F368358
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 258 | 185 | 258 | 183 |
Family's Representative Sequence
| Representative Sequence | 3300048088|Ga0495602_0000008|Ga0495602_0000008_231680_232285 |
| Length | 201 |
| Sequence | LFLHQLFERQQNSRKEIMSTKTINQQQVPAGTWTVDPIHSSITFAVTHNGVTTFRSGFEAYEARLVGGEQPRLEGTVEVASIDIDEEMLKGHLLSPEFFDVQRFPQLRFASSEISVGEDGSLRVVGELEIHGESRKVEASGRFASLGADLAGNERVGLSIESTVDRRDFGLDWQAQLPSGGEVLDYAVTISVELELVTEEA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 2 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 27 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 30 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 31 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 32 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 33 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 34 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 35 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 36 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 37 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 38 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 39 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 40 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 41 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 42 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 43 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 47 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 48 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 49 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 67 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 68 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 69 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 112 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 113 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 114 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 115 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 116 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 117 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 118 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 119 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 158 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 159 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 160 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 161 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 162 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 163 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 164 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 165 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 166 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 167 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 168 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 169 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 170 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 171 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 172 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 173 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 174 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 175 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 176 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 177 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 178 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 179 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 185 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.45 |
| Metatranscriptomes | 1.55 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.78 |
| Nodule | 0 |
| Rhizoplane | 9.69 |
| Rhizosphere | 87.98 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.55 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10002620 | 3300001979 | Bacteria | 8100 |
| 2 | JGI25407J50210_10058568 | 3300003373 | Bacteria | 970 |
| 3 | Ga0070658_10125411 | 3300005327 | Bacteria | 2137 |
| 4 | Ga0070683_100098363 | 3300005329 | Bacteria | 2754 |
| 5 | Ga0070670_100150143 | 3300005331 | Bacteria | 2017 |
| 6 | Ga0070677_10000153 | 3300005333 | Bacteria | 23244 |
| 7 | Ga0070666_10009423 | 3300005335 | Bacteria | 6088 |
| 8 | Ga0070680_100021599 | 3300005336 | Bacteria | 5118 |
| 9 | Ga0070682_100000086 | 3300005337 | Bacteria | 83703 |
| 10 | Ga0070682_100000303 | 3300005337 | Bacteria | 34116 |
| 11 | Ga0068868_100032286 | 3300005338 | Bacteria | 4027 |
| 12 | Ga0070660_100125941 | 3300005339 | Bacteria | 2047 |
| 13 | Ga0070661_100000633 | 3300005344 | Bacteria | 26147 |
| 14 | Ga0070661_100958787 | 3300005344 | Bacteria | 708 |
| 15 | Ga0070675_100000063 | 3300005354 | Bacteria | 64820 |
| 16 | Ga0070688_100003080 | 3300005365 | Bacteria | 8520 |
| 17 | Ga0070688_100033158 | 3300005365 | Bacteria | 3120 |
| 18 | Ga0070688_100041350 | 3300005365 | Bacteria | 2829 |
| 19 | Ga0070659_100003464 | 3300005366 | Bacteria | 11233 |
| 20 | Ga0070667_100055887 | 3300005367 | Bacteria | 3333 |
| 21 | Ga0070667_100210141 | 3300005367 | Bacteria | 1729 |
| 22 | Ga0070714_100199767 | 3300005435 | Bacteria | 1829 |
| 23 | Ga0070713_100000080 | 3300005436 | Bacteria | 60198 |
| 24 | Ga0070713_100123164 | 3300005436 | Bacteria | 2276 |
| 25 | Ga0070711_100140245 | 3300005439 | Bacteria | 1811 |
| 26 | Ga0070663_100655720 | 3300005455 | Unclassified | 888 |
| 27 | Ga0070678_100017734 | 3300005456 | Bacteria | 4593 |
| 28 | Ga0070681_10022818 | 3300005458 | Bacteria | 6290 |
| 29 | Ga0070685_10000340 | 3300005466 | Bacteria | 28675 |
| 30 | Ga0070685_10009982 | 3300005466 | Bacteria | 4926 |
| 31 | Ga0070679_100000570 | 3300005530 | Bacteria | 31264 |
| 32 | Ga0070684_100038032 | 3300005535 | Bacteria | 4132 |
| 33 | Ga0070684_100062924 | 3300005535 | Bacteria | 3251 |
| 34 | Ga0070684_100310242 | 3300005535 | Bacteria | 1448 |
| 35 | Ga0068853_100520448 | 3300005539 | Bacteria | 1124 |
| 36 | Ga0070665_100000490 | 3300005548 | Bacteria | 56603 |
| 37 | Ga0070665_100129673 | 3300005548 | Bacteria | 2524 |
| 38 | Ga0070664_100037876 | 3300005564 | Bacteria | 4056 |
| 39 | Ga0068857_100038576 | 3300005577 | Bacteria | 4231 |
| 40 | Ga0068854_100000091 | 3300005578 | Bacteria | 63568 |
| 41 | Ga0068856_100001180 | 3300005614 | Bacteria | 27504 |
| 42 | Ga0068852_100000035 | 3300005616 | Bacteria | 99721 |
| 43 | Ga0068852_100225069 | 3300005616 | Bacteria | 1786 |
| 44 | Ga0068861_100366292 | 3300005719 | Bacteria | 1269 |
| 45 | Ga0068851_10001419 | 3300005834 | Bacteria | 10483 |
| 46 | Ga0068851_10003586 | 3300005834 | Bacteria | 6920 |
| 47 | Ga0068870_10230553 | 3300005840 | Bacteria | 1138 |
| 48 | Ga0068863_100775989 | 3300005841 | Bacteria | 955 |
| 49 | Ga0068858_100000772 | 3300005842 | Bacteria | 33386 |
| 50 | Ga0068858_100973191 | 3300005842 | Bacteria | 831 |
| 51 | Ga0068860_100253155 | 3300005843 | Bacteria | 1715 |
| 52 | Ga0068862_100125760 | 3300005844 | Bacteria | 2263 |
| 53 | Ga0081538_10000010 | 3300005981 | Bacteria | 164857 |
| 54 | Ga0081538_10072090 | 3300005981 | Bacteria | 1896 |
| 55 | Ga0081540_1000564 | 3300005983 | Bacteria | 35930 |
| 56 | Ga0081539_10004745 | 3300005985 | Bacteria | 14693 |
| 57 | Ga0070715_10207964 | 3300006163 | Bacteria | 998 |
| 58 | Ga0070712_100003110 | 3300006175 | Bacteria | 10236 |
| 59 | Ga0097621_100808299 | 3300006237 | Bacteria | 869 |
| 60 | Ga0075430_100045687 | 3300006846 | Bacteria | 3699 |
| 61 | Ga0068865_100000260 | 3300006881 | Bacteria | 29219 |
| 62 | Ga0075435_100393011 | 3300007076 | Bacteria | 1192 |
| 63 | Ga0105245_10000262 | 3300009098 | Bacteria | 50073 |
| 64 | Ga0105245_10007535 | 3300009098 | Bacteria | 9536 |
| 65 | Ga0105247_10108821 | 3300009101 | Bacteria | 1781 |
| 66 | Ga0105247_10559738 | 3300009101 | Bacteria | 842 |
| 67 | Ga0105241_10097108 | 3300009174 | Bacteria | 2335 |
| 68 | Ga0105242_10004002 | 3300009176 | Bacteria | 11454 |
| 69 | Ga0105248_10000547 | 3300009177 | Bacteria | 42972 |
| 70 | Ga0105248_10738981 | 3300009177 | Bacteria | 1110 |
| 71 | Ga0105238_10000051 | 3300009551 | Bacteria | 141705 |
| 72 | Ga0105249_10000708 | 3300009553 | Bacteria | 30229 |
| 73 | Ga0105249_10006484 | 3300009553 | Bacteria | 10179 |
| 74 | Ga0105239_10204170 | 3300010375 | Bacteria | 2214 |
| 75 | Ga0157371_10029889 | 3300013102 | Bacteria | 3934 |
| 76 | Ga0157369_10000348 | 3300013105 | Bacteria | 61516 |
| 77 | Ga0157369_11103280 | 3300013105 | Bacteria | 811 |
| 78 | Ga0157374_10015112 | 3300013296 | Bacteria | 6768 |
| 79 | Ga0157374_10077329 | 3300013296 | Bacteria | 3149 |
| 80 | Ga0157378_10026356 | 3300013297 | Bacteria | 5124 |
| 81 | Ga0157372_10000435 | 3300013307 | Bacteria | 45997 |
| 82 | Ga0157375_10162809 | 3300013308 | Bacteria | 2374 |
| 83 | Ga0157375_10353922 | 3300013308 | Bacteria | 1634 |
| 84 | Ga0157380_10000092 | 3300014326 | Bacteria | 48994 |
| 85 | Ga0157380_10769013 | 3300014326 | Bacteria | 977 |
| 86 | Ga0157379_10033747 | 3300014968 | Bacteria | 4565 |
| 87 | Ga0157379_10095191 | 3300014968 | Bacteria | 2672 |
| 88 | Ga0157376_10244112 | 3300014969 | Bacteria | 1674 |
| 89 | Ga0157376_10442040 | 3300014969 | Bacteria | 1267 |
| 90 | Ga0206356_10600948 | 3300020070 | Bacteria | 2955 |
| 91 | Ga0206349_1652994 | 3300020075 | Bacteria | 1162 |
| 92 | Ga0206353_11139743 | 3300020082 | Bacteria | 1292 |
| 93 | Ga0207656_10000314 | 3300025321 | Bacteria | 16753 |
| 94 | Ga0207656_10037458 | 3300025321 | Bacteria | 2041 |
| 95 | Ga0207682_10000756 | 3300025893 | Bacteria | 14892 |
| 96 | Ga0207710_10081226 | 3300025900 | Bacteria | 1504 |
| 97 | Ga0207680_10008301 | 3300025903 | Bacteria | 5089 |
| 98 | Ga0207643_10163733 | 3300025908 | Bacteria | 1339 |
| 99 | Ga0207705_10041752 | 3300025909 | Bacteria | 3291 |
| 100 | Ga0207654_10077084 | 3300025911 | Bacteria | 1997 |
| 101 | Ga0207707_10020533 | 3300025912 | Bacteria | 5768 |
| 102 | Ga0207693_10021324 | 3300025915 | Bacteria | 5149 |
| 103 | Ga0207663_10423670 | 3300025916 | Bacteria | 1022 |
| 104 | Ga0207660_10322535 | 3300025917 | Unclassified | 1234 |
| 105 | Ga0207657_10321792 | 3300025919 | Bacteria | 1223 |
| 106 | Ga0207657_10516806 | 3300025919 | Bacteria | 935 |
| 107 | Ga0207649_10000333 | 3300025920 | Bacteria | 35819 |
| 108 | Ga0207652_10000854 | 3300025921 | Bacteria | 28959 |
| 109 | Ga0207694_10000035 | 3300025924 | Bacteria | 195870 |
| 110 | Ga0207650_10057334 | 3300025925 | Bacteria | 2897 |
| 111 | Ga0207659_10000054 | 3300025926 | Bacteria | 76823 |
| 112 | Ga0207687_10000027 | 3300025927 | Bacteria | 168505 |
| 113 | Ga0207687_10000058 | 3300025927 | Bacteria | 85860 |
| 114 | Ga0207700_10000013 | 3300025928 | Bacteria | 230462 |
| 115 | Ga0207664_10407393 | 3300025929 | Bacteria | 1210 |
| 116 | Ga0207690_10003028 | 3300025932 | Bacteria | 10114 |
| 117 | Ga0207686_10000440 | 3300025934 | Bacteria | 27916 |
| 118 | Ga0207704_10002108 | 3300025938 | Bacteria | 8921 |
| 119 | Ga0207711_10000019 | 3300025941 | Bacteria | 412779 |
| 120 | Ga0207661_10008279 | 3300025944 | Bacteria | 7429 |
| 121 | Ga0207661_10040297 | 3300025944 | Bacteria | 3671 |
| 122 | Ga0207661_10053213 | 3300025944 | Bacteria | 3238 |
| 123 | Ga0207661_10075662 | 3300025944 | Bacteria | 2763 |
| 124 | Ga0207679_10011056 | 3300025945 | Bacteria | 5829 |
| 125 | Ga0207667_10402383 | 3300025949 | Bacteria | 1394 |
| 126 | Ga0207712_10000033 | 3300025961 | Bacteria | 209336 |
| 127 | Ga0207712_10042335 | 3300025961 | Bacteria | 3135 |
| 128 | Ga0207668_10021293 | 3300025972 | Bacteria | 4133 |
| 129 | Ga0207640_10000140 | 3300025981 | Bacteria | 53451 |
| 130 | Ga0207658_10005912 | 3300025986 | Bacteria | 8356 |
| 131 | Ga0207658_10176212 | 3300025986 | Bacteria | 1766 |
| 132 | Ga0207677_10001509 | 3300026023 | Bacteria | 12292 |
| 133 | Ga0207703_10000597 | 3300026035 | Bacteria | 36654 |
| 134 | Ga0207639_10204694 | 3300026041 | Bacteria | 1695 |
| 135 | Ga0207702_10000737 | 3300026078 | Bacteria | 34960 |
| 136 | Ga0207674_10046568 | 3300026116 | Bacteria | 4452 |
| 137 | Ga0207675_100475637 | 3300026118 | Bacteria | 1241 |
| 138 | Ga0207683_10070285 | 3300026121 | Bacteria | 3093 |
| 139 | Ga0207698_10000044 | 3300026142 | Bacteria | 94471 |
| 140 | Ga0207698_10047805 | 3300026142 | Bacteria | 3245 |
| 141 | Ga0268266_10000076 | 3300028379 | Bacteria | 217644 |
| 142 | Ga0268266_10001920 | 3300028379 | Bacteria | 23363 |
| 143 | Ga0268266_10084798 | 3300028379 | Bacteria | 2767 |
| 144 | Ga0268266_10368278 | 3300028379 | Bacteria | 1353 |
| 145 | Ga0268265_10010484 | 3300028380 | Bacteria | 6258 |
| 146 | Ga0268264_10214875 | 3300028381 | Bacteria | 1767 |
| 147 | Ga0307405_10467210 | 3300031731 | Bacteria | 1004 |
| 148 | Ga0307415_100014304 | 3300032126 | Bacteria | 4661 |
| 149 | Ga0373933_0618499 | 3300035724 | Unclassified | 712 |
| 150 | Ga0373937_0692766 | 3300036401 | Bacteria | 965 |
| 151 | Ga0466963_0000035 | 3300044694 | Bacteria | 44364 |
| 152 | Ga0466963_0017737 | 3300044694 | Bacteria | 4440 |
| 153 | Ga0466963_0074254 | 3300044694 | Bacteria | 2293 |
| 154 | Ga0466957_0001096 | 3300044842 | Bacteria | 13999 |
| 155 | Ga0466958_0080849 | 3300045836 | Bacteria | 1999 |
| 156 | Ga0466967_0000003 | 3300045976 | Bacteria | 169144 |
| 157 | Ga0466967_0113686 | 3300045976 | Bacteria | 2491 |
| 158 | Ga0466967_0155393 | 3300045976 | Bacteria | 2142 |
| 159 | Ga0466967_1295222 | 3300045976 | Bacteria | 726 |
| 160 | Ga0495592_0040546 | 3300046454 | Bacteria | 3495 |
| 161 | Ga0495629_0000934 | 3300046459 | Bacteria | 23527 |
| 162 | Ga0495641_0000001 | 3300046461 | Bacteria | 485224 |
| 163 | Ga0495641_0014780 | 3300046461 | Bacteria | 4209 |
| 164 | Ga0495653_0021594 | 3300046463 | Bacteria | 5215 |
| 165 | Ga0495653_0532747 | 3300046463 | Bacteria | 729 |
| 166 | Ga0495662_0000031 | 3300046476 | Bacteria | 47907 |
| 167 | Ga0495606_0015106 | 3300046507 | Bacteria | 5974 |
| 168 | Ga0495608_0000021 | 3300046511 | Bacteria | 168462 |
| 169 | Ga0495608_0094311 | 3300046511 | Bacteria | 1933 |
| 170 | Ga0495610_0064548 | 3300046512 | Bacteria | 1730 |
| 171 | Ga0495628_0215526 | 3300046516 | Bacteria | 1443 |
| 172 | Ga0495630_0000053 | 3300046517 | Bacteria | 93065 |
| 173 | Ga0495630_0047979 | 3300046517 | Bacteria | 3195 |
| 174 | Ga0495652_0000022 | 3300046529 | Bacteria | 178368 |
| 175 | Ga0495640_0003562 | 3300046533 | Bacteria | 12507 |
| 176 | Ga0495586_0000608 | 3300046535 | Bacteria | 20782 |
| 177 | Ga0495587_0453648 | 3300046536 | Bacteria | 710 |
| 178 | Ga0495667_0056080 | 3300046559 | Bacteria | 2591 |
| 179 | Ga0495634_0133155 | 3300046642 | Bacteria | 1583 |
| 180 | Ga0495625_0000117 | 3300046660 | Bacteria | 121901 |
| 181 | Ga0495625_0506986 | 3300046660 | Bacteria | 737 |
| 182 | Ga0495635_0000026 | 3300046663 | Bacteria | 142517 |
| 183 | Ga0495588_0000496 | 3300046674 | Bacteria | 19288 |
| 184 | Ga0495657_0000019 | 3300046675 | Bacteria | 168441 |
| 185 | Ga0495657_0013264 | 3300046675 | Bacteria | 6086 |
| 186 | Ga0495599_0039139 | 3300046678 | Bacteria | 2979 |
| 187 | Ga0495647_0000096 | 3300046681 | Bacteria | 22160 |
| 188 | Ga0495647_0003681 | 3300046681 | Bacteria | 4921 |
| 189 | Ga0495658_0022946 | 3300046683 | Bacteria | 3307 |
| 190 | Ga0495669_0000045 | 3300046684 | Bacteria | 84113 |
| 191 | Ga0495669_0143147 | 3300046684 | Unclassified | 1129 |
| 192 | Ga0495613_0000861 | 3300046689 | Bacteria | 23279 |
| 193 | Ga0495624_0000085 | 3300046690 | Bacteria | 61809 |
| 194 | Ga0495624_0000699 | 3300046690 | Bacteria | 26337 |
| 195 | Ga0495624_0096769 | 3300046690 | Bacteria | 1818 |
| 196 | Ga0495670_0005477 | 3300046691 | Bacteria | 6230 |
| 197 | Ga0495649_0015120 | 3300046694 | Bacteria | 4399 |
| 198 | Ga0495600_0009323 | 3300046809 | Bacteria | 6061 |
| 199 | Ga0495600_0017169 | 3300046809 | Bacteria | 4601 |
| 200 | Ga0495581_0094852 | 3300047315 | Bacteria | 1732 |
| 201 | Ga0495604_0000081 | 3300047317 | Bacteria | 82621 |
| 202 | Ga0495604_0001698 | 3300047317 | Bacteria | 18108 |
| 203 | Ga0495604_0044651 | 3300047317 | Bacteria | 3460 |
| 204 | Ga0495604_0726135 | 3300047317 | Unclassified | 629 |
| 205 | Ga0495674_0131492 | 3300047319 | Bacteria | 2108 |
| 206 | Ga0495676_0005949 | 3300047321 | Bacteria | 11200 |
| 207 | Ga0495676_0167068 | 3300047321 | Bacteria | 1551 |
| 208 | Ga0495676_0247793 | 3300047321 | Unclassified | 1217 |
| 209 | Ga0495680_0230714 | 3300047322 | Bacteria | 1318 |
| 210 | Ga0495675_0000141 | 3300047444 | Bacteria | 50168 |
| 211 | Ga0495675_0033770 | 3300047444 | Bacteria | 3265 |
| 212 | Ga0495679_039853 | 3300047446 | Bacteria | 1463 |
| 213 | Ga0495593_0031920 | 3300047673 | Bacteria | 2874 |
| 214 | Ga0495602_0000008 | 3300048088 | Bacteria | 260157 |
| 215 | Ga0496100_0000003 | 3300048903 | Bacteria | 360802 |
| 216 | Ga0496101_0000003 | 3300048904 | Bacteria | 406565 |
| 217 | Ga0496104_0000007 | 3300048907 | Bacteria | 524804 |
| 218 | Ga0496104_0000120 | 3300048907 | Bacteria | 72797 |
| 219 | Ga0496105_0000002 | 3300048908 | Bacteria | 753215 |
| 220 | Ga0496105_0000020 | 3300048908 | Bacteria | 181484 |
| 221 | Ga0496106_0000146 | 3300048909 | Bacteria | 52294 |
| 222 | Ga0496107_0000026 | 3300048910 | Bacteria | 108989 |
| 223 | Ga0496108_0000025 | 3300048911 | Bacteria | 177919 |
| 224 | Ga0496108_0000032 | 3300048911 | Bacteria | 158930 |
| 225 | Ga0496108_0087856 | 3300048911 | Bacteria | 2641 |
| 226 | Ga0496109_0000070 | 3300048912 | Bacteria | 108889 |
| 227 | Ga0496109_0000081 | 3300048912 | Bacteria | 99723 |
| 228 | Ga0496109_0000884 | 3300048912 | Bacteria | 25037 |
| 229 | Ga0496109_0624719 | 3300048912 | Bacteria | 1014 |
| 230 | Ga0496110_0000003 | 3300048913 | Bacteria | 144124 |
| 231 | Ga0496110_0015192 | 3300048913 | Bacteria | 6405 |
| 232 | Ga0496110_0080947 | 3300048913 | Bacteria | 2895 |
| 233 | Ga0496110_0651865 | 3300048913 | Bacteria | 953 |
| 234 | Ga0496111_0000024 | 3300048914 | Bacteria | 62369 |
| 235 | Ga0496111_0037156 | 3300048914 | Bacteria | 3486 |
| 236 | Ga0496112_0000003 | 3300048915 | Bacteria | 660147 |
| 237 | Ga0496112_0000668 | 3300048915 | Bacteria | 23904 |
| 238 | Ga0496113_0000025 | 3300048916 | Bacteria | 64773 |
| 239 | Ga0496114_0116934 | 3300048917 | Bacteria | 2290 |
| 240 | Ga0496119_0225644 | 3300048922 | Bacteria | 956 |
| 241 | Ga0496120_0009861 | 3300048923 | Bacteria | 6729 |
| 242 | Ga0496124_0079374 | 3300048927 | Bacteria | 2703 |
| 243 | Ga0496125_0110556 | 3300048928 | Bacteria | 1992 |
| 244 | Ga0501323_042531 | 3300049539 | Unclassified | 670 |
| 245 | Ga0501042_0054259 | 3300049578 | Bacteria | 2858 |
| 246 | Ga0501073_0674432 | 3300049589 | Bacteria | 713 |
| 247 | nmdc:mga0qj67_117584_c1 | 3300050509 | Bacteria | 2149 |
| 248 | nmdc:mga0rr50_445475_c1 | 3300050513 | Bacteria | 1097 |
| 249 | Ga0495601_0000096 | 3300053077 | Bacteria | 48420 |
| 250 | Ga0495612_0001210 | 3300053078 | Bacteria | 10641 |
| 251 | Ga0495612_0007572 | 3300053078 | Bacteria | 4438 |
| 252 | Ga0495655_0008260 | 3300053083 | Bacteria | 1970 |
| 253 | Ga0495595_0000004 | 3300053084 | Bacteria | 260821 |
| 254 | Ga0495595_0038007 | 3300053084 | Bacteria | 2191 |
| 255 | Ga0495619_0000080 | 3300053085 | Bacteria | 72201 |
| 256 | Ga0495619_0000336 | 3300053085 | Bacteria | 32967 |
| 257 | Ga0500641_0001689 | 3300053096 | Bacteria | 7846 |
| 258 | Ga0500614_000204 | 3300053123 | Bacteria | 15618 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048915 | Ga0496112_0000003 | Ga0496112_0000003_479624_480211 | 166 |
| 2 | 3300045836 | Ga0466958_0080849 | Ga0466958_0080849_16_519 | 167 |
| 3 | 3300047446 | Ga0495679_039853 | Ga0495679_039853_903_1406 | 167 |
| 4 | 3300046684 | Ga0495669_0143147 | Ga0495669_0143147_510_1061 | 171 |
| 5 | 3300047317 | Ga0495604_0000081 | Ga0495604_0000081_49277_49858 | 171 |
| 6 | 3300047321 | Ga0495676_0247793 | Ga0495676_0247793_230_781 | 176 |
| 7 | 3300005344 | Ga0070661_100958787 | Ga0070661_1009587871 | 177 |
| 8 | 3300025919 | Ga0207657_10516806 | Ga0207657_105168062 | 177 |
| 9 | 3300045976 | Ga0466967_0113686 | Ga0466967_0113686_1832_2377 | 179 |
| 10 | 3300053078 | Ga0495612_0007572 | Ga0495612_0007572_88_627 | 179 |
| 11 | 3300003373 | JGI25407J50210_10058568 | JGI25407J50210_100585681 | 180 |
| 12 | 3300005981 | Ga0081538_10000010 | Ga0081538_1000001098 | 180 |
| 13 | 3300005981 | Ga0081538_10072090 | Ga0081538_100720903 | 180 |
| 14 | 3300049539 | Ga0501323_042531 | Ga0501323_042531_59_652 | 181 |
| 15 | 3300006881 | Ga0068865_100000260 | Ga0068865_10000026026 | 182 |
| 16 | 3300009098 | Ga0105245_10000262 | Ga0105245_1000026245 | 182 |
| 17 | 3300009177 | Ga0105248_10000547 | Ga0105248_1000054727 | 182 |
| 18 | 3300025927 | Ga0207687_10000058 | Ga0207687_1000005879 | 182 |
| 19 | 3300025938 | Ga0207704_10002108 | Ga0207704_100021088 | 182 |
| 20 | 3300025941 | Ga0207711_10000019 | Ga0207711_10000019416 | 182 |
| 21 | 3300044842 | Ga0466957_0001096 | Ga0466957_0001096_10210_10761 | 182 |
| 22 | 3300045976 | Ga0466967_0000003 | Ga0466967_0000003_120049_120600 | 182 |
| 23 | 3300046459 | Ga0495629_0000934 | Ga0495629_0000934_21549_22100 | 182 |
| 24 | 3300046463 | Ga0495653_0532747 | Ga0495653_0532747_15_563 | 182 |
| 25 | 3300046507 | Ga0495606_0015106 | Ga0495606_0015106_3995_4546 | 182 |
| 26 | 3300046663 | Ga0495635_0000026 | Ga0495635_0000026_20737_21285 | 182 |
| 27 | 3300046683 | Ga0495658_0022946 | Ga0495658_0022946_620_1171 | 182 |
| 28 | 3300048911 | Ga0496108_0000025 | Ga0496108_0000025_150831_151382 | 182 |
| 29 | 3300048912 | Ga0496109_0000081 | Ga0496109_0000081_36902_37453 | 182 |
| 30 | 3300048913 | Ga0496110_0080947 | Ga0496110_0080947_1064_1615 | 182 |
| 31 | 3300048914 | Ga0496111_0037156 | Ga0496111_0037156_123_674 | 182 |
| 32 | 3300048915 | Ga0496112_0000668 | Ga0496112_0000668_1471_2022 | 182 |
| 33 | 3300048916 | Ga0496113_0000025 | Ga0496113_0000025_36048_36599 | 182 |
| 34 | 3300048917 | Ga0496114_0116934 | Ga0496114_0116934_149_700 | 182 |
| 35 | 3300048927 | Ga0496124_0079374 | Ga0496124_0079374_853_1404 | 182 |
| 36 | 3300001979 | JGI24740J21852_10002620 | JGI24740J21852_100026205 | 183 |
| 37 | 3300005327 | Ga0070658_10125411 | Ga0070658_101254113 | 183 |
| 38 | 3300005329 | Ga0070683_100098363 | Ga0070683_1000983633 | 183 |
| 39 | 3300005331 | Ga0070670_100150143 | Ga0070670_1001501432 | 183 |
| 40 | 3300005333 | Ga0070677_10000153 | Ga0070677_1000015315 | 183 |
| 41 | 3300005335 | Ga0070666_10009423 | Ga0070666_100094234 | 183 |
| 42 | 3300005336 | Ga0070680_100021599 | Ga0070680_1000215993 | 183 |
| 43 | 3300005337 | Ga0070682_100000086 | Ga0070682_10000008683 | 183 |
| 44 | 3300005337 | Ga0070682_100000303 | Ga0070682_1000003034 | 183 |
| 45 | 3300005338 | Ga0068868_100032286 | Ga0068868_1000322862 | 183 |
| 46 | 3300005339 | Ga0070660_100125941 | Ga0070660_1001259412 | 183 |
| 47 | 3300005344 | Ga0070661_100000633 | Ga0070661_10000063321 | 183 |
| 48 | 3300005354 | Ga0070675_100000063 | Ga0070675_10000006356 | 183 |
| 49 | 3300005365 | Ga0070688_100003080 | Ga0070688_1000030805 | 183 |
| 50 | 3300005365 | Ga0070688_100033158 | Ga0070688_1000331581 | 183 |
| 51 | 3300005365 | Ga0070688_100041350 | Ga0070688_1000413502 | 183 |
| 52 | 3300005366 | Ga0070659_100003464 | Ga0070659_1000034644 | 183 |
| 53 | 3300005367 | Ga0070667_100055887 | Ga0070667_1000558872 | 183 |
| 54 | 3300005367 | Ga0070667_100210141 | Ga0070667_1002101412 | 183 |
| 55 | 3300005435 | Ga0070714_100199767 | Ga0070714_1001997673 | 183 |
| 56 | 3300005436 | Ga0070713_100000080 | Ga0070713_10000008054 | 183 |
| 57 | 3300005436 | Ga0070713_100123164 | Ga0070713_1001231642 | 183 |
| 58 | 3300005439 | Ga0070711_100140245 | Ga0070711_1001402452 | 183 |
| 59 | 3300005455 | Ga0070663_100655720 | Ga0070663_1006557202 | 183 |
| 60 | 3300005456 | Ga0070678_100017734 | Ga0070678_1000177346 | 183 |
| 61 | 3300005458 | Ga0070681_10022818 | Ga0070681_100228184 | 183 |
| 62 | 3300005466 | Ga0070685_10000340 | Ga0070685_1000034030 | 183 |
| 63 | 3300005466 | Ga0070685_10009982 | Ga0070685_100099821 | 183 |
| 64 | 3300005530 | Ga0070679_100000570 | Ga0070679_10000057033 | 183 |
| 65 | 3300005535 | Ga0070684_100038032 | Ga0070684_1000380323 | 183 |
| 66 | 3300005535 | Ga0070684_100062924 | Ga0070684_1000629243 | 183 |
| 67 | 3300005535 | Ga0070684_100310242 | Ga0070684_1003102422 | 183 |
| 68 | 3300005539 | Ga0068853_100520448 | Ga0068853_1005204482 | 183 |
| 69 | 3300005548 | Ga0070665_100000490 | Ga0070665_10000049043 | 183 |
| 70 | 3300005548 | Ga0070665_100129673 | Ga0070665_1001296734 | 183 |
| 71 | 3300005564 | Ga0070664_100037876 | Ga0070664_1000378763 | 183 |
| 72 | 3300005577 | Ga0068857_100038576 | Ga0068857_1000385764 | 183 |
| 73 | 3300005578 | Ga0068854_100000091 | Ga0068854_10000009150 | 183 |
| 74 | 3300005614 | Ga0068856_100001180 | Ga0068856_10000118012 | 183 |
| 75 | 3300005616 | Ga0068852_100000035 | Ga0068852_10000003546 | 183 |
| 76 | 3300005616 | Ga0068852_100225069 | Ga0068852_1002250692 | 183 |
| 77 | 3300005719 | Ga0068861_100366292 | Ga0068861_1003662922 | 183 |
| 78 | 3300005834 | Ga0068851_10001419 | Ga0068851_1000141910 | 183 |
| 79 | 3300005834 | Ga0068851_10003586 | Ga0068851_100035864 | 183 |
| 80 | 3300005840 | Ga0068870_10230553 | Ga0068870_102305532 | 183 |
| 81 | 3300005841 | Ga0068863_100775989 | Ga0068863_1007759892 | 183 |
| 82 | 3300005842 | Ga0068858_100000772 | Ga0068858_10000077231 | 183 |
| 83 | 3300005842 | Ga0068858_100973191 | Ga0068858_1009731912 | 183 |
| 84 | 3300005843 | Ga0068860_100253155 | Ga0068860_1002531552 | 183 |
| 85 | 3300005844 | Ga0068862_100125760 | Ga0068862_1001257602 | 183 |
| 86 | 3300005983 | Ga0081540_1000564 | Ga0081540_100056415 | 183 |
| 87 | 3300005985 | Ga0081539_10004745 | Ga0081539_1000474513 | 183 |
| 88 | 3300006163 | Ga0070715_10207964 | Ga0070715_102079642 | 183 |
| 89 | 3300006175 | Ga0070712_100003110 | Ga0070712_1000031103 | 183 |
| 90 | 3300006237 | Ga0097621_100808299 | Ga0097621_1008082992 | 183 |
| 91 | 3300006846 | Ga0075430_100045687 | Ga0075430_1000456875 | 183 |
| 92 | 3300007076 | Ga0075435_100393011 | Ga0075435_1003930113 | 183 |
| 93 | 3300009098 | Ga0105245_10007535 | Ga0105245_100075355 | 183 |
| 94 | 3300009101 | Ga0105247_10108821 | Ga0105247_101088212 | 183 |
| 95 | 3300009101 | Ga0105247_10559738 | Ga0105247_105597381 | 183 |
| 96 | 3300009174 | Ga0105241_10097108 | Ga0105241_100971084 | 183 |
| 97 | 3300009176 | Ga0105242_10004002 | Ga0105242_100040023 | 183 |
| 98 | 3300009177 | Ga0105248_10738981 | Ga0105248_107389812 | 183 |
| 99 | 3300009551 | Ga0105238_10000051 | Ga0105238_10000051100 | 183 |
| 100 | 3300009553 | Ga0105249_10000708 | Ga0105249_100007085 | 183 |
| 101 | 3300009553 | Ga0105249_10006484 | Ga0105249_100064845 | 183 |
| 102 | 3300010375 | Ga0105239_10204170 | Ga0105239_102041703 | 183 |
| 103 | 3300013102 | Ga0157371_10029889 | Ga0157371_100298894 | 183 |
| 104 | 3300013105 | Ga0157369_10000348 | Ga0157369_1000034825 | 183 |
| 105 | 3300013105 | Ga0157369_11103280 | Ga0157369_111032802 | 183 |
| 106 | 3300013296 | Ga0157374_10015112 | Ga0157374_100151126 | 183 |
| 107 | 3300013296 | Ga0157374_10077329 | Ga0157374_100773293 | 183 |
| 108 | 3300013297 | Ga0157378_10026356 | Ga0157378_100263565 | 183 |
| 109 | 3300013307 | Ga0157372_10000435 | Ga0157372_100004356 | 183 |
| 110 | 3300013308 | Ga0157375_10162809 | Ga0157375_101628092 | 183 |
| 111 | 3300013308 | Ga0157375_10353922 | Ga0157375_103539222 | 183 |
| 112 | 3300014326 | Ga0157380_10000092 | Ga0157380_100000924 | 183 |
| 113 | 3300014326 | Ga0157380_10769013 | Ga0157380_107690132 | 183 |
| 114 | 3300014968 | Ga0157379_10033747 | Ga0157379_100337474 | 183 |
| 115 | 3300014968 | Ga0157379_10095191 | Ga0157379_100951912 | 183 |
| 116 | 3300014969 | Ga0157376_10244112 | Ga0157376_102441122 | 183 |
| 117 | 3300014969 | Ga0157376_10442040 | Ga0157376_104420402 | 183 |
| 118 | 3300020070 | Ga0206356_10600948 | Ga0206356_106009484 | 183 |
| 119 | 3300020075 | Ga0206349_1652994 | Ga0206349_16529941 | 183 |
| 120 | 3300020082 | Ga0206353_11139743 | Ga0206353_111397432 | 183 |
| 121 | 3300025321 | Ga0207656_10000314 | Ga0207656_1000031410 | 183 |
| 122 | 3300025321 | Ga0207656_10037458 | Ga0207656_100374582 | 183 |
| 123 | 3300025893 | Ga0207682_10000756 | Ga0207682_100007569 | 183 |
| 124 | 3300025900 | Ga0207710_10081226 | Ga0207710_100812263 | 183 |
| 125 | 3300025903 | Ga0207680_10008301 | Ga0207680_100083012 | 183 |
| 126 | 3300025908 | Ga0207643_10163733 | Ga0207643_101637332 | 183 |
| 127 | 3300025909 | Ga0207705_10041752 | Ga0207705_100417523 | 183 |
| 128 | 3300025911 | Ga0207654_10077084 | Ga0207654_100770842 | 183 |
| 129 | 3300025912 | Ga0207707_10020533 | Ga0207707_100205334 | 183 |
| 130 | 3300025915 | Ga0207693_10021324 | Ga0207693_100213244 | 183 |
| 131 | 3300025916 | Ga0207663_10423670 | Ga0207663_104236702 | 183 |
| 132 | 3300025917 | Ga0207660_10322535 | Ga0207660_103225352 | 183 |
| 133 | 3300025919 | Ga0207657_10321792 | Ga0207657_103217922 | 183 |
| 134 | 3300025920 | Ga0207649_10000333 | Ga0207649_1000033326 | 183 |
| 135 | 3300025921 | Ga0207652_10000854 | Ga0207652_100008544 | 183 |
| 136 | 3300025924 | Ga0207694_10000035 | Ga0207694_1000003537 | 183 |
| 137 | 3300025925 | Ga0207650_10057334 | Ga0207650_100573343 | 183 |
| 138 | 3300025926 | Ga0207659_10000054 | Ga0207659_1000005423 | 183 |
| 139 | 3300025927 | Ga0207687_10000027 | Ga0207687_1000002765 | 183 |
| 140 | 3300025928 | Ga0207700_10000013 | Ga0207700_10000013166 | 183 |
| 141 | 3300025929 | Ga0207664_10407393 | Ga0207664_104073932 | 183 |
| 142 | 3300025932 | Ga0207690_10003028 | Ga0207690_100030284 | 183 |
| 143 | 3300025934 | Ga0207686_10000440 | Ga0207686_1000044024 | 183 |
| 144 | 3300025944 | Ga0207661_10008279 | Ga0207661_100082794 | 183 |
| 145 | 3300025944 | Ga0207661_10040297 | Ga0207661_100402973 | 183 |
| 146 | 3300025944 | Ga0207661_10053213 | Ga0207661_100532134 | 183 |
| 147 | 3300025944 | Ga0207661_10075662 | Ga0207661_100756623 | 183 |
| 148 | 3300025945 | Ga0207679_10011056 | Ga0207679_100110564 | 183 |
| 149 | 3300025949 | Ga0207667_10402383 | Ga0207667_104023833 | 183 |
| 150 | 3300025961 | Ga0207712_10000033 | Ga0207712_10000033166 | 183 |
| 151 | 3300025961 | Ga0207712_10042335 | Ga0207712_100423355 | 183 |
| 152 | 3300025972 | Ga0207668_10021293 | Ga0207668_100212935 | 183 |
| 153 | 3300025981 | Ga0207640_10000140 | Ga0207640_1000014049 | 183 |
| 154 | 3300025986 | Ga0207658_10005912 | Ga0207658_100059127 | 183 |
| 155 | 3300025986 | Ga0207658_10176212 | Ga0207658_101762122 | 183 |
| 156 | 3300026023 | Ga0207677_10001509 | Ga0207677_100015094 | 183 |
| 157 | 3300026035 | Ga0207703_10000597 | Ga0207703_1000059743 | 183 |
| 158 | 3300026041 | Ga0207639_10204694 | Ga0207639_102046941 | 183 |
| 159 | 3300026078 | Ga0207702_10000737 | Ga0207702_1000073730 | 183 |
| 160 | 3300026116 | Ga0207674_10046568 | Ga0207674_100465683 | 183 |
| 161 | 3300026118 | Ga0207675_100475637 | Ga0207675_1004756372 | 183 |
| 162 | 3300026121 | Ga0207683_10070285 | Ga0207683_100702854 | 183 |
| 163 | 3300026142 | Ga0207698_10000044 | Ga0207698_1000004416 | 183 |
| 164 | 3300026142 | Ga0207698_10047805 | Ga0207698_100478052 | 183 |
| 165 | 3300028379 | Ga0268266_10000076 | Ga0268266_1000007644 | 183 |
| 166 | 3300028379 | Ga0268266_10001920 | Ga0268266_100019204 | 183 |
| 167 | 3300028379 | Ga0268266_10084798 | Ga0268266_100847983 | 183 |
| 168 | 3300028379 | Ga0268266_10368278 | Ga0268266_103682782 | 183 |
| 169 | 3300028380 | Ga0268265_10010484 | Ga0268265_100104845 | 183 |
| 170 | 3300028381 | Ga0268264_10214875 | Ga0268264_102148753 | 183 |
| 171 | 3300031731 | Ga0307405_10467210 | Ga0307405_104672102 | 183 |
| 172 | 3300032126 | Ga0307415_100014304 | Ga0307415_1000143044 | 183 |
| 173 | 3300035724 | Ga0373933_0618499 | Ga0373933_0618499_65_616 | 183 |
| 174 | 3300036401 | Ga0373937_0692766 | Ga0373937_0692766_248_799 | 183 |
| 175 | 3300044694 | Ga0466963_0000035 | Ga0466963_0000035_30603_31154 | 183 |
| 176 | 3300044694 | Ga0466963_0017737 | Ga0466963_0017737_425_976 | 183 |
| 177 | 3300044694 | Ga0466963_0074254 | Ga0466963_0074254_660_1214 | 183 |
| 178 | 3300045976 | Ga0466967_0155393 | Ga0466967_0155393_1011_1562 | 183 |
| 179 | 3300045976 | Ga0466967_1295222 | Ga0466967_1295222_102_656 | 183 |
| 180 | 3300046454 | Ga0495592_0040546 | Ga0495592_0040546_2414_2965 | 183 |
| 181 | 3300046461 | Ga0495641_0000001 | Ga0495641_0000001_322044_322595 | 183 |
| 182 | 3300046461 | Ga0495641_0014780 | Ga0495641_0014780_2658_3212 | 183 |
| 183 | 3300046463 | Ga0495653_0021594 | Ga0495653_0021594_1579_2130 | 183 |
| 184 | 3300046476 | Ga0495662_0000031 | Ga0495662_0000031_28704_29255 | 183 |
| 185 | 3300046511 | Ga0495608_0000021 | Ga0495608_0000021_166422_166976 | 183 |
| 186 | 3300046511 | Ga0495608_0094311 | Ga0495608_0094311_1239_1790 | 183 |
| 187 | 3300046512 | Ga0495610_0064548 | Ga0495610_0064548_30_584 | 183 |
| 188 | 3300046516 | Ga0495628_0215526 | Ga0495628_0215526_347_901 | 183 |
| 189 | 3300046517 | Ga0495630_0000053 | Ga0495630_0000053_22697_23251 | 183 |
| 190 | 3300046517 | Ga0495630_0047979 | Ga0495630_0047979_1900_2451 | 183 |
| 191 | 3300046529 | Ga0495652_0000022 | Ga0495652_0000022_53608_54159 | 183 |
| 192 | 3300046533 | Ga0495640_0003562 | Ga0495640_0003562_3320_3871 | 183 |
| 193 | 3300046535 | Ga0495586_0000608 | Ga0495586_0000608_2775_3326 | 183 |
| 194 | 3300046536 | Ga0495587_0453648 | Ga0495587_0453648_99_650 | 183 |
| 195 | 3300046559 | Ga0495667_0056080 | Ga0495667_0056080_1937_2488 | 183 |
| 196 | 3300046642 | Ga0495634_0133155 | Ga0495634_0133155_774_1325 | 183 |
| 197 | 3300046660 | Ga0495625_0000117 | Ga0495625_0000117_88189_88740 | 183 |
| 198 | 3300046660 | Ga0495625_0506986 | Ga0495625_0506986_65_616 | 183 |
| 199 | 3300046674 | Ga0495588_0000496 | Ga0495588_0000496_5239_5793 | 183 |
| 200 | 3300046675 | Ga0495657_0000019 | Ga0495657_0000019_166422_166976 | 183 |
| 201 | 3300046675 | Ga0495657_0013264 | Ga0495657_0013264_2199_2750 | 183 |
| 202 | 3300046678 | Ga0495599_0039139 | Ga0495599_0039139_2006_2557 | 183 |
| 203 | 3300046681 | Ga0495647_0000096 | Ga0495647_0000096_6298_6849 | 183 |
| 204 | 3300046681 | Ga0495647_0003681 | Ga0495647_0003681_607_1161 | 183 |
| 205 | 3300046684 | Ga0495669_0000045 | Ga0495669_0000045_69350_69901 | 183 |
| 206 | 3300046689 | Ga0495613_0000861 | Ga0495613_0000861_20490_21044 | 183 |
| 207 | 3300046690 | Ga0495624_0000085 | Ga0495624_0000085_19461_20012 | 183 |
| 208 | 3300046690 | Ga0495624_0000699 | Ga0495624_0000699_1438_1992 | 183 |
| 209 | 3300046690 | Ga0495624_0096769 | Ga0495624_0096769_868_1419 | 183 |
| 210 | 3300046691 | Ga0495670_0005477 | Ga0495670_0005477_497_1048 | 183 |
| 211 | 3300046694 | Ga0495649_0015120 | Ga0495649_0015120_3242_3793 | 183 |
| 212 | 3300046809 | Ga0495600_0009323 | Ga0495600_0009323_2941_3492 | 183 |
| 213 | 3300046809 | Ga0495600_0017169 | Ga0495600_0017169_3364_3918 | 183 |
| 214 | 3300047315 | Ga0495581_0094852 | Ga0495581_0094852_753_1304 | 183 |
| 215 | 3300047317 | Ga0495604_0001698 | Ga0495604_0001698_11925_12479 | 183 |
| 216 | 3300047317 | Ga0495604_0044651 | Ga0495604_0044651_2319_2873 | 183 |
| 217 | 3300047317 | Ga0495604_0726135 | Ga0495604_0726135_28_582 | 183 |
| 218 | 3300047319 | Ga0495674_0131492 | Ga0495674_0131492_846_1397 | 183 |
| 219 | 3300047321 | Ga0495676_0005949 | Ga0495676_0005949_4295_4846 | 183 |
| 220 | 3300047321 | Ga0495676_0167068 | Ga0495676_0167068_825_1379 | 183 |
| 221 | 3300047322 | Ga0495680_0230714 | Ga0495680_0230714_470_1021 | 183 |
| 222 | 3300047444 | Ga0495675_0000141 | Ga0495675_0000141_614_1168 | 183 |
| 223 | 3300047444 | Ga0495675_0033770 | Ga0495675_0033770_657_1208 | 183 |
| 224 | 3300047673 | Ga0495593_0031920 | Ga0495593_0031920_147_698 | 183 |
| 225 | 3300048088 | Ga0495602_0000008 | Ga0495602_0000008_231680_232285 | 183 |
| 226 | 3300048903 | Ga0496100_0000003 | Ga0496100_0000003_48764_49315 | 183 |
| 227 | 3300048904 | Ga0496101_0000003 | Ga0496101_0000003_48764_49315 | 183 |
| 228 | 3300048907 | Ga0496104_0000007 | Ga0496104_0000007_93480_94031 | 183 |
| 229 | 3300048907 | Ga0496104_0000120 | Ga0496104_0000120_57479_58030 | 183 |
| 230 | 3300048908 | Ga0496105_0000002 | Ga0496105_0000002_296419_296970 | 183 |
| 231 | 3300048908 | Ga0496105_0000020 | Ga0496105_0000020_14768_15319 | 183 |
| 232 | 3300048909 | Ga0496106_0000146 | Ga0496106_0000146_48754_49305 | 183 |
| 233 | 3300048910 | Ga0496107_0000026 | Ga0496107_0000026_48764_49315 | 183 |
| 234 | 3300048911 | Ga0496108_0000032 | Ga0496108_0000032_80994_81545 | 183 |
| 235 | 3300048911 | Ga0496108_0087856 | Ga0496108_0087856_2071_2625 | 183 |
| 236 | 3300048912 | Ga0496109_0000070 | Ga0496109_0000070_77386_77937 | 183 |
| 237 | 3300048912 | Ga0496109_0000884 | Ga0496109_0000884_1429_1983 | 183 |
| 238 | 3300048912 | Ga0496109_0624719 | Ga0496109_0624719_328_879 | 183 |
| 239 | 3300048913 | Ga0496110_0000003 | Ga0496110_0000003_37173_37727 | 183 |
| 240 | 3300048913 | Ga0496110_0015192 | Ga0496110_0015192_2697_3248 | 183 |
| 241 | 3300048913 | Ga0496110_0651865 | Ga0496110_0651865_291_842 | 183 |
| 242 | 3300048914 | Ga0496111_0000024 | Ga0496111_0000024_37158_37712 | 183 |
| 243 | 3300048922 | Ga0496119_0225644 | Ga0496119_0225644_158_709 | 183 |
| 244 | 3300048923 | Ga0496120_0009861 | Ga0496120_0009861_10_561 | 183 |
| 245 | 3300048928 | Ga0496125_0110556 | Ga0496125_0110556_856_1407 | 183 |
| 246 | 3300049578 | Ga0501042_0054259 | Ga0501042_0054259_1367_1918 | 183 |
| 247 | 3300049589 | Ga0501073_0674432 | Ga0501073_0674432_18_572 | 183 |
| 248 | 3300050509 | nmdc:mga0qj67_117584_c1 | nmdc:mga0qj67_117584_c1_238_789 | 183 |
| 249 | 3300050513 | nmdc:mga0rr50_445475_c1 | nmdc:mga0rr50_445475_c1_491_1042 | 183 |
| 250 | 3300053077 | Ga0495601_0000096 | Ga0495601_0000096_22903_23457 | 183 |
| 251 | 3300053078 | Ga0495612_0001210 | Ga0495612_0001210_1400_1987 | 183 |
| 252 | 3300053083 | Ga0495655_0008260 | Ga0495655_0008260_617_1171 | 183 |
| 253 | 3300053084 | Ga0495595_0000004 | Ga0495595_0000004_166422_166976 | 183 |
| 254 | 3300053084 | Ga0495595_0038007 | Ga0495595_0038007_542_1096 | 183 |
| 255 | 3300053085 | Ga0495619_0000080 | Ga0495619_0000080_1470_2024 | 183 |
| 256 | 3300053085 | Ga0495619_0000336 | Ga0495619_0000336_5810_6364 | 183 |
| 257 | 3300053096 | Ga0500641_0001689 | Ga0500641_0001689_5010_5561 | 183 |
| 258 | 3300053123 | Ga0500614_000204 | Ga0500614_000204_582_1133 | 183 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1wub-assembly1.cif.gz_A | crystal structure of the polyisoprenoid-binding protein, tt1927b, from thermus thermophilus hb8 | 0.9186 | 14 | 182 |
| 1wub-assembly1.cif.gz_A | crystal structure of the polyisoprenoid-binding protein, tt1927b, from thermus thermophilus hb8 | 0.8792 | 14 | 182 |
| 5ixh-assembly1.cif.gz_A | crystal structure of burkholderia cenocepacia bcna | 0.8763 | 17 | 177 |
| 1y0g-assembly2.cif.gz_D | crystal structure of the escherichia coli ycei protein, structural genomics | 0.8757 | 14 | 182 |
| 6w3w-assembly1.cif.gz_A | an enumerative algorithm for de novo design of proteins with diverse pocket structures | 0.8669 | 91 | 124 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1wubA00 | Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like | 0.9186 | 14 | 182 | 2.40.128.110 |
| af_Q2FUS9_3_167_2.40.128.110 | Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like | 0.8816 | 17 | 177 | 2.40.128.110 |
| af_P0A8X2_23_191_2.40.128.110 | Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like | 0.8812 | 14 | 182 | 2.40.128.110 |
| 1wubA00 | Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like | 0.8792 | 14 | 182 | 2.40.128.110 |
| af_P0A8X2_23_191_2.40.128.110 | Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like | 0.8712 | 14 | 182 | 2.40.128.110 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A838V6I3-F1-model_v4 | YceI family protein | 0.982 | 2 | 183 |
|
| AF-A0A537YKF7-F1-model_v4 | YceI family protein | 0.9732 | 1 | 183 |
|
| AF-A0A838V6I3-F1-model_v4 | YceI family protein | 0.9715 | 2 | 183 |
|
| AF-A0A7V9M6X5-F1-model_v4 | YceI family protein | 0.9711 | 12 | 182 |
|
| AF-A0A537YKF7-F1-model_v4 | YceI family protein | 0.9679 | 1 | 183 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar