F368476

General Info

Members Datasets Scaffolds Average Seq Length
258 188 516 360

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2876808645|2876813258
Length 432
Sequence VLNAFGSPLAIENVPDPLLGTGEVIIDVVASRVLAYANEVLSGERKYLLELPVVPGPGAIGRIRATGPDATRLRPGDWVYCDPTVRSRDNALSPDIALQGLTAGSEGGLRLQRYFHDGAWAEQMRLPTENAVSIGDIDEKDAGRWCALGTLLVPYGGFLAVQLQAGEIALVNGATGSFGSAAVAVALAMGAQCVIATGRNEQALTELTRRFGARVRTVPMRGDEADDRARILQAAPGPIDCVLDILPPVASAVQVRTAVLAVRPHGRVVLMGGVGMQGGAGLDLPYPWMMRNGITLRGQWMYPPHAAILMAGLIRAGLVDLDHFEIAAFGLDRANEAVAHAAAHSGXXXXXXXXXXXXXXXXXXXXXXDPAAIGPAACWRSGADDVADDVMDFERLVDLGEPFGAVGGAAAAALVERQXXXXATGWSLLRAP

Samples

Sample ID Description Type Environment
1 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
5 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
6 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
7 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
8 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
9 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
10 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
11 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
35 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
36 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
37 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
38 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
39 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
40 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
41 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
42 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
43 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
44 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
45 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
46 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
60 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
61 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
65 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
67 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
69 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
70 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
101 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
102 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
103 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
104 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
105 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
106 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
107 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
108 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
109 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
110 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
111 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
112 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
113 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
114 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
115 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
116 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
117 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
118 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
119 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
120 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
121 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
122 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
123 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
124 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
125 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
126 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
127 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
128 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
129 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
130 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
131 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
132 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
133 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
134 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
135 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
136 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
137 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
138 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
139 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
140 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
141 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
142 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
143 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
144 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
145 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
146 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
147 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
148 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
149 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
150 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
151 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
152 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
153 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
154 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
155 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
156 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
157 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
158 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
159 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
160 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
161 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
162 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
163 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
164 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
165 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
166 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
167 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
168 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
169 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
170 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
171 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
172 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
173 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
174 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
175 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
176 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
177 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
178 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
179 2855730933 Achromobacter sp. HZ28 Isolate Nodule
180 2855767633 Achromobacter sp. HZ34 Isolate Nodule
181 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
182 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
183 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
184 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
185 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
186 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
187 2939602548 Pantoea dispersa 1175 Isolate Rhizosphere
188 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 92.64
Metatranscriptomes 0
Isolates 7.36

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.83
Nodule 4.26
Rhizoplane 2.71
Rhizosphere 62.4
Stem 0
Stem Tuber 0
Unclassified 0.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10000549 3300003215 Bacteria 23413
2 rootH1_10039163 3300003316 Bacteria 15334
3 rootH1_10160845 3300003323 Bacteria 3226
4 Ga0055532_1000276 3300003758 Bacteria 33326
5 Ga0055527_1003642 3300003760 Bacteria 2240
6 Ga0055535_1000172 3300003761 Bacteria 69740
7 Ga0055542_1000219 3300003762 Bacteria 69781
8 Ga0055529_1000235 3300003763 Bacteria 69781
9 Ga0058692_1002555 3300003856 Bacteria 6023
10 Ga0058692_1013940 3300003856 Bacteria 1856
11 Ga0055543_1008580 3300004625 Bacteria 2254
12 Ga0065165_1000779 3300005262 Bacteria 42728
13 Ga0070670_100257475 3300005331 Bacteria 1521
14 Ga0068869_100022285 3300005334 Bacteria 4363
15 Ga0068869_100056145 3300005334 Bacteria 2871
16 Ga0068869_100169554 3300005334 Bacteria 1704
17 Ga0070666_10137113 3300005335 Bacteria 1703
18 Ga0070689_100054568 3300005340 Bacteria 3094
19 Ga0070674_100302896 3300005356 Bacteria 1275
20 Ga0070714_100038353 3300005435 Bacteria 4028
21 Ga0070663_100087529 3300005455 Bacteria 2302
22 Ga0070678_100036617 3300005456 Bacteria 3436
23 Ga0070681_10052065 3300005458 Bacteria 4083
24 Ga0070706_100120474 3300005467 Bacteria 2446
25 Ga0068853_100114567 3300005539 Bacteria 2398
26 Ga0070665_100062371 3300005548 Bacteria 3738
27 Ga0070665_100313979 3300005548 Bacteria 1571
28 Ga0068855_100019654 3300005563 Bacteria 8112
29 Ga0068854_100033465 3300005578 Bacteria 3584
30 Ga0068856_100000223 3300005614 Bacteria 61437
31 Ga0068856_100024184 3300005614 Bacteria 5910
32 Ga0068856_100050757 3300005614 Bacteria 4089
33 Ga0068852_100265869 3300005616 Bacteria 1649
34 Ga0068859_100059219 3300005617 Bacteria 3858
35 Ga0068864_100016299 3300005618 Bacteria 6186
36 Ga0068861_100101262 3300005719 Bacteria 2291
37 Ga0068861_100404983 3300005719 Bacteria 1212
38 Ga0068863_100108539 3300005841 Bacteria 2641
39 Ga0068863_100299359 3300005841 Bacteria 1560
40 Ga0068858_100018333 3300005842 Bacteria 6554
41 Ga0068858_100051823 3300005842 Bacteria 3797
42 Ga0068860_100241415 3300005843 Bacteria 1757
43 Ga0081455_10007271 3300005937 Bacteria 11685
44 Ga0081455_10007953 3300005937 Bacteria 11090
45 Ga0081455_10069950 3300005937 Bacteria 2916
46 Ga0081540_1001309 3300005983 Bacteria 21732
47 Ga0081540_1007690 3300005983 Bacteria 7641
48 Ga0081540_1011824 3300005983 Bacteria 5800
49 Ga0081539_10068922 3300005985 Bacteria 1906
50 Ga0081539_10097753 3300005985 Bacteria 1503
51 Ga0070717_10033558 3300006028 Bacteria 4141
52 Ga0075365_10031906 3300006038 Bacteria 3383
53 Ga0075365_10061903 3300006038 Bacteria 2501
54 Ga0075368_10008163 3300006042 Bacteria 3719
55 Ga0075363_100000880 3300006048 Bacteria 10553
56 Ga0075363_100033735 3300006048 Bacteria 2668
57 Ga0075364_10009208 3300006051 Bacteria 5918
58 Ga0075367_10015848 3300006178 Bacteria 4106
59 Ga0075367_10020665 3300006178 Bacteria 3670
60 Ga0075369_10078319 3300006186 Bacteria 1463
61 Ga0075370_10031920 3300006353 Bacteria 2942
62 Ga0075370_10110918 3300006353 Bacteria 1593
63 Ga0075370_10122992 3300006353 Bacteria 1512
64 Ga0075433_10328472 3300006852 Bacteria 1353
65 Ga0075434_100079758 3300006871 Bacteria 3270
66 Ga0097620_100059220 3300006931 Bacteria 3858
67 Ga0075435_100022886 3300007076 Bacteria 4824
68 Ga0105240_10000005 3300009093 Bacteria 702630
69 Ga0105240_10109552 3300009093 Bacteria 3344
70 Ga0105245_10051742 3300009098 Bacteria 3682
71 Ga0105247_10201753 3300009101 Bacteria 1337
72 Ga0105241_10010905 3300009174 Bacteria 6667
73 Ga0105241_10028160 3300009174 Bacteria 4185
74 Ga0105248_10053320 3300009177 Bacteria 4538
75 Ga0105248_10072957 3300009177 Bacteria 3858
76 Ga0105237_10045179 3300009545 Bacteria 4434
77 Ga0105237_10065589 3300009545 Bacteria 3627
78 Ga0105238_10087204 3300009551 Bacteria 3108
79 Ga0105239_10002672 3300010375 Bacteria 22471
80 Ga0105239_10023031 3300010375 Bacteria 6866
81 Ga0105239_10087454 3300010375 Bacteria 3435
82 Ga0105239_10510037 3300010375 Bacteria 1368
83 Ga0157370_10000163 3300013104 Bacteria 81428
84 Ga0157372_10254547 3300013307 Bacteria 2038
85 Ga0157379_10112641 3300014968 Bacteria 2445
86 Ga0213875_10000800 3300021388 Bacteria 23523
87 Ga0209672_100030 3300025228 Bacteria 337051
88 Ga0209147_100036 3300025229 Bacteria 337052
89 Ga0209258_100056 3300025242 Bacteria 337051
90 Ga0209026_1000535 3300025250 Bacteria 26193
91 Ga0209148_1000105 3300025254 Bacteria 210795
92 Ga0209148_1000155 3300025254 Bacteria 143807
93 Ga0209565_1026159 3300025263 Bacteria 1173
94 Ga0209455_1000061 3300025272 Bacteria 337052
95 Ga0209455_1003131 3300025272 Bacteria 6024
96 Ga0209673_1000108 3300025273 Bacteria 183732
97 Ga0209758_1001732 3300025297 Bacteria 24300
98 Ga0209257_1009538 3300025304 Bacteria 5161
99 Ga0207688_10012904 3300025901 Bacteria 4542
100 Ga0207680_10094884 3300025903 Bacteria 1905
101 Ga0207647_10007950 3300025904 Bacteria 7624
102 Ga0207647_10040059 3300025904 Bacteria 2952
103 Ga0207645_10149084 3300025907 Bacteria 1526
104 Ga0207643_10041215 3300025908 Bacteria 2602
105 Ga0207643_10081680 3300025908 Bacteria 1873
106 Ga0207705_10321293 3300025909 Bacteria 1189
107 Ga0207654_10011101 3300025911 Bacteria 4584
108 Ga0207654_10036655 3300025911 Bacteria 2742
109 Ga0207695_10000011 3300025913 Bacteria 910221
110 Ga0207695_10017177 3300025913 Bacteria 8433
111 Ga0207695_10203500 3300025913 Bacteria 1893
112 Ga0207671_10002302 3300025914 Bacteria 20628
113 Ga0207671_10093760 3300025914 Bacteria 2265
114 Ga0207649_10157811 3300025920 Bacteria 1569
115 Ga0207694_10004185 3300025924 Bacteria 11320
116 Ga0207694_10254335 3300025924 Bacteria 1438
117 Ga0207687_10141132 3300025927 Bacteria 1828
118 Ga0207691_10119678 3300025940 Bacteria 2335
119 Ga0207711_10221546 3300025941 Bacteria 1730
120 Ga0207689_10079187 3300025942 Bacteria 2701
121 Ga0207667_10007333 3300025949 Bacteria 13274
122 Ga0207667_10016189 3300025949 Bacteria 8430
123 Ga0207668_10050098 3300025972 Bacteria 2875
124 Ga0207668_10099734 3300025972 Bacteria 2155
125 Ga0207640_10273666 3300025981 Bacteria 1322
126 Ga0207703_10029106 3300026035 Bacteria 4357
127 Ga0207639_10037132 3300026041 Bacteria 3617
128 Ga0207678_10118823 3300026067 Bacteria 2256
129 Ga0207678_10243684 3300026067 Bacteria 1539
130 Ga0207702_10000252 3300026078 Bacteria 62099
131 Ga0207702_10067760 3300026078 Bacteria 3064
132 Ga0207675_100050867 3300026118 Bacteria 3867
133 Ga0207675_100064738 3300026118 Bacteria 3417
134 Ga0207675_100338403 3300026118 Bacteria 1473
135 Ga0207675_100441910 3300026118 Bacteria 1287
136 Ga0207683_10103145 3300026121 Bacteria 2547
137 Ga0207698_10228210 3300026142 Bacteria 1688
138 Ga0209371_1000017 3300027312 Bacteria 625776
139 Ga0209371_1000103 3300027312 Bacteria 149486
140 Ga0209371_1000387 3300027312 Bacteria 46537
141 Ga0209371_1005939 3300027312 Bacteria 4689
142 Ga0209371_1006357 3300027312 Bacteria 4391
143 Ga0268266_10004455 3300028379 Bacteria 13397
144 Ga0268266_10006881 3300028379 Bacteria 10350
145 Ga0268266_10011633 3300028379 Bacteria 7640
146 Ga0268266_10253482 3300028379 Bacteria 1628
147 Ga0268265_10086486 3300028380 Bacteria 2491
148 Ga0268264_10229040 3300028381 Bacteria 1715
149 Ga0307517_10000369 3300028786 Bacteria 77795
150 Ga0307517_10163380 3300028786 Bacteria 1487
151 Ga0307515_10023324 3300028794 Bacteria 10849
152 Ga0268256_1000036 3300030500 Bacteria 370250
153 Ga0268256_1000119 3300030500 Bacteria 114623
154 Ga0268256_1000420 3300030500 Bacteria 38284
155 Ga0268256_1006904 3300030500 Bacteria 4144
156 Ga0265325_10001590 3300031241 Bacteria 15835
157 Ga0265339_10002393 3300031249 Bacteria 13463
158 Ga0265316_10027614 3300031344 Bacteria 4695
159 Ga0307408_100276472 3300031548 Bacteria 1397
160 Ga0265313_10001032 3300031595 Bacteria 27079
161 Ga0307508_10028978 3300031616 Bacteria 5005
162 Ga0265314_10008285 3300031711 Bacteria 8920
163 Ga0307412_10201150 3300031911 Bacteria 1513
164 Ga0307409_100116193 3300031995 Bacteria 2254
165 Ga0307416_100301562 3300032002 Bacteria 1593
166 Ga0307510_10006740 3300033180 Bacteria 13693
167 Ga0307510_10212885 3300033180 Bacteria 1453
168 Ga0395899_0000065 3300037312 Bacteria 205510
169 Ga0395900_0000339 3300037418 Bacteria 69082
170 Ga0395898_0000565 3300037466 Bacteria 69082
171 Ga0395898_0027365 3300037466 Bacteria 5726
172 Ga0395905_0033714 3300037471 Bacteria 4809
173 Ga0436364_1005383 3300037853 Bacteria 2674
174 Ga0436364_1562947 3300037853 Bacteria 33891
175 Ga0436365_0962981 3300039437 Bacteria 2474
176 Ga0436361_0507638 3300039447 Bacteria 3347
177 Ga0451789_1234897 3300041443 Bacteria 1779
178 Ga0439463_001270 3300042016 Bacteria 6743
179 Ga0466966_0011372 3300044684 Bacteria 5903
180 Ga0466970_0003795 3300044765 Bacteria 7399
181 Ga0466958_0002400 3300045836 Bacteria 9382
182 Ga0495603_0142249 3300046455 Bacteria 1395
183 Ga0495629_0122793 3300046459 Bacteria 1809
184 Ga0495638_0099062 3300046460 Bacteria 1745
185 Ga0495639_0032155 3300046475 Bacteria 2339
186 Ga0495639_0112163 3300046475 Bacteria 1295
187 Ga0495607_0119492 3300046501 Bacteria 1386
188 Ga0495583_0022742 3300046506 Bacteria 3189
189 Ga0495616_0089099 3300046513 Bacteria 1464
190 Ga0495632_0077131 3300046519 Bacteria 1593
191 Ga0495632_0111198 3300046519 Bacteria 1286
192 Ga0495644_0042001 3300046523 Bacteria 1722
193 Ga0495625_0179850 3300046660 Bacteria 1407
194 Ga0495635_0138354 3300046663 Bacteria 1659
195 Ga0495661_0100831 3300046665 Bacteria 1625
196 Ga0495588_0009550 3300046674 Bacteria 4488
197 Ga0495669_0060812 3300046684 Bacteria 1708
198 Ga0495683_0111300 3300047323 Bacteria 1307
199 Ga0495686_0031719 3300047472 Unclassified 3423
200 Ga0496102_0052218 3300048905 Bacteria 3724
201 Ga0496103_0004703 3300048906 Bacteria 8261
202 Ga0496106_0055551 3300048909 Bacteria 2993
203 Ga0496109_0125588 3300048912 Bacteria 2392
204 Ga0496113_0248453 3300048916 Unclassified 1420
205 Ga0496117_0024118 3300048920 Bacteria 4822
206 Ga0496118_0000378 3300048921 Bacteria 74801
207 Ga0496121_0000616 3300048924 Bacteria 66339
208 Ga0496121_0031651 3300048924 Bacteria 4828
209 Ga0496121_0074918 3300048924 Bacteria 2705
210 Ga0496121_0079103 3300048924 Bacteria 2611
211 Ga0496121_0211532 3300048924 Bacteria 1373
212 Ga0496122_0001717 3300048925 Bacteria 33994
213 Ga0496122_0136796 3300048925 Bacteria 1542
214 Ga0496123_0000211 3300048926 Bacteria 118697
215 Ga0496124_0001697 3300048927 Bacteria 31139
216 Ga0496124_0025173 3300048927 Bacteria 5395
217 Ga0496125_0005040 3300048928 Bacteria 14904
218 Ga0496125_0084824 3300048928 Bacteria 2403
219 Ga0496126_0004475 3300048929 Bacteria 16682
220 Ga0496126_0104782 3300048929 Bacteria 2470
221 Ga0496126_0205621 3300048929 Bacteria 1660
222 Ga0496126_0234832 3300048929 Bacteria 1534
223 Ga0501067_0016488 3300049583 Bacteria 4082
224 nmdc:mga03n38_2163_c1 3300050490 Bacteria 5983
225 nmdc:mga03n38_74018_c1 3300050490 Bacteria 1583
226 nmdc:mga00v17_63066_c1 3300050491 Bacteria 2282
227 nmdc:mga06z11_9282_c1 3300050494 Bacteria 4139
228 nmdc:mga06r32_440962_c1 3300050510 Bacteria 1282
229 Ga0500641_0028712 3300053096 Bacteria 2174
230 Ga0500554_010878 3300053102 Bacteria 2235
231 Ga0500595_002327 3300053119 Bacteria 9499
232 Ga0500595_017961 3300053119 Bacteria 2597
233 Ga0500655_019392 3300053133 Bacteria 1267
234 Ga0500590_110836 3300053148 Bacteria 1302
235 Ga0500622_0045681 3300053156 Bacteria 2267
236 Ga0500627_0081571 3300053158 Bacteria 1442
237 Ga0500638_019715 3300053162 Bacteria 3165
238 Ga0500637_0001603 3300053178 Bacteria 9697
239 Ga0500552_000109 3300053733 Bacteria 6937
240 2876813258 2876808645 Bacteria 8824342
241 2513691603 2513237101 Bacteria 7952346
242 2513892745 2513237141 Bacteria 8496279
243 2524467641 2524023210 Bacteria 9029266
244 2599973262 2599185307 Bacteria 6194719
245 2723845970 2721755755 Bacteria 8322773
246 2808972772 2808606384 Bacteria 8474373
247 2809007754 2808606390 Bacteria 8476311
248 2809014706 2808606391 Bacteria 8308166
249 2855736227 2855730933 Bacteria 7047938
250 2855773164 2855767633 Bacteria 7049357
251 2863423303 2863421361 Bacteria 7300805
252 2874609368 2874604998 Bacteria 7834745
253 2879110414 2879110137 Bacteria 8907982
254 2917736484 2917736166 Bacteria 9690793
255 2922367929 2922361189 Bacteria 7436256
256 2922392184 2922386360 Bacteria 7017218
257 2939606423 2939602548 Bacteria 4950493
258 8006968756 8006964411 Bacteria 8966052
259 JGI25153J46596_10000549
260 rootH1_10039163
261 rootH1_10160845
262 Ga0055532_1000276
263 Ga0055527_1003642
264 Ga0055535_1000172
265 Ga0055542_1000219
266 Ga0055529_1000235
267 Ga0058692_1002555
268 Ga0058692_1013940
269 Ga0055543_1008580
270 Ga0065165_1000779
271 Ga0070670_100257475
272 Ga0068869_100022285
273 Ga0068869_100056145
274 Ga0068869_100169554
275 Ga0070666_10137113
276 Ga0070689_100054568
277 Ga0070674_100302896
278 Ga0070714_100038353
279 Ga0070663_100087529
280 Ga0070678_100036617
281 Ga0070681_10052065
282 Ga0070706_100120474
283 Ga0068853_100114567
284 Ga0070665_100062371
285 Ga0070665_100313979
286 Ga0068855_100019654
287 Ga0068854_100033465
288 Ga0068856_100000223
289 Ga0068856_100024184
290 Ga0068856_100050757
291 Ga0068852_100265869
292 Ga0068859_100059219
293 Ga0068864_100016299
294 Ga0068861_100101262
295 Ga0068861_100404983
296 Ga0068863_100108539
297 Ga0068863_100299359
298 Ga0068858_100018333
299 Ga0068858_100051823
300 Ga0068860_100241415
301 Ga0081455_10007271
302 Ga0081455_10007953
303 Ga0081455_10069950
304 Ga0081540_1001309
305 Ga0081540_1007690
306 Ga0081540_1011824
307 Ga0081539_10068922
308 Ga0081539_10097753
309 Ga0070717_10033558
310 Ga0075365_10031906
311 Ga0075365_10061903
312 Ga0075368_10008163
313 Ga0075363_100000880
314 Ga0075363_100033735
315 Ga0075364_10009208
316 Ga0075367_10015848
317 Ga0075367_10020665
318 Ga0075369_10078319
319 Ga0075370_10031920
320 Ga0075370_10110918
321 Ga0075370_10122992
322 Ga0075433_10328472
323 Ga0075434_100079758
324 Ga0097620_100059220
325 Ga0075435_100022886
326 Ga0105240_10000005
327 Ga0105240_10109552
328 Ga0105245_10051742
329 Ga0105247_10201753
330 Ga0105241_10010905
331 Ga0105241_10028160
332 Ga0105248_10053320
333 Ga0105248_10072957
334 Ga0105237_10045179
335 Ga0105237_10065589
336 Ga0105238_10087204
337 Ga0105239_10002672
338 Ga0105239_10023031
339 Ga0105239_10087454
340 Ga0105239_10510037
341 Ga0157370_10000163
342 Ga0157372_10254547
343 Ga0157379_10112641
344 Ga0213875_10000800
345 Ga0209672_100030
346 Ga0209147_100036
347 Ga0209258_100056
348 Ga0209026_1000535
349 Ga0209148_1000105
350 Ga0209148_1000155
351 Ga0209565_1026159
352 Ga0209455_1000061
353 Ga0209455_1003131
354 Ga0209673_1000108
355 Ga0209758_1001732
356 Ga0209257_1009538
357 Ga0207688_10012904
358 Ga0207680_10094884
359 Ga0207647_10007950
360 Ga0207647_10040059
361 Ga0207645_10149084
362 Ga0207643_10041215
363 Ga0207643_10081680
364 Ga0207705_10321293
365 Ga0207654_10011101
366 Ga0207654_10036655
367 Ga0207695_10000011
368 Ga0207695_10017177
369 Ga0207695_10203500
370 Ga0207671_10002302
371 Ga0207671_10093760
372 Ga0207649_10157811
373 Ga0207694_10004185
374 Ga0207694_10254335
375 Ga0207687_10141132
376 Ga0207691_10119678
377 Ga0207711_10221546
378 Ga0207689_10079187
379 Ga0207667_10007333
380 Ga0207667_10016189
381 Ga0207668_10050098
382 Ga0207668_10099734
383 Ga0207640_10273666
384 Ga0207703_10029106
385 Ga0207639_10037132
386 Ga0207678_10118823
387 Ga0207678_10243684
388 Ga0207702_10000252
389 Ga0207702_10067760
390 Ga0207675_100050867
391 Ga0207675_100064738
392 Ga0207675_100338403
393 Ga0207675_100441910
394 Ga0207683_10103145
395 Ga0207698_10228210
396 Ga0209371_1000017
397 Ga0209371_1000103
398 Ga0209371_1000387
399 Ga0209371_1005939
400 Ga0209371_1006357
401 Ga0268266_10004455
402 Ga0268266_10006881
403 Ga0268266_10011633
404 Ga0268266_10253482
405 Ga0268265_10086486
406 Ga0268264_10229040
407 Ga0307517_10000369
408 Ga0307517_10163380
409 Ga0307515_10023324
410 Ga0268256_1000036
411 Ga0268256_1000119
412 Ga0268256_1000420
413 Ga0268256_1006904
414 Ga0265325_10001590
415 Ga0265339_10002393
416 Ga0265316_10027614
417 Ga0307408_100276472
418 Ga0265313_10001032
419 Ga0307508_10028978
420 Ga0265314_10008285
421 Ga0307412_10201150
422 Ga0307409_100116193
423 Ga0307416_100301562
424 Ga0307510_10006740
425 Ga0307510_10212885
426 Ga0395899_0000065
427 Ga0395900_0000339
428 Ga0395898_0000565
429 Ga0395898_0027365
430 Ga0395905_0033714
431 Ga0436364_1005383
432 Ga0436364_1562947
433 Ga0436365_0962981
434 Ga0436361_0507638
435 Ga0451789_1234897
436 Ga0439463_001270
437 Ga0466966_0011372
438 Ga0466970_0003795
439 Ga0466958_0002400
440 Ga0495603_0142249
441 Ga0495629_0122793
442 Ga0495638_0099062
443 Ga0495639_0032155
444 Ga0495639_0112163
445 Ga0495607_0119492
446 Ga0495583_0022742
447 Ga0495616_0089099
448 Ga0495632_0077131
449 Ga0495632_0111198
450 Ga0495644_0042001
451 Ga0495625_0179850
452 Ga0495635_0138354
453 Ga0495661_0100831
454 Ga0495588_0009550
455 Ga0495669_0060812
456 Ga0495683_0111300
457 Ga0495686_0031719
458 Ga0496102_0052218
459 Ga0496103_0004703
460 Ga0496106_0055551
461 Ga0496109_0125588
462 Ga0496113_0248453
463 Ga0496117_0024118
464 Ga0496118_0000378
465 Ga0496121_0000616
466 Ga0496121_0031651
467 Ga0496121_0074918
468 Ga0496121_0079103
469 Ga0496121_0211532
470 Ga0496122_0001717
471 Ga0496122_0136796
472 Ga0496123_0000211
473 Ga0496124_0001697
474 Ga0496124_0025173
475 Ga0496125_0005040
476 Ga0496125_0084824
477 Ga0496126_0004475
478 Ga0496126_0104782
479 Ga0496126_0205621
480 Ga0496126_0234832
481 Ga0501067_0016488
482 nmdc:mga03n38_2163_c1
483 nmdc:mga03n38_74018_c1
484 nmdc:mga00v17_63066_c1
485 nmdc:mga06z11_9282_c1
486 nmdc:mga06r32_440962_c1
487 Ga0500641_0028712
488 Ga0500554_010878
489 Ga0500595_002327
490 Ga0500595_017961
491 Ga0500655_019392
492 Ga0500590_110836
493 Ga0500622_0045681
494 Ga0500627_0081571
495 Ga0500638_019715
496 Ga0500637_0001603
497 Ga0500552_000109
498 2876813258
499 2513691603
500 2513892745
501 2524467641
502 2599973262
503 2723845970
504 2808972772
505 2809007754
506 2809014706
507 2855736227
508 2855773164
509 2863423303
510 2874609368
511 2879110414
512 2917736484
513 2922367929
514 2922392184
515 2939606423
516 8006968756

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00107

ADH_zinc_N

Zinc-binding dehydrogenase

178

314

0.83

PF08240

ADH_N

Alcohol dehydrogenase GroES-like domain

20

136

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
1pl6-assembly1.cif.gz_A human sdh/nadh/inhibitor complex 0.8403 2 359
1rjw-assembly1.cif.gz_C crystal structure of nad(+)-dependent alcohol dehydrogenase from bacillus stearothermophilus strain lld-r 0.8375 1 358
1e3j-assembly1.cif.gz_A ketose reductase (sorbitol dehydrogenase) from silverleaf whitefly 0.8355 2 359
2d8a-assembly1.cif.gz_A crystal structure of ph0655 from pyrococcus horikoshii ot3 0.8305 1 357
4ilk-assembly1.cif.gz_B crystal structure of short chain alcohol dehydrogenase (rspb) from e. coli cft073 (efi target efi-506413) complexed with cofactor nadh 0.8302 1 357
ID Description Score Start End Superfamily
af_B0BNC9_25_138_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9149 2 141 3.90.180.10
af_Q3UNZ8_26_154_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.8896 2 145 3.90.180.10
af_O97479_158_293_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8799 160 301 3.40.50.720
3m6iB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8733 156 303 3.40.50.720
af_Q21703_166_295_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8695 166 303 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A1Q3LLL8-F1-model_v4 Alcohol dehydrogenase 0.9669 1 328 GO:0016491
AF-A0A1Q3LLL8-F1-model_v4 Alcohol dehydrogenase 0.964 1 328 GO:0016491
AF-A0A499V367-F1-model_v4 Alcohol dehydrogenase 0.9584 1 358 GO:0016491
AF-A0A499V367-F1-model_v4 Alcohol dehydrogenase 0.9532 1 358 GO:0016491
AF-A0A846GEE9-F1-model_v4 Alcohol dehydrogenase catalytic domain-containing protein 0.9511 1 358 GO:0016491
GO:0046872

Map