bacteria 1788
239 Ga0496115_0002037 3300048918 Bacteria 14464
240 Ga0496121_0003291 3300048924 Bacteria 23204
241 Ga0496126_0000122 3300048929 Bacteria 182785
242 Ga0496126_0002356 3300048929 Bacteria 25785
243 Ga0496126_0005114 3300048929 Bacteria 15200
244 Ga0501034_0026386 3300049571 Bacteria 5916
245 Ga0501037_0102760 3300049573 Bacteria 2061
246 Ga0501038_0039026 3300049574 Bacteria 4156
247 Ga0501047_0014252 3300049581 Bacteria 7559
248 Ga0501080_0116901 3300049742 Bacteria 2472
249 Ga0501035_0042752 3300049822 Bacteria 4086
250 nmdc:mga05p37_61430_c2 3300050507 Bacteria 3637
251 nmdc:mga0n895_11835_c1 3300050512 Bacteria 7803
252 nmdc:mga0n895_278_c1 3300050512 Bacteria 33673
253 nmdc:mga0rr50_2608_c1 3300050513 Bacteria 10219
254 nmdc:mga0rr50_4209_c1 3300050513 Bacteria 8414
255 nmdc:mga0rr50_80144_c1 3300050513 Bacteria 2516
256 nmdc:mga08x19_2202_c1 3300050514 Bacteria 11919
257 nmdc:mga0a205_21330_c1 3300050515 Bacteria 6129
258 nmdc:mga0a205_58154_c1 3300050515 Bacteria 3734
259 nmdc:mga0a205_62346_c1 3300050515 Bacteria 3602
260 Ga0070681_10181106
261 rootH2_10040954
262 rootH2_10045572
263 rootH2_10150537
264 rootL2_10037490
265 rootL2_10069029
266 Ga0065707_10126844
267 Ga0070658_10003167
268 Ga0070658_10003618
269 Ga0070680_100020064
270 Ga0070680_100036724
271 Ga0070682_100007749
272 Ga0070660_100014084
273 Ga0070661_100022303
274 Ga0070668_100090420
275 Ga0070714_100034550
276 Ga0070714_100038875
277 Ga0070714_100077406
278 Ga0070713_100000118
279 Ga0070713_100024421
280 Ga0070710_10008865
281 Ga0070711_100000168
282 Ga0070711_100110065
283 Ga0070708_100013487
284 Ga0070708_100019863
285 Ga0070708_100040323
286 Ga0070681_10047072
287 Ga0070681_10127389
288 Ga0070706_100013012
289 Ga0070679_100035807
290 Ga0070679_100041861
291 Ga0070697_100000467
292 Ga0068853_100010704
293 Ga0070686_100001178
294 Ga0070665_100101693
295 Ga0068855_100004012
296 Ga0068855_100049119
297 Ga0068855_100084705
298 Ga0068855_100146334
299 Ga0068857_100172662
300 Ga0068856_100020969
301 Ga0068852_100004002
302 Ga0068852_100019075
303 Ga0068852_100081367
304 Ga0068863_100032327
305 Ga0070717_10001647
306 Ga0070717_10004697
307 Ga0070717_10148598
308 Ga0070715_10031216
309 Ga0070716_100002495
310 Ga0070716_100015469
311 Ga0070716_100025708
312 Ga0070712_100001749
313 Ga0070712_100036353
314 Ga0075433_10012902
315 Ga0075433_10030891
316 Ga0075433_10053567
317 Ga0075434_100000129
318 Ga0075434_100004257
319 Ga0075436_100000949
320 Ga0075436_100010420
321 Ga0075435_100014747
322 Ga0075435_100120593
323 Ga0099794_10052996
324 Ga0105240_10000880
325 Ga0105240_10002491
326 Ga0105240_10003115
327 Ga0105240_10007867
328 Ga0105240_10010473
329 Ga0105240_10010853
330 Ga0105240_10020026
331 Ga0105240_10054812
332 Ga0105240_10092555
333 Ga0105240_10211528
334 Ga0105240_10341402
335 Ga0114129_10105970
336 Ga0105248_10000131
337 Ga0105248_10002771
338 Ga0105237_10000081
339 Ga0105237_10002342
340 Ga0105237_10106585
341 Ga0105238_10000793
342 Ga0105238_10006469
343 Ga0105238_10009248
344 Ga0105238_10057646
345 Ga0105249_10160048
346 Ga0105239_10229413
347 Ga0157369_10021420
348 Ga0157369_10033270
349 Ga0157369_10047245
350 Ga0157369_10348247
351 Ga0157372_10005215
352 Ga0157372_10014466
353 Ga0157372_10048567
354 Ga0157372_10130278
355 Ga0157376_10056074
356 Ga0213872_10000186
357 Ga0213872_10002391
358 Ga0213872_10014997
359 Ga0213872_10023963
360 Ga0228598_1000135
361 Ga0207692_10028476
362 Ga0207685_10024155
363 Ga0207699_10028223
364 Ga0207705_10007516
365 Ga0207705_10009856
366 Ga0207705_10115728
367 Ga0207684_10004728
368 Ga0207707_10070749
369 Ga0207695_10000348
370 Ga0207695_10011129
371 Ga0207695_10022430
372 Ga0207695_10084021
373 Ga0207695_10124995
374 Ga0207695_10142628
375 Ga0207671_10000077
376 Ga0207671_10007230
377 Ga0207693_10000353
378 Ga0207693_10026761
379 Ga0207693_10052345
380 Ga0207663_10016472
381 Ga0207660_10021863
382 Ga0207657_10037847
383 Ga0207652_10015223
384 Ga0207652_10039190
385 Ga0207652_10064540
386 Ga0207694_10005740
387 Ga0207700_10000210
388 Ga0207664_10022019
389 Ga0207664_10031632
390 Ga0207664_10042801
391 Ga0207690_10021575
392 Ga0207690_10059200
393 Ga0207665_10000108
394 Ga0207665_10000267
395 Ga0207665_10024734
396 Ga0207665_10031636
397 Ga0207665_10032747
398 Ga0207711_10000010
399 Ga0207711_10013362
400 Ga0207667_10000760
401 Ga0207667_10007364
402 Ga0207667_10019141
403 Ga0207639_10006560
404 Ga0207702_10078912
405 Ga0207698_10006506
406 Ga0209588_1014197
407 Ga0268266_10005001
408 Ga0268266_10017234
409 Ga0265318_10007524
410 Ga0265338_10003090
411 Ga0265338_10005005
412 Ga0265338_10022194
413 Ga0265338_10030226
414 Ga0265338_10087741
415 Ga0265760_10000182
416 Ga0265760_10017701
417 Ga0265330_10000109
418 Ga0265330_10000843
419 Ga0265328_10000319
420 Ga0265328_10003262
421 Ga0265328_10015093
422 Ga0265320_10005649
423 Ga0265325_10003400
424 Ga0265325_10007040
425 Ga0265325_10018358
426 Ga0265340_10010054
427 Ga0265340_10012265
428 Ga0265340_10014874
429 Ga0265339_10000309
430 Ga0265339_10000818
431 Ga0265339_10001396
432 Ga0265339_10002368
433 Ga0265339_10011492
434 Ga0265339_10012175
435 Ga0265339_10025638
436 Ga0265339_10073108
437 Ga0265327_10000890
438 Ga0265316_10000987
439 Ga0265316_10009228
440 Ga0265316_10010712
441 Ga0265316_10016197
442 Ga0265316_10019561
443 Ga0265316_10119609
444 Ga0265313_10002847
445 Ga0265313_10003484
446 Ga0265313_10015435
447 Ga0265313_10020125
448 Ga0265314_10000027
449 Ga0265314_10002531
450 Ga0265314_10042575
451 Ga0265314_10061854
452 Ga0265342_10000383
453 Ga0265342_10002309
454 Ga0265342_10002457
455 Ga0265342_10002776
456 Ga0265342_10003942
457 Ga0265342_10006105
458 Ga0265342_10054831
459 Ga0265342_10089295
460 Ga0373955_0001154
461 Ga0373942_0006394
462 Ga0373937_0004479
463 Ga0436365_0125936
464 Ga0436360_0487763
465 Ga0436361_0026290
466 Ga0436361_0048586
467 Ga0436361_0496449
468 Ga0436361_0507643
469 Ga0436361_0900144
470 Ga0439448_0022465
471 Ga0466969_0007757
472 Ga0453683_0058903
473 Ga0466966_0012263
474 Ga0466966_0027157
475 Ga0466961_0002934
476 Ga0466971_0056908
477 Ga0466970_0063455
478 Ga0495603_0015966
479 Ga0495629_0037934
480 Ga0495638_0000073
481 Ga0495580_0000470
482 Ga0495580_0002438
483 Ga0495580_0004286
484 Ga0495594_0023814
485 Ga0495583_0000087
486 Ga0495630_0089231
487 Ga0495648_0000049
488 Ga0495622_0001121
489 Ga0495659_0033727
490 Ga0495658_0016180
491 Ga0495671_0000042
492 Ga0495649_0009698
493 Ga0495672_0005793
494 Ga0495673_0000111
495 Ga0496100_0070311
496 Ga0496106_0000140
497 Ga0496112_0234727
498 Ga0496115_0002037
499 Ga0496121_0003291
500 Ga0496126_0000122
501 Ga0496126_0002356
502 Ga0496126_0005114
503 Ga0501034_0026386
504 Ga0501037_0102760
505 Ga0501038_0039026
506 Ga0501047_0014252
507 Ga0501080_0116901
508 Ga0501035_0042752
509 nmdc:mga05p37_61430_c2
510 nmdc:mga0n895_11835_c1
511 nmdc:mga0n895_278_c1
512 nmdc:mga0rr50_2608_c1
513 nmdc:mga0rr50_4209_c1
514 nmdc:mga0rr50_80144_c1
515 nmdc:mga08x19_2202_c1
516 nmdc:mga0a205_21330_c1
517 nmdc:mga0a205_58154_c1
518 nmdc:mga0a205_62346_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02321

OEP

Outer membrane efflux protein

339

523

0.96

PF02321

OEP

Outer membrane efflux protein

125

316

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
1yc9-assembly1.cif.gz_A the crystal structure of the outer membrane protein vcec from the bacterial pathogen vibrio cholerae at 1.8 resolution 0.9038 68 488
1yc9-assembly1.cif.gz_A the crystal structure of the outer membrane protein vcec from the bacterial pathogen vibrio cholerae at 1.8 resolution 0.8996 68 488
4k7r-assembly1.cif.gz_A crystal structures of cusc review conformational changes accompanying folding and transmembrane channel formation 0.8893 37 486
5azp-assembly1.cif.gz_A crystal structure of a membrane protein from pseudomonas aeruginosa 0.8863 34 488
5azs-assembly1.cif.gz_B crystal structure of a membrane protein from pseudomonas aeruginosa 0.885 34 484
ID Description Score Start End Superfamily
1yc9A01 Mainly Alpha;Up-down Bundle;Outer membrane efflux proteins (OEP);Outer membrane efflux proteins (OEP) 0.9315 68 487 1.20.1600.10
1yc9A01 Mainly Alpha;Up-down Bundle;Outer membrane efflux proteins (OEP);Outer membrane efflux proteins (OEP) 0.9261 68 487 1.20.1600.10
4k7rA01 Mainly Alpha;Up-down Bundle;Outer membrane efflux proteins (OEP);Outer membrane efflux proteins (OEP) 0.9085 37 486 1.20.1600.10
af_P75830_95_182_6.10.140.1990 Special;Helix non-globular;Helix Hairpins; 0.9045 401 482 6.10.140.1990
5iuyA01 Mainly Alpha;Up-down Bundle;Outer membrane efflux proteins (OEP);Outer membrane efflux proteins (OEP) 0.9041 34 487 1.20.1600.10
ID Description Score Start End GO Terms
AF-A0A259D0E5-F1-model_v4 deleted 0.9448 160 493
AF-A0A3P3ZPY6-F1-model_v4 Outer membrane protein OprM 0.9426 162 494 GO:0015562
GO:0016020
AF-A0A259D0E5-F1-model_v4 deleted 0.9312 160 493
AF-A0A3A1VMU5-F1-model_v4 deleted 0.9286 286 475
AF-A0A847E067-F1-model_v4 Efflux transporter outer membrane subunit 0.9245 144 490 GO:0005886
GO:0015562

Map