F368623

General Info

Members Datasets Scaffolds Average Seq Length
259 138 518 183

Family's Representative Sequence

Representative Sequence 3300005439|Ga0070711_100276817|Ga0070711_1002768172
Length 195
Sequence MRIFIALDIPPEIRARMTEYMERARSLAPGARWARVEGLHVTLKFVGPATDGLVEEMKTALASIKTTPFPVKFEGVGFFPNAKAARVFWIGVHGGEALPRLASAVDAALATLGVAREEKAYHPHLTLARASSHPLRELQPLLSDPPPAPHHAQNPRALGAPPQFGTMTAREFFLYHSQPQKGGSKYTKLERFGLE

Samples

Sample ID Description Type Environment
1 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
2 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
11 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
12 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
13 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
17 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
20 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
23 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
24 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
25 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
26 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
27 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
28 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
29 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
30 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
31 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
32 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
33 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
34 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
35 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
36 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
37 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
38 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
39 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
40 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
41 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
42 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
43 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
44 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
63 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
64 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
65 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
66 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
67 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
68 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
69 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
70 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
71 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
72 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
73 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
74 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
75 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
76 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
77 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
78 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
79 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
80 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
81 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
82 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
83 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
84 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
85 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
86 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
87 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
88 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
89 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
90 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
91 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
92 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
93 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
94 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
95 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
96 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
97 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
98 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
99 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
100 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
101 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
102 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
103 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
104 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
105 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
106 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
107 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
108 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
109 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
110 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
111 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
112 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
113 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
114 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
115 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
116 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
117 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
118 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
119 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
120 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
121 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
122 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
123 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
124 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
125 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
126 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
127 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
128 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
129 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
130 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
131 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
132 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
133 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
134 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
135 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
136 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
137 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
138 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.46
Metatranscriptomes 1.54
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.25
Rhizosphere 95.75
Stem 0
Stem Tuber 0
Unclassified 27.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070711_100276817 3300005439 Bacteria 1326
2 Ga0058863_10065671 3300004799 Bacteria 2109
3 Ga0070658_10819471 3300005327 Unclassified 809
4 Ga0070683_100133903 3300005329 Bacteria 2346
5 Ga0070680_100001825 3300005336 Bacteria 15645
6 Ga0068868_100069458 3300005338 Bacteria 2807
7 Ga0070709_10156699 3300005434 Bacteria 1579
8 Ga0070714_100236017 3300005435 Unclassified 1686
9 Ga0070713_100056266 3300005436 Unclassified 3272
10 Ga0070713_100086047 3300005436 Bacteria 2694
11 Ga0070713_100679880 3300005436 Unclassified 982
12 Ga0070711_100018601 3300005439 Unclassified 4440
13 Ga0070711_100243577 3300005439 Bacteria 1407
14 Ga0070681_10002097 3300005458 Bacteria 18110
15 Ga0070681_10265031 3300005458 Bacteria 1630
16 Ga0070707_100000399 3300005468 Bacteria 42939
17 Ga0070707_100669800 3300005468 Unclassified 1000
18 Ga0070698_100105457 3300005471 Bacteria 2788
19 Ga0070699_101231160 3300005518 Unclassified 687
20 Ga0070679_100007324 3300005530 Bacteria 10309
21 Ga0070679_100131701 3300005530 Bacteria 2481
22 Ga0070684_100379078 3300005535 Bacteria 1302
23 Ga0068853_100089645 3300005539 Bacteria 2701
24 Ga0068853_100437122 3300005539 Bacteria 1229
25 Ga0070693_100052898 3300005547 Unclassified 2330
26 Ga0068855_100344054 3300005563 Bacteria 1644
27 Ga0070664_100868494 3300005564 Bacteria 845
28 Ga0068854_100026694 3300005578 Bacteria 3971
29 Ga0068854_100557568 3300005578 Unclassified 973
30 Ga0068856_100549909 3300005614 Bacteria 1175
31 Ga0068856_100731928 3300005614 Unclassified 1009
32 Ga0068852_100022343 3300005616 Bacteria 5072
33 Ga0068852_100175530 3300005616 Bacteria 2012
34 Ga0068851_10305955 3300005834 Unclassified 915
35 Ga0070717_10048509 3300006028 Bacteria 3483
36 Ga0070717_10051582 3300006028 Bacteria 3386
37 Ga0070717_10331243 3300006028 Bacteria 1358
38 Ga0070716_101035406 3300006173 Bacteria 651
39 Ga0070712_100033468 3300006175 Bacteria 3478
40 Ga0070712_100060228 3300006175 Bacteria 2676
41 Ga0099794_10003916 3300007265 Bacteria 5769
42 Ga0099795_10098415 3300007788 Bacteria 1144
43 Ga0105240_10059254 3300009093 Bacteria 4779
44 Ga0105240_10297632 3300009093 Bacteria 1847
45 Ga0105240_10647715 3300009093 Bacteria 1158
46 Ga0105240_11181574 3300009093 Bacteria 811
47 Ga0105245_10007107 3300009098 Bacteria 9822
48 Ga0105237_10148691 3300009545 Bacteria 2338
49 Ga0105237_11008678 3300009545 Unclassified 839
50 Ga0105238_10025244 3300009551 Bacteria 6057
51 Ga0105238_10252541 3300009551 Bacteria 1742
52 Ga0105239_10355056 3300010375 Bacteria 1655
53 Ga0157373_10642645 3300013100 Unclassified 774
54 Ga0157370_10227161 3300013104 Bacteria 1728
55 Ga0157369_10117175 3300013105 Bacteria 2827
56 Ga0157369_10177137 3300013105 Bacteria 2244
57 Ga0157369_10286803 3300013105 Bacteria 1714
58 Ga0157369_10673792 3300013105 Bacteria 1066
59 Ga0157374_10504441 3300013296 Bacteria 1215
60 Ga0157378_10003043 3300013297 Bacteria 14907
61 Ga0157372_10269811 3300013307 Bacteria 1977
62 Ga0157372_11034522 3300013307 Unclassified 951
63 Ga0157372_12110734 3300013307 Unclassified 647
64 Ga0157376_10232013 3300014969 Bacteria 1715
65 Ga0206356_10116366 3300020070 Unclassified 763
66 Ga0206350_11471005 3300020080 Unclassified 909
67 Ga0228598_1008606 3300024227 Bacteria 2056
68 Ga0207692_10535586 3300025898 Unclassified 747
69 Ga0207685_10128761 3300025905 Bacteria 1121
70 Ga0207707_10003451 3300025912 Bacteria 14016
71 Ga0207707_10074035 3300025912 Bacteria 2970
72 Ga0207707_10279209 3300025912 Bacteria 1447
73 Ga0207707_10367501 3300025912 Bacteria 1238
74 Ga0207695_10111674 3300025913 Bacteria 2712
75 Ga0207695_10683477 3300025913 Unclassified 907
76 Ga0207695_10787736 3300025913 Unclassified 831
77 Ga0207671_10077997 3300025914 Bacteria 2480
78 Ga0207693_10010397 3300025915 Bacteria 7556
79 Ga0207693_10273995 3300025915 Bacteria 1322
80 Ga0207693_10602644 3300025915 Unclassified 855
81 Ga0207663_10014771 3300025916 Bacteria 4288
82 Ga0207663_10689876 3300025916 Unclassified 808
83 Ga0207660_10007193 3300025917 Bacteria 7204
84 Ga0207660_10086802 3300025917 Bacteria 2311
85 Ga0207652_10002802 3300025921 Bacteria 14627
86 Ga0207646_10000294 3300025922 Bacteria 67765
87 Ga0207694_10153633 3300025924 Bacteria 1855
88 Ga0207694_10187479 3300025924 Bacteria 1679
89 Ga0207694_10389793 3300025924 Bacteria 1157
90 Ga0207687_10001223 3300025927 Bacteria 17577
91 Ga0207687_10106662 3300025927 Unclassified 2071
92 Ga0207700_10400299 3300025928 Bacteria 1203
93 Ga0207700_10688678 3300025928 Unclassified 912
94 Ga0207700_10689945 3300025928 Unclassified 911
95 Ga0207700_10691012 3300025928 Unclassified 910
96 Ga0207700_10935674 3300025928 Unclassified 776
97 Ga0207665_10280317 3300025939 Unclassified 1240
98 Ga0207661_10205738 3300025944 Bacteria 1732
99 Ga0207667_10833287 3300025949 Bacteria 917
100 Ga0207639_10027889 3300026041 Bacteria 4117
101 Ga0207639_10074206 3300026041 Bacteria 2670
102 Ga0207639_10635329 3300026041 Unclassified 987
103 Ga0207698_10010175 3300026142 Bacteria 6029
104 Ga0265760_10073479 3300031090 Bacteria 1051
105 Ga0265339_10135066 3300031249 Bacteria 1259
106 Ga0373926_0061022 3300035083 Bacteria 1375
107 Ga0373926_0065117 3300035083 Bacteria 1332
108 Ga0373944_0060121 3300035089 Unclassified 1217
109 Ga0373944_0156986 3300035089 Bacteria 805
110 Ga0373923_0002976 3300035111 Bacteria 5344
111 Ga0373923_0043253 3300035111 Bacteria 1864
112 Ga0373923_0112215 3300035111 Bacteria 1211
113 Ga0373923_0258491 3300035111 Unclassified 816
114 Ga0373936_0106291 3300035113 Unclassified 1188
115 Ga0373945_0085242 3300035116 Unclassified 1216
116 Ga0373954_0061033 3300035118 Bacteria 1779
117 Ga0373956_0008468 3300035119 Bacteria 4165
118 Ga0373957_0025249 3300035120 Unclassified 2140
119 Ga0373946_0010823 3300035171 Bacteria 3388
120 Ga0373946_0069047 3300035171 Unclassified 1521
121 Ga0373955_0033462 3300035172 Bacteria 2707
122 Ga0373955_0094231 3300035172 Bacteria 1711
123 Ga0373955_0313455 3300035172 Unclassified 947
124 Ga0373924_0066133 3300035410 Bacteria 1519
125 Ga0373935_0003038 3300035692 Bacteria 9680
126 Ga0373935_0022869 3300035692 Bacteria 3838
127 Ga0373935_0183007 3300035692 Unclassified 1439
128 Ga0373935_0233209 3300035692 Bacteria 1282
129 Ga0373935_0350344 3300035692 Unclassified 1052
130 Ga0373935_0945003 3300035692 Bacteria 639
131 Ga0373927_0008613 3300035695 Bacteria 6855
132 Ga0373927_0032761 3300035695 Bacteria 3384
133 Ga0373927_0719389 3300035695 Bacteria 660
134 Ga0373927_0746698 3300035695 Unclassified 646
135 Ga0373933_0051832 3300035724 Bacteria 2454
136 Ga0373947_0005465 3300035725 Bacteria 7416
137 Ga0373947_0024690 3300035725 Bacteria 3503
138 Ga0373937_0000422 3300036401 Bacteria 39461
139 Ga0373937_0006590 3300036401 Bacteria 10027
140 Ga0373937_0024980 3300036401 Bacteria 5393
141 Ga0373937_0057429 3300036401 Bacteria 3575
142 Ga0373937_0074013 3300036401 Unclassified 3143
143 Ga0373925_0304508 3300037068 Bacteria 1287
144 Ga0373925_0343195 3300037068 Bacteria 1211
145 Ga0373925_0527370 3300037068 Bacteria 970
146 Ga0395898_0697082 3300037466 Bacteria 957
147 Ga0395898_0842339 3300037466 Unclassified 856
148 Ga0451577_0037371 3300042876 Bacteria 4371
149 Ga0453683_0034003 3300044673 Bacteria 3214
150 Ga0466963_0004656 3300044694 Bacteria 8004
151 Ga0453684_0007931 3300044712 Bacteria 19259
152 Ga0466957_0000025 3300044842 Bacteria 56192
153 Ga0451576_0051573 3300045051 Bacteria 4313
154 Ga0466958_0463252 3300045836 Unclassified 821
155 Ga0495592_0017635 3300046454 Bacteria 5425
156 Ga0495651_0003842 3300046462 Bacteria 11479
157 Ga0495651_0016480 3300046462 Bacteria 5724
158 Ga0495651_0104912 3300046462 Bacteria 2097
159 Ga0495651_0703776 3300046462 Unclassified 629
160 Ga0495653_0000997 3300046463 Bacteria 21811
161 Ga0495653_0062068 3300046463 Unclassified 2825
162 Ga0495580_0011042 3300046472 Bacteria 7001
163 Ga0495580_0072686 3300046472 Bacteria 2401
164 Ga0495580_0255768 3300046472 Unclassified 1198
165 Ga0495582_0052703 3300046473 Bacteria 2243
166 Ga0495582_0237849 3300046473 Bacteria 1043
167 Ga0495639_0048216 3300046475 Bacteria 1931
168 Ga0495639_0073441 3300046475 Bacteria 1583
169 Ga0495664_0162410 3300046477 Unclassified 1355
170 Ga0495664_0434007 3300046477 Bacteria 787
171 Ga0495608_0018110 3300046511 Bacteria 4864
172 Ga0495608_0021409 3300046511 Unclassified 4437
173 Ga0495608_0040729 3300046511 Bacteria 3111
174 Ga0495608_0230763 3300046511 Bacteria 1159
175 Ga0495618_0004059 3300046514 Bacteria 9028
176 Ga0495618_0392354 3300046514 Unclassified 850
177 Ga0495628_0000713 3300046516 Bacteria 30746
178 Ga0495628_0026452 3300046516 Bacteria 4731
179 Ga0495628_0214668 3300046516 Bacteria 1446
180 Ga0495630_0002995 3300046517 Bacteria 11713
181 Ga0495630_0033347 3300046517 Unclassified 3840
182 Ga0495630_0110985 3300046517 Unclassified 2077
183 Ga0495666_0211461 3300046526 Bacteria 890
184 Ga0495652_0001695 3300046529 Bacteria 23794
185 Ga0495652_0008308 3300046529 Bacteria 9483
186 Ga0495665_0004855 3300046531 Bacteria 7252
187 Ga0495665_0089892 3300046531 Bacteria 1613
188 Ga0495640_0129577 3300046533 Unclassified 1633
189 Ga0495586_0012364 3300046535 Bacteria 4527
190 Ga0495586_0025373 3300046535 Bacteria 3172
191 Ga0495586_0367391 3300046535 Bacteria 827
192 Ga0495586_0738703 3300046535 Unclassified 568
193 Ga0495587_0009037 3300046536 Bacteria 6397
194 Ga0495587_0015185 3300046536 Bacteria 4813
195 Ga0495645_0008638 3300046543 Bacteria 7113
196 Ga0495645_0016623 3300046543 Bacteria 5258
197 Ga0495645_0063019 3300046543 Bacteria 2685
198 Ga0495622_0098326 3300046557 Unclassified 1342
199 Ga0495667_0008038 3300046559 Bacteria 7157
200 Ga0495667_0026479 3300046559 Bacteria 3909
201 Ga0495667_0157053 3300046559 Unclassified 1463
202 Ga0495634_0073314 3300046642 Bacteria 2251
203 Ga0495634_0635536 3300046642 Unclassified 617
204 Ga0495635_0023348 3300046663 Bacteria 4311
205 Ga0495635_0070165 3300046663 Bacteria 2402
206 Ga0495657_0016279 3300046675 Bacteria 5419
207 Ga0495657_0066286 3300046675 Unclassified 2372
208 Ga0495657_0273575 3300046675 Unclassified 1012
209 Ga0495623_0005078 3300046679 Bacteria 8631
210 Ga0495623_0011645 3300046679 Bacteria 5698
211 Ga0495646_0000381 3300046680 Bacteria 23155
212 Ga0495658_0265285 3300046683 Bacteria 1081
213 Ga0495658_0319481 3300046683 Bacteria 984
214 Ga0495613_0084789 3300046689 Unclassified 2300
215 Ga0495613_0194670 3300046689 Unclassified 1431
216 Ga0495624_0006387 3300046690 Bacteria 8365
217 Ga0495600_0007100 3300046809 Bacteria 6845
218 Ga0495581_0039527 3300047315 Unclassified 2731
219 Ga0495604_0009526 3300047317 Bacteria 7679
220 Ga0495604_0059309 3300047317 Bacteria 2933
221 Ga0495604_0116844 3300047317 Bacteria 1935
222 Ga0495604_0743600 3300047317 Unclassified 621
223 Ga0495674_0010043 3300047319 Bacteria 8971
224 Ga0495674_0019430 3300047319 Bacteria 6305
225 Ga0495674_0062413 3300047319 Unclassified 3245
226 Ga0495674_0207483 3300047319 Unclassified 1624
227 Ga0495674_0233935 3300047319 Bacteria 1516
228 Ga0495676_0358440 3300047321 Unclassified 974
229 Ga0495680_0013948 3300047322 Bacteria 6988
230 Ga0495680_0023540 3300047322 Bacteria 5119
231 Ga0495680_0031205 3300047322 Bacteria 4340
232 Ga0495680_0085198 3300047322 Bacteria 2380
233 Ga0495680_0195183 3300047322 Bacteria 1455
234 Ga0495675_0000077 3300047444 Bacteria 68982
235 Ga0495675_0003872 3300047444 Bacteria 9070
236 Ga0495675_0008577 3300047444 Bacteria 6336
237 Ga0495684_0002210 3300047471 Bacteria 15583
238 Ga0495684_0021456 3300047471 Unclassified 4973
239 Ga0495684_0563212 3300047471 Bacteria 774
240 Ga0495593_0003824 3300047673 Bacteria 8991
241 Ga0495602_0020648 3300048088 Bacteria 6505
242 Ga0495602_0045754 3300048088 Bacteria 3958
243 Ga0495602_0353969 3300048088 Bacteria 1059
244 Ga0495602_0706395 3300048088 Unclassified 684
245 Ga0495614_0023066 3300048089 Unclassified 2684
246 Ga0496102_0151105 3300048905 Bacteria 2182
247 Ga0496104_0360802 3300048907 Bacteria 1365
248 Ga0496105_0001170 3300048908 Bacteria 18267
249 Ga0496105_0214757 3300048908 Bacteria 1567
250 Ga0496110_0008846 3300048913 Bacteria 8114
251 Ga0496110_0477294 3300048913 Unclassified 1136
252 Ga0496111_0003483 3300048914 Bacteria 9739
253 Ga0496111_0569432 3300048914 Bacteria 831
254 Ga0496112_0051478 3300048915 Bacteria 4040
255 Ga0496113_0001237 3300048916 Bacteria 14065
256 Ga0496115_0384137 3300048918 Bacteria 1141
257 Ga0495601_0004794 3300053077 Bacteria 7843
258 Ga0495612_0403583 3300053078 Unclassified 621
259 Ga0495619_0731901 3300053085 Unclassified 672
260 Ga0070711_100276817
261 Ga0058863_10065671
262 Ga0070658_10819471
263 Ga0070683_100133903
264 Ga0070680_100001825
265 Ga0068868_100069458
266 Ga0070709_10156699
267 Ga0070714_100236017
268 Ga0070713_100056266
269 Ga0070713_100086047
270 Ga0070713_100679880
271 Ga0070711_100018601
272 Ga0070711_100243577
273 Ga0070681_10002097
274 Ga0070681_10265031
275 Ga0070707_100000399
276 Ga0070707_100669800
277 Ga0070698_100105457
278 Ga0070699_101231160
279 Ga0070679_100007324
280 Ga0070679_100131701
281 Ga0070684_100379078
282 Ga0068853_100089645
283 Ga0068853_100437122
284 Ga0070693_100052898
285 Ga0068855_100344054
286 Ga0070664_100868494
287 Ga0068854_100026694
288 Ga0068854_100557568
289 Ga0068856_100549909
290 Ga0068856_100731928
291 Ga0068852_100022343
292 Ga0068852_100175530
293 Ga0068851_10305955
294 Ga0070717_10048509
295 Ga0070717_10051582
296 Ga0070717_10331243
297 Ga0070716_101035406
298 Ga0070712_100033468
299 Ga0070712_100060228
300 Ga0099794_10003916
301 Ga0099795_10098415
302 Ga0105240_10059254
303 Ga0105240_10297632
304 Ga0105240_10647715
305 Ga0105240_11181574
306 Ga0105245_10007107
307 Ga0105237_10148691
308 Ga0105237_11008678
309 Ga0105238_10025244
310 Ga0105238_10252541
311 Ga0105239_10355056
312 Ga0157373_10642645
313 Ga0157370_10227161
314 Ga0157369_10117175
315 Ga0157369_10177137
316 Ga0157369_10286803
317 Ga0157369_10673792
318 Ga0157374_10504441
319 Ga0157378_10003043
320 Ga0157372_10269811
321 Ga0157372_11034522
322 Ga0157372_12110734
323 Ga0157376_10232013
324 Ga0206356_10116366
325 Ga0206350_11471005
326 Ga0228598_1008606
327 Ga0207692_10535586
328 Ga0207685_10128761
329 Ga0207707_10003451
330 Ga0207707_10074035
331 Ga0207707_10279209
332 Ga0207707_10367501
333 Ga0207695_10111674
334 Ga0207695_10683477
335 Ga0207695_10787736
336 Ga0207671_10077997
337 Ga0207693_10010397
338 Ga0207693_10273995
339 Ga0207693_10602644
340 Ga0207663_10014771
341 Ga0207663_10689876
342 Ga0207660_10007193
343 Ga0207660_10086802
344 Ga0207652_10002802
345 Ga0207646_10000294
346 Ga0207694_10153633
347 Ga0207694_10187479
348 Ga0207694_10389793
349 Ga0207687_10001223
350 Ga0207687_10106662
351 Ga0207700_10400299
352 Ga0207700_10688678
353 Ga0207700_10689945
354 Ga0207700_10691012
355 Ga0207700_10935674
356 Ga0207665_10280317
357 Ga0207661_10205738
358 Ga0207667_10833287
359 Ga0207639_10027889
360 Ga0207639_10074206
361 Ga0207639_10635329
362 Ga0207698_10010175
363 Ga0265760_10073479
364 Ga0265339_10135066
365 Ga0373926_0061022
366 Ga0373926_0065117
367 Ga0373944_0060121
368 Ga0373944_0156986
369 Ga0373923_0002976
370 Ga0373923_0043253
371 Ga0373923_0112215
372 Ga0373923_0258491
373 Ga0373936_0106291
374 Ga0373945_0085242
375 Ga0373954_0061033
376 Ga0373956_0008468
377 Ga0373957_0025249
378 Ga0373946_0010823
379 Ga0373946_0069047
380 Ga0373955_0033462
381 Ga0373955_0094231
382 Ga0373955_0313455
383 Ga0373924_0066133
384 Ga0373935_0003038
385 Ga0373935_0022869
386 Ga0373935_0183007
387 Ga0373935_0233209
388 Ga0373935_0350344
389 Ga0373935_0945003
390 Ga0373927_0008613
391 Ga0373927_0032761
392 Ga0373927_0719389
393 Ga0373927_0746698
394 Ga0373933_0051832
395 Ga0373947_0005465
396 Ga0373947_0024690
397 Ga0373937_0000422
398 Ga0373937_0006590
399 Ga0373937_0024980
400 Ga0373937_0057429
401 Ga0373937_0074013
402 Ga0373925_0304508
403 Ga0373925_0343195
404 Ga0373925_0527370
405 Ga0395898_0697082
406 Ga0395898_0842339
407 Ga0451577_0037371
408 Ga0453683_0034003
409 Ga0466963_0004656
410 Ga0453684_0007931
411 Ga0466957_0000025
412 Ga0451576_0051573
413 Ga0466958_0463252
414 Ga0495592_0017635
415 Ga0495651_0003842
416 Ga0495651_0016480
417 Ga0495651_0104912
418 Ga0495651_0703776
419 Ga0495653_0000997
420 Ga0495653_0062068
421 Ga0495580_0011042
422 Ga0495580_0072686
423 Ga0495580_0255768
424 Ga0495582_0052703
425 Ga0495582_0237849
426 Ga0495639_0048216
427 Ga0495639_0073441
428 Ga0495664_0162410
429 Ga0495664_0434007
430 Ga0495608_0018110
431 Ga0495608_0021409
432 Ga0495608_0040729
433 Ga0495608_0230763
434 Ga0495618_0004059
435 Ga0495618_0392354
436 Ga0495628_0000713
437 Ga0495628_0026452
438 Ga0495628_0214668
439 Ga0495630_0002995
440 Ga0495630_0033347
441 Ga0495630_0110985
442 Ga0495666_0211461
443 Ga0495652_0001695
444 Ga0495652_0008308
445 Ga0495665_0004855
446 Ga0495665_0089892
447 Ga0495640_0129577
448 Ga0495586_0012364
449 Ga0495586_0025373
450 Ga0495586_0367391
451 Ga0495586_0738703
452 Ga0495587_0009037
453 Ga0495587_0015185
454 Ga0495645_0008638
455 Ga0495645_0016623
456 Ga0495645_0063019
457 Ga0495622_0098326
458 Ga0495667_0008038
459 Ga0495667_0026479
460 Ga0495667_0157053
461 Ga0495634_0073314
462 Ga0495634_0635536
463 Ga0495635_0023348
464 Ga0495635_0070165
465 Ga0495657_0016279
466 Ga0495657_0066286
467 Ga0495657_0273575
468 Ga0495623_0005078
469 Ga0495623_0011645
470 Ga0495646_0000381
471 Ga0495658_0265285
472 Ga0495658_0319481
473 Ga0495613_0084789
474 Ga0495613_0194670
475 Ga0495624_0006387
476 Ga0495600_0007100
477 Ga0495581_0039527
478 Ga0495604_0009526
479 Ga0495604_0059309
480 Ga0495604_0116844
481 Ga0495604_0743600
482 Ga0495674_0010043
483 Ga0495674_0019430
484 Ga0495674_0062413
485 Ga0495674_0207483
486 Ga0495674_0233935
487 Ga0495676_0358440
488 Ga0495680_0013948
489 Ga0495680_0023540
490 Ga0495680_0031205
491 Ga0495680_0085198
492 Ga0495680_0195183
493 Ga0495675_0000077
494 Ga0495675_0003872
495 Ga0495675_0008577
496 Ga0495684_0002210
497 Ga0495684_0021456
498 Ga0495684_0563212
499 Ga0495593_0003824
500 Ga0495602_0020648
501 Ga0495602_0045754
502 Ga0495602_0353969
503 Ga0495602_0706395
504 Ga0495614_0023066
505 Ga0496102_0151105
506 Ga0496104_0360802
507 Ga0496105_0001170
508 Ga0496105_0214757
509 Ga0496110_0008846
510 Ga0496110_0477294
511 Ga0496111_0003483
512 Ga0496111_0569432
513 Ga0496112_0051478
514 Ga0496113_0001237
515 Ga0496115_0384137
516 Ga0495601_0004794
517 Ga0495612_0403583
518 Ga0495619_0731901

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02834

LigT_PEase

LigT like Phosphoesterase

7

89

0.97

PF10469

AKAP7_NLS

AKAP7 2'5' RNA ligase-like domain

4

192

0.82

PF13563

2_5_RNA_ligase2

2'-5' RNA ligase superfamily

9

154

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vgj-assembly1.cif.gz_A crystal structure of 2'-5' rna ligase from pyrococcus horikoshii 0.8807 1 183
5ldo-assembly4.cif.gz_D crystal structure of e.coli ligt complexed with 3'-amp 0.8696 2 183
5ldi-assembly4.cif.gz_D crystal structure of e.coli ligt in apo form 0.8616 2 183
5h7f-assembly1.cif.gz_A crystal structure of mn-derivative drcpdase 0.8517 2 182
5ldo-assembly3.cif.gz_C crystal structure of e.coli ligt complexed with 3'-amp 0.8484 2 183
ID Description Score Start End Superfamily
af_Q58963_1_173_3.90.1140.10 Alpha Beta;Alpha-Beta Complex;Cyclic Phosphodiesterase; Chain: A,;Cyclic phosphodiesterase 0.9004 1 181 3.90.1140.10
af_Q58963_1_173_3.90.1140.10 Alpha Beta;Alpha-Beta Complex;Cyclic Phosphodiesterase; Chain: A,;Cyclic phosphodiesterase 0.8956 1 181 3.90.1140.10
1vgjA00 Alpha Beta;Alpha-Beta Complex;Cyclic Phosphodiesterase; Chain: A,;Cyclic phosphodiesterase 0.8615 2 183 3.90.1140.10
5h7fA00 Alpha Beta;Alpha-Beta Complex;Cyclic Phosphodiesterase; Chain: A,;Cyclic phosphodiesterase 0.8517 2 182 3.90.1140.10
1vgjA00 Alpha Beta;Alpha-Beta Complex;Cyclic Phosphodiesterase; Chain: A,;Cyclic phosphodiesterase 0.8484 2 183 3.90.1140.10
ID Description Score Start End GO Terms
AF-A0A321L9J3-F1-model_v4 RNA 2',3'-cyclic phosphodiesterase (RNA 2',3'-CPDase) (EC 3.1.4.58) 0.9535 1 184 GO:0004113
GO:0008664
AF-A0A321L9J3-F1-model_v4 RNA 2',3'-cyclic phosphodiesterase (RNA 2',3'-CPDase) (EC 3.1.4.58) 0.9485 1 184 GO:0004113
GO:0008664
AF-A0A2N9LIT3-F1-model_v4 RNA 2',3'-cyclic phosphodiesterase (RNA 2',3'-CPDase) (EC 3.1.4.58) 0.9388 1 181 GO:0004113
GO:0008664
GO:0016874
AF-A0A1F2RVY3-F1-model_v4 RNA 2',3'-cyclic phosphodiesterase (RNA 2',3'-CPDase) (EC 3.1.4.58) 0.9387 1 183 GO:0004113
GO:0008664
GO:0016874
AF-A0A0F2IYA7-F1-model_v4 deleted 0.9344 1 183

Map