F368427

General Info

Members Datasets Scaffolds Average Seq Length
258 155 516 163

Family's Representative Sequence

Representative Sequence 3300049743|Ga0501081_0249147|Ga0501081_0249147_481_981
Length 166
Sequence MTNTPPTIRIGQGFDVHPFSGDADRPLVLGGVSFAGLPGLAGHSDGDVIAHAVTDALLGAAGLGDIGQHFPDTDPDWAGLLRRAVAALHDAGWYPQNVDCTVVLEEPKVAPQRAAIEARLGDAVGAPVTVKGKRAEGLGALGRAEGIACFAVALVARAAPVGGGSA

Samples

Sample ID Description Type Environment
1 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
5 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
6 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
7 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
8 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
9 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
10 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
11 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
12 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
13 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
14 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
15 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
16 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
17 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
18 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
19 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
20 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
21 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
22 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
23 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
24 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
25 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
26 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
27 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
28 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
29 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
30 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
31 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
32 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
33 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
34 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
35 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
39 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
40 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
41 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
42 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
43 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
44 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
45 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
46 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
47 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
48 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
70 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
73 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
74 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
75 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
76 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
77 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
78 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
79 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
80 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
81 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
82 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
83 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
84 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
85 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
86 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
87 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
88 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
89 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
90 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
91 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
92 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
93 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
94 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
95 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
96 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
97 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
98 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
99 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
100 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
101 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
102 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
103 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
104 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
105 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
106 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
107 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
108 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
109 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
110 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
111 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
112 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
113 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
114 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
115 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
129 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
130 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
131 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
132 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
133 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
134 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
135 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
136 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
137 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
138 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
139 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
140 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
141 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
142 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
143 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
144 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
145 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
146 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
147 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
148 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
149 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
150 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
151 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
152 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
153 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
154 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
155 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.02
Nodule 0
Rhizoplane 6.59
Rhizosphere 79.84
Stem 0
Stem Tuber 0
Unclassified 3.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501081_0249147 3300049743 Bacteria 1296
2 Ga0070676_10500103 3300005328 Unclassified 863
3 Ga0070690_100375799 3300005330 Bacteria 1038
4 Ga0070689_100074633 3300005340 Bacteria 2653
5 Ga0070674_100260104 3300005356 Bacteria 1367
6 Ga0070688_100142415 3300005365 Bacteria 1630
7 Ga0070667_100703420 3300005367 Bacteria 935
8 Ga0070700_100303506 3300005441 Bacteria 1166
9 Ga0070694_101221421 3300005444 Bacteria 630
10 Ga0070662_100638168 3300005457 Bacteria 898
11 Ga0068867_100017334 3300005459 Bacteria 5115
12 Ga0070685_10093274 3300005466 Bacteria 1826
13 Ga0070684_100790119 3300005535 Bacteria 887
14 Ga0070686_100086830 3300005544 Bacteria 2084
15 Ga0068859_100405501 3300005617 Bacteria 1459
16 Ga0068866_10177394 3300005718 Bacteria 1256
17 Ga0068861_100070885 3300005719 Bacteria 2700
18 Ga0068861_100248071 3300005719 Bacteria 1518
19 Ga0068870_10710711 3300005840 Unclassified 694
20 Ga0068860_100007293 3300005843 Bacteria 11058
21 Ga0068862_100012826 3300005844 Bacteria 6932
22 Ga0081455_10013846 3300005937 Bacteria 7933
23 Ga0081455_10248064 3300005937 Bacteria 1304
24 Ga0081455_10716649 3300005937 Bacteria 636
25 Ga0081538_10000054 3300005981 Bacteria 107029
26 Ga0075365_10005307 3300006038 Bacteria 6933
27 Ga0075365_10011293 3300006038 Bacteria 5246
28 Ga0075365_10111151 3300006038 Bacteria 1883
29 Ga0075365_10408900 3300006038 Bacteria 958
30 Ga0075363_100006954 3300006048 Bacteria 5172
31 Ga0075364_10002156 3300006051 Bacteria 11032
32 Ga0075364_10065553 3300006051 Bacteria 2384
33 Ga0075364_10093877 3300006051 Bacteria 1992
34 Ga0075364_10641711 3300006051 Bacteria 725
35 Ga0075362_10032539 3300006177 Bacteria 2263
36 Ga0075362_10047722 3300006177 Bacteria 1908
37 Ga0075362_10164227 3300006177 Bacteria 1070
38 Ga0075367_10123661 3300006178 Bacteria 1596
39 Ga0097621_100234697 3300006237 Bacteria 1602
40 Ga0075370_10194329 3300006353 Bacteria 1196
41 Ga0075428_100004448 3300006844 Bacteria 15472
42 Ga0075428_100634688 3300006844 Bacteria 1139
43 Ga0075430_100002227 3300006846 Bacteria 16085
44 Ga0075430_100022393 3300006846 Bacteria 5376
45 Ga0075430_100232619 3300006846 Bacteria 1528
46 Ga0075431_100000292 3300006847 Bacteria 39252
47 Ga0075431_100056843 3300006847 Bacteria 4035
48 Ga0075431_100164494 3300006847 Bacteria 2281
49 Ga0075429_100020461 3300006880 Bacteria 5742
50 Ga0075429_100045733 3300006880 Bacteria 3808
51 Ga0075429_101131235 3300006880 Bacteria 684
52 Ga0068865_100058489 3300006881 Bacteria 2693
53 Ga0097620_100405515 3300006931 Bacteria 1459
54 Ga0111539_10013858 3300009094 Bacteria 10079
55 Ga0111539_10014653 3300009094 Bacteria 9782
56 Ga0114129_10042870 3300009147 Bacteria 6368
57 Ga0114129_10167080 3300009147 Bacteria 3002
58 Ga0105243_10011406 3300009148 Bacteria 6725
59 Ga0105242_10012264 3300009176 Bacteria 6597
60 Ga0105248_10060025 3300009177 Bacteria 4270
61 Ga0105237_11147398 3300009545 Bacteria 784
62 Ga0105249_10208293 3300009553 Bacteria 1917
63 Ga0105249_11385871 3300009553 Unclassified 775
64 Ga0157378_10002197 3300013297 Bacteria 17312
65 Ga0157378_11339653 3300013297 Bacteria 758
66 Ga0157375_10502729 3300013308 Bacteria 1376
67 Ga0157380_11470726 3300014326 Bacteria 734
68 Ga0157379_10053838 3300014968 Bacteria 3595
69 Ga0157379_10969216 3300014968 Bacteria 809
70 Ga0163161_10653581 3300017792 Bacteria 871
71 Ga0207642_10101701 3300025899 Bacteria 1444
72 Ga0207680_10569304 3300025903 Bacteria 809
73 Ga0207650_10153583 3300025925 Bacteria 1819
74 Ga0207687_10659803 3300025927 Bacteria 885
75 Ga0207644_10574540 3300025931 Bacteria 934
76 Ga0207706_10187351 3300025933 Bacteria 1817
77 Ga0207686_10027950 3300025934 Bacteria 3309
78 Ga0207709_10187945 3300025935 Bacteria 1465
79 Ga0207670_10158866 3300025936 Bacteria 1685
80 Ga0207704_10195150 3300025938 Bacteria 1476
81 Ga0207665_10360527 3300025939 Bacteria 1099
82 Ga0207661_11490939 3300025944 Bacteria 620
83 Ga0207661_11606550 3300025944 Bacteria 595
84 Ga0207651_11118510 3300025960 Bacteria 706
85 Ga0207712_10614829 3300025961 Unclassified 941
86 Ga0207668_10155013 3300025972 Bacteria 1778
87 Ga0207658_10499114 3300025986 Bacteria 1084
88 Ga0207658_10637942 3300025986 Bacteria 959
89 Ga0207703_10091159 3300026035 Bacteria 2563
90 Ga0207678_10087290 3300026067 Bacteria 2666
91 Ga0207708_10110164 3300026075 Bacteria 2136
92 Ga0207648_10003839 3300026089 Bacteria 15698
93 Ga0207648_11006137 3300026089 Bacteria 781
94 Ga0207675_100037139 3300026118 Bacteria 4544
95 Ga0207675_100098833 3300026118 Bacteria 2749
96 Ga0207428_10034886 3300027907 Bacteria 4117
97 Ga0207428_10080149 3300027907 Bacteria 2551
98 Ga0268265_10130501 3300028380 Bacteria 2087
99 Ga0268264_10008132 3300028381 Bacteria 8719
100 Ga0265338_10064706 3300028800 Bacteria 3178
101 Ga0265327_10066939 3300031251 Bacteria 1811
102 Ga0307405_10398273 3300031731 Bacteria 1077
103 Ga0316577_10549056 3300031733 Bacteria 657
104 Ga0307416_100266357 3300032002 Bacteria 1679
105 Ga0373930_0087977 3300034816 Bacteria 725
106 Ga0373948_0067079 3300034817 Unclassified 798
107 Ga0373929_0000911 3300035085 Bacteria 5758
108 Ga0373951_0116548 3300035091 Unclassified 723
109 Ga0373932_0008402 3300035112 Bacteria 2468
110 Ga0373931_0000006 3300035691 Bacteria 437006
111 Ga0373931_0000203 3300035691 Bacteria 25193
112 Ga0373931_0552373 3300035691 Bacteria 748
113 Ga0316584_0065542 3300036712 Bacteria 2721
114 Ga0395905_0924417 3300037471 Bacteria 775
115 Ga0400485_02745 3300038735 Unclassified 1137
116 Ga0400483_093776 3300039062 Bacteria 6589
117 Ga0400483_280380 3300039062 Eukaryota 3863
118 Ga0436360_1195129 3300039438 Unclassified 699
119 Ga0451843_0731265 3300041509 Bacteria 1426
120 Ga0439450_024943 3300042008 Bacteria 1307
121 Ga0439454_014943 3300042011 Bacteria 1082
122 Ga0439463_008517 3300042016 Bacteria 2528
123 Ga0439463_127114 3300042016 Bacteria 659
124 Ga0439464_0002896 3300042439 Bacteria 4273
125 Ga0439460_0007435 3300042461 Bacteria 2741
126 Ga0439440_0001500 3300042993 Bacteria 4273
127 Ga0466967_0760877 3300045976 Bacteria 961
128 Ga0495639_0096185 3300046475 Bacteria 1394
129 Ga0495630_0731371 3300046517 Bacteria 757
130 Ga0495667_0678586 3300046559 Bacteria 639
131 Ga0495647_0208725 3300046681 Bacteria 859
132 Ga0495613_0474460 3300046689 Bacteria 845
133 Ga0495614_0060400 3300048089 Bacteria 1629
134 Ga0496100_0072676 3300048903 Bacteria 2300
135 Ga0496101_0143966 3300048904 Bacteria 1819
136 Ga0496102_0545424 3300048905 Unclassified 1082
137 Ga0496102_1628492 3300048905 Bacteria 564
138 Ga0496103_0306749 3300048906 Bacteria 1021
139 Ga0496104_0123250 3300048907 Bacteria 2488
140 Ga0496105_0010194 3300048908 Bacteria 7385
141 Ga0496105_0255775 3300048908 Bacteria 1418
142 Ga0496106_0269571 3300048909 Bacteria 1363
143 Ga0496107_0248352 3300048910 Bacteria 1324
144 Ga0496108_0180842 3300048911 Bacteria 1826
145 Ga0496108_0347296 3300048911 Bacteria 1295
146 Ga0496109_1520309 3300048912 Bacteria 604
147 Ga0496110_0072775 3300048913 Bacteria 3050
148 Ga0496110_0279153 3300048913 Bacteria 1521
149 Ga0496111_0007564 3300048914 Bacteria 7128
150 Ga0496114_0156412 3300048917 Bacteria 1979
151 Ga0501032_0075208 3300049569 Bacteria 2249
152 Ga0501032_0203748 3300049569 Bacteria 1291
153 Ga0501033_0117769 3300049570 Bacteria 1929
154 Ga0501033_0277226 3300049570 Bacteria 1184
155 Ga0501034_0002635 3300049571 Bacteria 21267
156 Ga0501034_0007345 3300049571 Bacteria 11735
157 Ga0501034_0060999 3300049571 Bacteria 3788
158 Ga0501034_0066866 3300049571 Bacteria 3608
159 Ga0501034_0765725 3300049571 Bacteria 860
160 Ga0501036_0014591 3300049572 Bacteria 6544
161 Ga0501037_0001191 3300049573 Bacteria 19226
162 Ga0501037_0019635 3300049573 Bacteria 4986
163 Ga0501037_0741224 3300049573 Bacteria 651
164 Ga0501038_0011879 3300049574 Bacteria 7947
165 Ga0501038_0044379 3300049574 Bacteria 3863
166 Ga0501040_0005706 3300049576 Bacteria 8051
167 Ga0501040_1250388 3300049576 Bacteria 539
168 Ga0501041_0089688 3300049577 Bacteria 1898
169 Ga0501041_0281633 3300049577 Bacteria 1046
170 Ga0501041_0487287 3300049577 Bacteria 784
171 Ga0501042_0070167 3300049578 Bacteria 2506
172 Ga0501043_0004210 3300049579 Bacteria 11743
173 Ga0501046_0019310 3300049580 Bacteria 5655
174 Ga0501047_0639227 3300049581 Bacteria 884
175 Ga0501048_0530047 3300049582 Bacteria 845
176 Ga0501068_0002080 3300049584 Bacteria 10664
177 Ga0501068_0002398 3300049584 Bacteria 9957
178 Ga0501069_0000119 3300049585 Bacteria 34987
179 Ga0501069_0000305 3300049585 Bacteria 22379
180 Ga0501070_0000582 3300049586 Bacteria 33274
181 Ga0501070_0002225 3300049586 Bacteria 17038
182 Ga0501070_0085036 3300049586 Bacteria 2619
183 Ga0501071_0017504 3300049587 Bacteria 4944
184 Ga0501071_0031410 3300049587 Bacteria 3764
185 Ga0501071_0056730 3300049587 Bacteria 2830
186 Ga0501071_0182188 3300049587 Bacteria 1574
187 Ga0501072_0155789 3300049588 Bacteria 1822
188 Ga0501072_0241864 3300049588 Bacteria 1437
189 Ga0501072_0343024 3300049588 Bacteria 1186
190 Ga0501072_0449221 3300049588 Bacteria 1021
191 Ga0501073_0000396 3300049589 Bacteria 29653
192 Ga0501073_0010106 3300049589 Bacteria 6938
193 Ga0501074_0000695 3300049590 Bacteria 21048
194 Ga0501074_0134409 3300049590 Bacteria 1769
195 Ga0501074_0606407 3300049590 Bacteria 774
196 Ga0501075_0174074 3300049591 Bacteria 1643
197 Ga0501076_0041375 3300049592 Bacteria 3625
198 Ga0501076_0143201 3300049592 Bacteria 1943
199 Ga0501076_0583035 3300049592 Bacteria 922
200 Ga0501079_0029655 3300049741 Bacteria 4202
201 Ga0501079_0103764 3300049741 Bacteria 2205
202 Ga0501079_0564764 3300049741 Bacteria 895
203 Ga0501079_0579586 3300049741 Bacteria 883
204 Ga0501079_0898595 3300049741 Bacteria 697
205 Ga0501080_0001886 3300049742 Bacteria 18044
206 Ga0501080_0003484 3300049742 Bacteria 13864
207 Ga0501080_0019465 3300049742 Bacteria 6286
208 Ga0501080_0075562 3300049742 Bacteria 3134
209 Ga0501080_0231034 3300049742 Bacteria 1691
210 Ga0501081_0399432 3300049743 Bacteria 1017
211 Ga0501083_0000167 3300049744 Bacteria 43126
212 Ga0501083_0028516 3300049744 Bacteria 3846
213 Ga0501044_0013723 3300049823 Bacteria 8755
214 nmdc:mga03683_9805_c1 3300050489 Bacteria 3417
215 nmdc:mga03n38_64310_c1 3300050490 Bacteria 1679
216 nmdc:mga00v17_45238_c1 3300050491 Bacteria 2659
217 nmdc:mga00v17_740737_c1 3300050491 Bacteria 628
218 nmdc:mga00v17_9307_c1 3300050491 Bacteria 5313
219 nmdc:mga0yw44_15314_c1 3300050492 Bacteria 4104
220 nmdc:mga0yw44_169377_c1 3300050492 Bacteria 1433
221 nmdc:mga0yw44_175444_c1 3300050492 Bacteria 1409
222 nmdc:mga0yw44_18633_c1 3300050492 Bacteria 3808
223 nmdc:mga0yw44_21216_c1 3300050492 Bacteria 3619
224 nmdc:mga0yw44_2502_c1 3300050492 Bacteria 7866
225 nmdc:mga0yw44_330831_c1 3300050492 Bacteria 1024
226 nmdc:mga0yw44_418079_c1 3300050492 Bacteria 907
227 nmdc:mga0yw44_734_c1 3300050492 Bacteria 12085
228 nmdc:mga06z11_312150_c1 3300050494 Bacteria 937
229 nmdc:mga06z11_69382_c1 3300050494 Bacteria 1861
230 nmdc:mga04h51_51972_c1 3300050495 Bacteria 1379
231 nmdc:mga05p37_296782_c1 3300050507 Bacteria 1922
232 nmdc:mga05p37_371015_c1 3300050507 Bacteria 1679
233 nmdc:mga05p37_66730_c1 3300050507 Bacteria 4425
234 nmdc:mga09592_104575_c1 3300050508 Bacteria 2426
235 nmdc:mga09592_49154_c1 3300050508 Bacteria 3556
236 nmdc:mga09592_4972_c1 3300050508 Bacteria 10774
237 nmdc:mga0qj67_181918_c1 3300050509 Bacteria 1707
238 nmdc:mga0qj67_207534_c1 3300050509 Bacteria 1591
239 nmdc:mga0qj67_728703_c1 3300050509 Bacteria 788
240 nmdc:mga0qj67_7525_c1 3300050509 Bacteria 8047
241 nmdc:mga0qj67_76981_c1 3300050509 Bacteria 2669
242 nmdc:mga0qj67_79000_c1 3300050509 Bacteria 2634
243 nmdc:mga06r32_1598_c1 3300050510 Bacteria 20412
244 nmdc:mga06r32_306259_c1 3300050510 Unclassified 1574
245 nmdc:mga06r32_759111_c1 3300050510 Bacteria 933
246 nmdc:mga06r32_761785_c1 3300050510 Bacteria 931
247 nmdc:mga08y16_472256_c1 3300050511 Bacteria 1277
248 nmdc:mga08y16_5662_c1 3300050511 Bacteria 13089
249 nmdc:mga08y16_68498_c1 3300050511 Bacteria 3700
250 nmdc:mga0n895_856604_c1 3300050512 Bacteria 896
251 Ga0501084_0000101 3300054114 Bacteria 63579
252 Ga0501084_0045299 3300054114 Bacteria 3683
253 Ga0501084_1131381 3300054114 Bacteria 657
254 Ga0501082_0009353 3300060353 Bacteria 8447
255 Ga0501082_0043477 3300060353 Bacteria 3874
256 Ga0501082_0164354 3300060353 Bacteria 1929
257 Ga0530510_0005110 3300061734 Bacteria 9050
258 Ga0530510_0150347 3300061734 Bacteria 1719
259 Ga0501081_0249147
260 Ga0070676_10500103
261 Ga0070690_100375799
262 Ga0070689_100074633
263 Ga0070674_100260104
264 Ga0070688_100142415
265 Ga0070667_100703420
266 Ga0070700_100303506
267 Ga0070694_101221421
268 Ga0070662_100638168
269 Ga0068867_100017334
270 Ga0070685_10093274
271 Ga0070684_100790119
272 Ga0070686_100086830
273 Ga0068859_100405501
274 Ga0068866_10177394
275 Ga0068861_100070885
276 Ga0068861_100248071
277 Ga0068870_10710711
278 Ga0068860_100007293
279 Ga0068862_100012826
280 Ga0081455_10013846
281 Ga0081455_10248064
282 Ga0081455_10716649
283 Ga0081538_10000054
284 Ga0075365_10005307
285 Ga0075365_10011293
286 Ga0075365_10111151
287 Ga0075365_10408900
288 Ga0075363_100006954
289 Ga0075364_10002156
290 Ga0075364_10065553
291 Ga0075364_10093877
292 Ga0075364_10641711
293 Ga0075362_10032539
294 Ga0075362_10047722
295 Ga0075362_10164227
296 Ga0075367_10123661
297 Ga0097621_100234697
298 Ga0075370_10194329
299 Ga0075428_100004448
300 Ga0075428_100634688
301 Ga0075430_100002227
302 Ga0075430_100022393
303 Ga0075430_100232619
304 Ga0075431_100000292
305 Ga0075431_100056843
306 Ga0075431_100164494
307 Ga0075429_100020461
308 Ga0075429_100045733
309 Ga0075429_101131235
310 Ga0068865_100058489
311 Ga0097620_100405515
312 Ga0111539_10013858
313 Ga0111539_10014653
314 Ga0114129_10042870
315 Ga0114129_10167080
316 Ga0105243_10011406
317 Ga0105242_10012264
318 Ga0105248_10060025
319 Ga0105237_11147398
320 Ga0105249_10208293
321 Ga0105249_11385871
322 Ga0157378_10002197
323 Ga0157378_11339653
324 Ga0157375_10502729
325 Ga0157380_11470726
326 Ga0157379_10053838
327 Ga0157379_10969216
328 Ga0163161_10653581
329 Ga0207642_10101701
330 Ga0207680_10569304
331 Ga0207650_10153583
332 Ga0207687_10659803
333 Ga0207644_10574540
334 Ga0207706_10187351
335 Ga0207686_10027950
336 Ga0207709_10187945
337 Ga0207670_10158866
338 Ga0207704_10195150
339 Ga0207665_10360527
340 Ga0207661_11490939
341 Ga0207661_11606550
342 Ga0207651_11118510
343 Ga0207712_10614829
344 Ga0207668_10155013
345 Ga0207658_10499114
346 Ga0207658_10637942
347 Ga0207703_10091159
348 Ga0207678_10087290
349 Ga0207708_10110164
350 Ga0207648_10003839
351 Ga0207648_11006137
352 Ga0207675_100037139
353 Ga0207675_100098833
354 Ga0207428_10034886
355 Ga0207428_10080149
356 Ga0268265_10130501
357 Ga0268264_10008132
358 Ga0265338_10064706
359 Ga0265327_10066939
360 Ga0307405_10398273
361 Ga0316577_10549056
362 Ga0307416_100266357
363 Ga0373930_0087977
364 Ga0373948_0067079
365 Ga0373929_0000911
366 Ga0373951_0116548
367 Ga0373932_0008402
368 Ga0373931_0000006
369 Ga0373931_0000203
370 Ga0373931_0552373
371 Ga0316584_0065542
372 Ga0395905_0924417
373 Ga0400485_02745
374 Ga0400483_093776
375 Ga0400483_280380
376 Ga0436360_1195129
377 Ga0451843_0731265
378 Ga0439450_024943
379 Ga0439454_014943
380 Ga0439463_008517
381 Ga0439463_127114
382 Ga0439464_0002896
383 Ga0439460_0007435
384 Ga0439440_0001500
385 Ga0466967_0760877
386 Ga0495639_0096185
387 Ga0495630_0731371
388 Ga0495667_0678586
389 Ga0495647_0208725
390 Ga0495613_0474460
391 Ga0495614_0060400
392 Ga0496100_0072676
393 Ga0496101_0143966
394 Ga0496102_0545424
395 Ga0496102_1628492
396 Ga0496103_0306749
397 Ga0496104_0123250
398 Ga0496105_0010194
399 Ga0496105_0255775
400 Ga0496106_0269571
401 Ga0496107_0248352
402 Ga0496108_0180842
403 Ga0496108_0347296
404 Ga0496109_1520309
405 Ga0496110_0072775
406 Ga0496110_0279153
407 Ga0496111_0007564
408 Ga0496114_0156412
409 Ga0501032_0075208
410 Ga0501032_0203748
411 Ga0501033_0117769
412 Ga0501033_0277226
413 Ga0501034_0002635
414 Ga0501034_0007345
415 Ga0501034_0060999
416 Ga0501034_0066866
417 Ga0501034_0765725
418 Ga0501036_0014591
419 Ga0501037_0001191
420 Ga0501037_0019635
421 Ga0501037_0741224
422 Ga0501038_0011879
423 Ga0501038_0044379
424 Ga0501040_0005706
425 Ga0501040_1250388
426 Ga0501041_0089688
427 Ga0501041_0281633
428 Ga0501041_0487287
429 Ga0501042_0070167
430 Ga0501043_0004210
431 Ga0501046_0019310
432 Ga0501047_0639227
433 Ga0501048_0530047
434 Ga0501068_0002080
435 Ga0501068_0002398
436 Ga0501069_0000119
437 Ga0501069_0000305
438 Ga0501070_0000582
439 Ga0501070_0002225
440 Ga0501070_0085036
441 Ga0501071_0017504
442 Ga0501071_0031410
443 Ga0501071_0056730
444 Ga0501071_0182188
445 Ga0501072_0155789
446 Ga0501072_0241864
447 Ga0501072_0343024
448 Ga0501072_0449221
449 Ga0501073_0000396
450 Ga0501073_0010106
451 Ga0501074_0000695
452 Ga0501074_0134409
453 Ga0501074_0606407
454 Ga0501075_0174074
455 Ga0501076_0041375
456 Ga0501076_0143201
457 Ga0501076_0583035
458 Ga0501079_0029655
459 Ga0501079_0103764
460 Ga0501079_0564764
461 Ga0501079_0579586
462 Ga0501079_0898595
463 Ga0501080_0001886
464 Ga0501080_0003484
465 Ga0501080_0019465
466 Ga0501080_0075562
467 Ga0501080_0231034
468 Ga0501081_0399432
469 Ga0501083_0000167
470 Ga0501083_0028516
471 Ga0501044_0013723
472 nmdc:mga03683_9805_c1
473 nmdc:mga03n38_64310_c1
474 nmdc:mga00v17_45238_c1
475 nmdc:mga00v17_740737_c1
476 nmdc:mga00v17_9307_c1
477 nmdc:mga0yw44_15314_c1
478 nmdc:mga0yw44_169377_c1
479 nmdc:mga0yw44_175444_c1
480 nmdc:mga0yw44_18633_c1
481 nmdc:mga0yw44_21216_c1
482 nmdc:mga0yw44_2502_c1
483 nmdc:mga0yw44_330831_c1
484 nmdc:mga0yw44_418079_c1
485 nmdc:mga0yw44_734_c1
486 nmdc:mga06z11_312150_c1
487 nmdc:mga06z11_69382_c1
488 nmdc:mga04h51_51972_c1
489 nmdc:mga05p37_296782_c1
490 nmdc:mga05p37_371015_c1
491 nmdc:mga05p37_66730_c1
492 nmdc:mga09592_104575_c1
493 nmdc:mga09592_49154_c1
494 nmdc:mga09592_4972_c1
495 nmdc:mga0qj67_181918_c1
496 nmdc:mga0qj67_207534_c1
497 nmdc:mga0qj67_728703_c1
498 nmdc:mga0qj67_7525_c1
499 nmdc:mga0qj67_76981_c1
500 nmdc:mga0qj67_79000_c1
501 nmdc:mga06r32_1598_c1
502 nmdc:mga06r32_306259_c1
503 nmdc:mga06r32_759111_c1
504 nmdc:mga06r32_761785_c1
505 nmdc:mga08y16_472256_c1
506 nmdc:mga08y16_5662_c1
507 nmdc:mga08y16_68498_c1
508 nmdc:mga0n895_856604_c1
509 Ga0501084_0000101
510 Ga0501084_0045299
511 Ga0501084_1131381
512 Ga0501082_0009353
513 Ga0501082_0043477
514 Ga0501082_0164354
515 Ga0530510_0005110
516 Ga0530510_0150347

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02542

YgbB

YgbB family

8

156

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3f6m-assembly1.cif.gz_A crystal structure of 2-c-methyl-d-erythritol 2,4-cyclodiphosphate synthase ispf from yersinia pestis 0.9653 4 158
3iew-assembly1.cif.gz_A crystal structure of 2c-methyl-d-erythritol 2,4-cyclodiphosphate synthase from burkholderia pseudomallei with bound ctp and cdp 0.9646 3 158
2uzh-assembly1.cif.gz_C mycobacterium smegmatis 2c-methyl-d-erythritol-2,4-cyclodiphosphate synthase (ispf) 0.9638 4 158
4c8i-assembly1.cif.gz_B ispf (burkholderia cenocepacia) citrate complex 0.9635 3 158
5b8f-assembly1.cif.gz_B x-ray crystal structure of a 2-c-methyl-d-erythritol 2,4-cyclodiphosphate synthase from pseudomonas aeruginosa 0.9618 3 158
ID Description Score Start End Superfamily
1woqB01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9949 116 131 3.30.420.40
2uzhA00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 0.955 4 158 3.30.1330.50
af_B6TL41_66_225_3.30.1330.50 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 0.9488 4 158 3.30.1330.50
5b8fC00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 0.9429 3 158 3.30.1330.50
2uzhA00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase 0.9429 4 158 3.30.1330.50
ID Description Score Start End GO Terms
AF-A0A381PJY2-F1-model_v4 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (EC 4.6.1.12) 0.9957 7 158 GO:0008685
GO:0016114
GO:0019288
GO:0046872
AF-A0A7Y1U1H1-F1-model_v4 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (EC 4.6.1.12) 0.9938 7 155 GO:0008685
GO:0016114
GO:0019288
GO:0046872
AF-A0A6I3F7N5-F1-model_v4 Bifunctional enzyme IspD/IspF [Includes: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase (EC 2.7.7.60) (4-diphosphocytidyl-2C-methyl-D-erythritol synthase) (MEP cytidylyltransferase) (MCT); 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (MECDP-synthase) (MECPP-synthase) (MECPS) (EC 4.6.1.12)] 0.9935 4 158 GO:0008685
GO:0016114
GO:0019288
GO:0046872
GO:0050518
AF-A0A399XL16-F1-model_v4 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (MECDP-synthase) (MECPP-synthase) (MECPS) (EC 4.6.1.12) 0.9923 3 158 GO:0008685
GO:0016114
GO:0019288
GO:0046872
AF-A0A0J0UY16-F1-model_v4 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (MECDP-synthase) (MECPP-synthase) (MECPS) (EC 4.6.1.12) 0.9919 3 155 GO:0008685
GO:0016114
GO:0019288
GO:0046872

Map