F368300

General Info

Members Datasets Scaffolds Average Seq Length
258 175 516 375

Family's Representative Sequence

Representative Sequence 3300045836|Ga0466958_0020120|Ga0466958_0020120_2009_3295
Length 428
Sequence LVEFYNVLAVLDHASESRIREVDHVEQRETTRRQQGRRVGAPATAAREIEVRPVRGRSELSTFIRLPWRLYRDQANWVPPLLSERRRHLDRRRNPFFEHAEAEYFVARRDGLPVGRISAHVDHRLSEFQNDRWGLFGFFECERDPAVAAALFDSAERWLRARDRDPMIGPFDFTTNHECGLLVEGHGLPPQILENWHHPYYRQLFEGAGFVKAMDLYKWEIEPGDRGRMLPIIDELADRLEPEHGIRLRRMRRKDFEAEIRRFMEIYNEAWSDNWGFVPLTDAELKHMAKELRPVLDEDFAAVAETSDGEVAGVSLSLPDYNQILAHLNGRLLPLGWIKALTMRRKIDEIRVFALGVKPAYQHTGVAAALYRDVWDAVFRRGMKRAETGWILEGNTAMNRAMEALTGRVVKRYRIYERPLAPRAETAS

Samples

Sample ID Description Type Environment
1 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
34 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
35 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
36 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
37 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
38 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
39 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
40 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
43 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
44 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
49 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
54 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
61 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
62 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
63 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
64 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
96 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
98 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
99 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
100 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
101 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
102 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
103 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
104 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
105 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
106 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
107 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
108 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
109 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
110 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
111 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
112 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
113 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
114 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
115 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
116 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
117 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
118 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
119 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
120 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
121 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
122 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
123 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
124 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
125 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
126 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
127 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
128 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
129 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
130 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
131 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
132 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
133 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
134 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
135 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
136 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
137 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
138 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
139 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
140 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
141 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
142 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
143 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
144 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
145 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
146 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
147 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
148 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
149 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
150 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
155 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
156 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
157 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
158 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
159 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
160 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
161 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
162 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
163 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
164 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
165 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
166 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
167 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
168 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
169 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
170 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
171 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
172 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
173 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
174 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
175 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.14
Nodule 0
Rhizoplane 8.53
Rhizosphere 79.46
Stem 0
Stem Tuber 0
Unclassified 0.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466958_0020120 3300045836 Bacteria 3891
2 rootH1_10114760 3300003323 Bacteria 5473
3 Ga0070658_10107550 3300005327 Bacteria 2308
4 Ga0070658_10112080 3300005327 Bacteria 2261
5 Ga0070683_100029687 3300005329 Bacteria 4954
6 Ga0070683_100115098 3300005329 Bacteria 2538
7 Ga0070670_100202297 3300005331 Bacteria 1726
8 Ga0070680_100003289 3300005336 Bacteria 12060
9 Ga0068868_100025996 3300005338 Bacteria 4458
10 Ga0068868_100057500 3300005338 Bacteria 3073
11 Ga0070660_100002833 3300005339 Bacteria 11935
12 Ga0070660_100007911 3300005339 Bacteria 7417
13 Ga0070689_100062880 3300005340 Bacteria 2889
14 Ga0070661_100010684 3300005344 Bacteria 6387
15 Ga0070661_100032308 3300005344 Bacteria 3789
16 Ga0070692_10023750 3300005345 Bacteria 3007
17 Ga0070675_100014980 3300005354 Bacteria 6123
18 Ga0070674_100034951 3300005356 Bacteria 3362
19 Ga0070659_100001455 3300005366 Bacteria 17048
20 Ga0070659_100024123 3300005366 Bacteria 4661
21 Ga0070667_100249976 3300005367 Bacteria 1585
22 Ga0070705_100036907 3300005440 Bacteria 2752
23 Ga0070700_100083548 3300005441 Bacteria 2067
24 Ga0070663_100020279 3300005455 Bacteria 4399
25 Ga0070678_100009022 3300005456 Bacteria 6009
26 Ga0070662_100007957 3300005457 Bacteria 6896
27 Ga0070681_10028531 3300005458 Bacteria 5612
28 Ga0070681_10318252 3300005458 Bacteria 1465
29 Ga0068867_100054064 3300005459 Bacteria 2966
30 Ga0068867_100071186 3300005459 Bacteria 2601
31 Ga0070706_100188395 3300005467 Bacteria 1928
32 Ga0070679_100030165 3300005530 Bacteria 5353
33 Ga0070684_100012241 3300005535 Bacteria 6867
34 Ga0070684_100015500 3300005535 Bacteria 6209
35 Ga0070684_100027378 3300005535 Bacteria 4810
36 Ga0070693_100043290 3300005547 Bacteria 2542
37 Ga0070665_100031574 3300005548 Bacteria 5332
38 Ga0070664_100017766 3300005564 Bacteria 5843
39 Ga0070702_100052596 3300005615 Bacteria 2336
40 Ga0068852_100005572 3300005616 Bacteria 9028
41 Ga0068852_100054437 3300005616 Bacteria 3449
42 Ga0068864_100073618 3300005618 Bacteria 2978
43 Ga0068863_100126053 3300005841 Bacteria 2443
44 Ga0081455_10036984 3300005937 Bacteria 4340
45 Ga0081455_10076276 3300005937 Bacteria 2762
46 Ga0081455_10094032 3300005937 Bacteria 2422
47 Ga0081538_10045017 3300005981 Bacteria 2741
48 Ga0081540_1001015 3300005983 Bacteria 25170
49 Ga0075365_10003952 3300006038 Bacteria 7765
50 Ga0075365_10026379 3300006038 Bacteria 3688
51 Ga0075365_10114950 3300006038 Bacteria 1852
52 Ga0075363_100005919 3300006048 Bacteria 5509
53 Ga0075363_100038635 3300006048 Bacteria 2510
54 Ga0075364_10066295 3300006051 Bacteria 2372
55 Ga0075364_10080682 3300006051 Bacteria 2151
56 Ga0075364_10082177 3300006051 Bacteria 2131
57 Ga0075367_10052355 3300006178 Bacteria 2416
58 Ga0075367_10080461 3300006178 Bacteria 1970
59 Ga0097621_100097692 3300006237 Bacteria 2466
60 Ga0068871_100092214 3300006358 Bacteria 2526
61 Ga0075428_100088938 3300006844 Bacteria 3369
62 Ga0075431_100000639 3300006847 Bacteria 29649
63 Ga0068865_100008867 3300006881 Bacteria 6221
64 Ga0111539_10005952 3300009094 Bacteria 15751
65 Ga0111539_10056522 3300009094 Bacteria 4663
66 Ga0111539_10063906 3300009094 Bacteria 4355
67 Ga0105245_10008112 3300009098 Bacteria 9188
68 Ga0105245_10094726 3300009098 Bacteria 2753
69 Ga0114129_10125891 3300009147 Unclassified 3523
70 Ga0114129_10168425 3300009147 Bacteria 2988
71 Ga0105243_10017008 3300009148 Bacteria 5498
72 Ga0105243_10321601 3300009148 Bacteria 1410
73 Ga0105242_10124257 3300009176 Bacteria 2219
74 Ga0105238_10046096 3300009551 Bacteria 4401
75 Ga0105249_10056072 3300009553 Bacteria 3607
76 Ga0105249_10449314 3300009553 Bacteria 1327
77 Ga0105239_10052379 3300010375 Bacteria 4476
78 Ga0105239_10320628 3300010375 Bacteria 1747
79 Ga0105246_10075625 3300011119 Bacteria 2384
80 Ga0105246_10201022 3300011119 Bacteria 1549
81 Ga0157370_10004857 3300013104 Bacteria 15262
82 Ga0157369_10018671 3300013105 Bacteria 7774
83 Ga0157374_10317846 3300013296 Bacteria 1542
84 Ga0157374_10409725 3300013296 Bacteria 1353
85 Ga0163162_10175811 3300013306 Bacteria 2266
86 Ga0157372_10015654 3300013307 Bacteria 8132
87 Ga0157372_10183020 3300013307 Bacteria 2426
88 Ga0157372_10268792 3300013307 Bacteria 1981
89 Ga0157372_10457278 3300013307 Bacteria 1488
90 Ga0163163_10064182 3300014325 Bacteria 3643
91 Ga0157377_10016708 3300014745 Bacteria 3779
92 Ga0157376_10078028 3300014969 Bacteria 2835
93 Ga0213873_10010141 3300021358 Bacteria 1979
94 Ga0213876_10040008 3300021384 Bacteria 2476
95 Ga0213876_10043809 3300021384 Bacteria 2365
96 Ga0207688_10006520 3300025901 Bacteria 6354
97 Ga0207643_10032999 3300025908 Bacteria 2896
98 Ga0207707_10010774 3300025912 Bacteria 7944
99 Ga0207707_10081903 3300025912 Bacteria 2817
100 Ga0207671_10114515 3300025914 Bacteria 2055
101 Ga0207693_10002584 3300025915 Bacteria 15726
102 Ga0207660_10002251 3300025917 Bacteria 12748
103 Ga0207660_10284952 3300025917 Bacteria 1312
104 Ga0207657_10025925 3300025919 Bacteria 5397
105 Ga0207649_10148793 3300025920 Bacteria 1610
106 Ga0207652_10013550 3300025921 Bacteria 6595
107 Ga0207694_10023998 3300025924 Bacteria 4631
108 Ga0207659_10006237 3300025926 Bacteria 7293
109 Ga0207687_10024325 3300025927 Bacteria 4045
110 Ga0207687_10026164 3300025927 Bacteria 3906
111 Ga0207690_10007761 3300025932 Bacteria 6370
112 Ga0207706_10015324 3300025933 Bacteria 6929
113 Ga0207709_10020620 3300025935 Bacteria 3722
114 Ga0207709_10029363 3300025935 Bacteria 3189
115 Ga0207669_10080326 3300025937 Bacteria 2085
116 Ga0207661_10001028 3300025944 Bacteria 18500
117 Ga0207679_10021732 3300025945 Bacteria 4356
118 Ga0207651_10022612 3300025960 Bacteria 3849
119 Ga0207651_10060015 3300025960 Bacteria 2638
120 Ga0207712_10143340 3300025961 Bacteria 1836
121 Ga0207640_10053683 3300025981 Bacteria 2632
122 Ga0207658_10140569 3300025986 Bacteria 1953
123 Ga0207677_10010471 3300026023 Bacteria 5247
124 Ga0207639_10191167 3300026041 Bacteria 1749
125 Ga0207678_10039172 3300026067 Bacteria 4114
126 Ga0207708_10032144 3300026075 Bacteria 3986
127 Ga0207641_10160710 3300026088 Bacteria 2042
128 Ga0207648_10072919 3300026089 Bacteria 2992
129 Ga0207676_10061452 3300026095 Bacteria 2975
130 Ga0207683_10014501 3300026121 Bacteria 6711
131 Ga0207683_10111844 3300026121 Bacteria 2445
132 Ga0207698_10041253 3300026142 Bacteria 3437
133 Ga0207428_10011051 3300027907 Bacteria 8021
134 Ga0268266_10050462 3300028379 Bacteria 3570
135 Ga0268266_10184463 3300028379 Bacteria 1902
136 Ga0265337_1003501 3300028556 Bacteria 6786
137 Ga0265334_10007747 3300028573 Bacteria 4600
138 Ga0265322_10000611 3300028654 Bacteria 13519
139 Ga0265320_10000203 3300031240 Bacteria 48715
140 Ga0265339_10039327 3300031249 Bacteria 2634
141 Ga0265314_10005502 3300031711 Bacteria 11412
142 Ga0307410_10112856 3300031852 Bacteria 1969
143 Ga0307406_10255669 3300031901 Bacteria 1322
144 Ga0307409_100232671 3300031995 Bacteria 1672
145 Ga0373943_0045551 3300035170 Bacteria 2138
146 Ga0316574_0024605 3300035398 Bacteria 3606
147 Ga0373931_0075997 3300035691 Bacteria 1844
148 Ga0373937_0029072 3300036401 Bacteria 5004
149 Ga0316584_0122858 3300036712 Bacteria 1940
150 Ga0395899_0032603 3300037312 Bacteria 3914
151 Ga0395900_0006427 3300037418 Bacteria 12247
152 Ga0395900_0109322 3300037418 Bacteria 2840
153 Ga0395900_0146427 3300037418 Bacteria 2415
154 Ga0395898_0002176 3300037466 Bacteria 24003
155 Ga0395898_0026722 3300037466 Bacteria 5802
156 Ga0395905_0002315 3300037471 Bacteria 21325
157 Ga0395905_0005949 3300037471 Bacteria 12357
158 Ga0395905_0104390 3300037471 Bacteria 2661
159 Ga0395901_0007020 3300038443 Bacteria 11384
160 Ga0395901_0041476 3300038443 Bacteria 4770
161 Ga0395901_0070243 3300038443 Bacteria 3648
162 Ga0400483_014212 3300039062 Unclassified 1927
163 Ga0436365_0371798 3300039437 Bacteria 4466
164 Ga0436365_0867201 3300039437 Bacteria 11980
165 Ga0436365_1023867 3300039437 Bacteria 6071
166 Ga0436363_1479403 3300039450 Bacteria 1387
167 Ga0436362_1231669 3300039453 Bacteria 3422
168 Ga0451853_0488346 3300041512 Bacteria 1205
169 Ga0451577_0000616 3300042876 Bacteria 57266
170 Ga0451577_0001063 3300042876 Bacteria 39602
171 Ga0451577_0019615 3300042876 Bacteria 6216
172 Ga0451577_0030951 3300042876 Bacteria 4831
173 Ga0451577_0215779 3300042876 Bacteria 1734
174 Ga0466969_0013630 3300044656 Bacteria 4280
175 Ga0453683_0003731 3300044673 Bacteria 11116
176 Ga0453683_0048436 3300044673 Bacteria 2666
177 Ga0466965_0018021 3300044683 Bacteria 3380
178 Ga0466966_0066460 3300044684 Bacteria 2266
179 Ga0466961_0001948 3300044693 Bacteria 12866
180 Ga0466961_0030379 3300044693 Bacteria 3472
181 Ga0466961_0059536 3300044693 Bacteria 2429
182 Ga0466963_0000992 3300044694 Bacteria 14630
183 Ga0466963_0001716 3300044694 Bacteria 11923
184 Ga0466963_0029234 3300044694 Bacteria 3545
185 Ga0453684_0000039 3300044712 Bacteria 697730
186 Ga0453684_0008184 3300044712 Bacteria 18860
187 Ga0453684_0270161 3300044712 Bacteria 1943
188 Ga0466968_0008596 3300044735 Bacteria 3913
189 Ga0466957_0033309 3300044842 Bacteria 3091
190 Ga0466957_0059112 3300044842 Bacteria 2349
191 Ga0466959_0008175 3300045049 Bacteria 7383
192 Ga0466959_0042214 3300045049 Bacteria 3364
193 Ga0451576_0002836 3300045051 Bacteria 24930
194 Ga0451576_0043120 3300045051 Bacteria 4761
195 Ga0451576_0082616 3300045051 Bacteria 3341
196 Ga0495603_0073304 3300046455 Bacteria 2012
197 Ga0495664_0059980 3300046477 Bacteria 2265
198 Ga0495628_0060173 3300046516 Bacteria 2981
199 Ga0495600_0016398 3300046809 Bacteria 4702
200 Ga0496101_0004318 3300048904 Bacteria 8924
201 Ga0496102_0004667 3300048905 Bacteria 11591
202 Ga0496103_0002638 3300048906 Bacteria 11231
203 Ga0496105_0044676 3300048908 Bacteria 3654
204 Ga0496106_0028049 3300048909 Bacteria 4192
205 Ga0496108_0014983 3300048911 Bacteria 6328
206 Ga0496108_0046279 3300048911 Bacteria 3635
207 Ga0496109_0012826 3300048912 Bacteria 7244
208 Ga0496109_0029329 3300048912 Bacteria 4928
209 Ga0496109_0061875 3300048912 Bacteria 3423
210 Ga0496109_0120343 3300048912 Bacteria 2446
211 Ga0496110_0031274 3300048913 Bacteria 4592
212 Ga0496110_0040377 3300048913 Bacteria 4067
213 Ga0496110_0157816 3300048913 Bacteria 2055
214 Ga0496111_0018339 3300048914 Bacteria 4847
215 Ga0496112_0087447 3300048915 Bacteria 3083
216 Ga0496112_0232064 3300048915 Bacteria 1800
217 Ga0496113_0012105 3300048916 Bacteria 5787
218 Ga0496113_0091517 3300048916 Bacteria 2345
219 Ga0496113_0102695 3300048916 Bacteria 2217
220 Ga0496113_0308732 3300048916 Bacteria 1267
221 Ga0496114_0004346 3300048917 Bacteria 10965
222 Ga0496121_0052235 3300048924 Bacteria 3435
223 Ga0501031_0173138 3300049568 Bacteria 1410
224 Ga0501034_0265542 3300049571 Bacteria 1658
225 Ga0501041_0068266 3300049577 Bacteria 2179
226 Ga0501048_0201359 3300049582 Bacteria 1411
227 Ga0501071_0105925 3300049587 Bacteria 2076
228 Ga0501072_0062561 3300049588 Bacteria 2936
229 Ga0501072_0067797 3300049588 Bacteria 2816
230 Ga0501074_0032638 3300049590 Bacteria 3771
231 Ga0501074_0068362 3300049590 Bacteria 2554
232 Ga0501075_0048811 3300049591 Bacteria 3181
233 Ga0501076_0044599 3300049592 Bacteria 3497
234 Ga0501077_0038821 3300049593 Bacteria 3032
235 Ga0501079_0129452 3300049741 Bacteria 1964
236 Ga0501080_0223031 3300049742 Bacteria 1724
237 Ga0501081_0049067 3300049743 Bacteria 2906
238 Ga0501045_0187815 3300049824 Bacteria 1540
239 nmdc:mga03n38_41192_c1 3300050490 Bacteria 2011
240 nmdc:mga03n38_42401_c1 3300050490 Bacteria 1989
241 nmdc:mga00v17_166505_c1 3300050491 Bacteria 1420
242 nmdc:mga00v17_4802_c1 3300050491 Bacteria 7074
243 nmdc:mga0yw44_111421_c1 3300050492 Bacteria 1754
244 nmdc:mga0yw44_2343_c1 3300050492 Bacteria 8027
245 nmdc:mga0yw44_3780_c1 3300050492 Bacteria 6795
246 nmdc:mga0yw44_53414_c1 3300050492 Bacteria 2454
247 nmdc:mga0yw44_80695_c1 3300050492 Bacteria 2038
248 nmdc:mga06z11_52745_c1 3300050494 Bacteria 2088
249 nmdc:mga06r32_6224_c1 3300050510 Bacteria 10713
250 nmdc:mga08y16_46527_c1 3300050511 Bacteria 4542
251 nmdc:mga08y16_48712_c1 3300050511 Bacteria 4434
252 nmdc:mga08y16_8203_c1 3300050511 Bacteria 10930
253 nmdc:mga0n895_9396_c1 3300050512 Bacteria 8555
254 Ga0495612_0000655 3300053078 Bacteria 13936
255 Ga0495619_0001274 3300053085 Bacteria 16546
256 Ga0500614_008818 3300053123 Bacteria 2144
257 Ga0501082_0040922 3300060353 Bacteria 3996
258 Ga0530510_0122963 3300061734 Bacteria 1906
259 Ga0466958_0020120
260 rootH1_10114760
261 Ga0070658_10107550
262 Ga0070658_10112080
263 Ga0070683_100029687
264 Ga0070683_100115098
265 Ga0070670_100202297
266 Ga0070680_100003289
267 Ga0068868_100025996
268 Ga0068868_100057500
269 Ga0070660_100002833
270 Ga0070660_100007911
271 Ga0070689_100062880
272 Ga0070661_100010684
273 Ga0070661_100032308
274 Ga0070692_10023750
275 Ga0070675_100014980
276 Ga0070674_100034951
277 Ga0070659_100001455
278 Ga0070659_100024123
279 Ga0070667_100249976
280 Ga0070705_100036907
281 Ga0070700_100083548
282 Ga0070663_100020279
283 Ga0070678_100009022
284 Ga0070662_100007957
285 Ga0070681_10028531
286 Ga0070681_10318252
287 Ga0068867_100054064
288 Ga0068867_100071186
289 Ga0070706_100188395
290 Ga0070679_100030165
291 Ga0070684_100012241
292 Ga0070684_100015500
293 Ga0070684_100027378
294 Ga0070693_100043290
295 Ga0070665_100031574
296 Ga0070664_100017766
297 Ga0070702_100052596
298 Ga0068852_100005572
299 Ga0068852_100054437
300 Ga0068864_100073618
301 Ga0068863_100126053
302 Ga0081455_10036984
303 Ga0081455_10076276
304 Ga0081455_10094032
305 Ga0081538_10045017
306 Ga0081540_1001015
307 Ga0075365_10003952
308 Ga0075365_10026379
309 Ga0075365_10114950
310 Ga0075363_100005919
311 Ga0075363_100038635
312 Ga0075364_10066295
313 Ga0075364_10080682
314 Ga0075364_10082177
315 Ga0075367_10052355
316 Ga0075367_10080461
317 Ga0097621_100097692
318 Ga0068871_100092214
319 Ga0075428_100088938
320 Ga0075431_100000639
321 Ga0068865_100008867
322 Ga0111539_10005952
323 Ga0111539_10056522
324 Ga0111539_10063906
325 Ga0105245_10008112
326 Ga0105245_10094726
327 Ga0114129_10125891
328 Ga0114129_10168425
329 Ga0105243_10017008
330 Ga0105243_10321601
331 Ga0105242_10124257
332 Ga0105238_10046096
333 Ga0105249_10056072
334 Ga0105249_10449314
335 Ga0105239_10052379
336 Ga0105239_10320628
337 Ga0105246_10075625
338 Ga0105246_10201022
339 Ga0157370_10004857
340 Ga0157369_10018671
341 Ga0157374_10317846
342 Ga0157374_10409725
343 Ga0163162_10175811
344 Ga0157372_10015654
345 Ga0157372_10183020
346 Ga0157372_10268792
347 Ga0157372_10457278
348 Ga0163163_10064182
349 Ga0157377_10016708
350 Ga0157376_10078028
351 Ga0213873_10010141
352 Ga0213876_10040008
353 Ga0213876_10043809
354 Ga0207688_10006520
355 Ga0207643_10032999
356 Ga0207707_10010774
357 Ga0207707_10081903
358 Ga0207671_10114515
359 Ga0207693_10002584
360 Ga0207660_10002251
361 Ga0207660_10284952
362 Ga0207657_10025925
363 Ga0207649_10148793
364 Ga0207652_10013550
365 Ga0207694_10023998
366 Ga0207659_10006237
367 Ga0207687_10024325
368 Ga0207687_10026164
369 Ga0207690_10007761
370 Ga0207706_10015324
371 Ga0207709_10020620
372 Ga0207709_10029363
373 Ga0207669_10080326
374 Ga0207661_10001028
375 Ga0207679_10021732
376 Ga0207651_10022612
377 Ga0207651_10060015
378 Ga0207712_10143340
379 Ga0207640_10053683
380 Ga0207658_10140569
381 Ga0207677_10010471
382 Ga0207639_10191167
383 Ga0207678_10039172
384 Ga0207708_10032144
385 Ga0207641_10160710
386 Ga0207648_10072919
387 Ga0207676_10061452
388 Ga0207683_10014501
389 Ga0207683_10111844
390 Ga0207698_10041253
391 Ga0207428_10011051
392 Ga0268266_10050462
393 Ga0268266_10184463
394 Ga0265337_1003501
395 Ga0265334_10007747
396 Ga0265322_10000611
397 Ga0265320_10000203
398 Ga0265339_10039327
399 Ga0265314_10005502
400 Ga0307410_10112856
401 Ga0307406_10255669
402 Ga0307409_100232671
403 Ga0373943_0045551
404 Ga0316574_0024605
405 Ga0373931_0075997
406 Ga0373937_0029072
407 Ga0316584_0122858
408 Ga0395899_0032603
409 Ga0395900_0006427
410 Ga0395900_0109322
411 Ga0395900_0146427
412 Ga0395898_0002176
413 Ga0395898_0026722
414 Ga0395905_0002315
415 Ga0395905_0005949
416 Ga0395905_0104390
417 Ga0395901_0007020
418 Ga0395901_0041476
419 Ga0395901_0070243
420 Ga0400483_014212
421 Ga0436365_0371798
422 Ga0436365_0867201
423 Ga0436365_1023867
424 Ga0436363_1479403
425 Ga0436362_1231669
426 Ga0451853_0488346
427 Ga0451577_0000616
428 Ga0451577_0001063
429 Ga0451577_0019615
430 Ga0451577_0030951
431 Ga0451577_0215779
432 Ga0466969_0013630
433 Ga0453683_0003731
434 Ga0453683_0048436
435 Ga0466965_0018021
436 Ga0466966_0066460
437 Ga0466961_0001948
438 Ga0466961_0030379
439 Ga0466961_0059536
440 Ga0466963_0000992
441 Ga0466963_0001716
442 Ga0466963_0029234
443 Ga0453684_0000039
444 Ga0453684_0008184
445 Ga0453684_0270161
446 Ga0466968_0008596
447 Ga0466957_0033309
448 Ga0466957_0059112
449 Ga0466959_0008175
450 Ga0466959_0042214
451 Ga0451576_0002836
452 Ga0451576_0043120
453 Ga0451576_0082616
454 Ga0495603_0073304
455 Ga0495664_0059980
456 Ga0495628_0060173
457 Ga0495600_0016398
458 Ga0496101_0004318
459 Ga0496102_0004667
460 Ga0496103_0002638
461 Ga0496105_0044676
462 Ga0496106_0028049
463 Ga0496108_0014983
464 Ga0496108_0046279
465 Ga0496109_0012826
466 Ga0496109_0029329
467 Ga0496109_0061875
468 Ga0496109_0120343
469 Ga0496110_0031274
470 Ga0496110_0040377
471 Ga0496110_0157816
472 Ga0496111_0018339
473 Ga0496112_0087447
474 Ga0496112_0232064
475 Ga0496113_0012105
476 Ga0496113_0091517
477 Ga0496113_0102695
478 Ga0496113_0308732
479 Ga0496114_0004346
480 Ga0496121_0052235
481 Ga0501031_0173138
482 Ga0501034_0265542
483 Ga0501041_0068266
484 Ga0501048_0201359
485 Ga0501071_0105925
486 Ga0501072_0062561
487 Ga0501072_0067797
488 Ga0501074_0032638
489 Ga0501074_0068362
490 Ga0501075_0048811
491 Ga0501076_0044599
492 Ga0501077_0038821
493 Ga0501079_0129452
494 Ga0501080_0223031
495 Ga0501081_0049067
496 Ga0501045_0187815
497 nmdc:mga03n38_41192_c1
498 nmdc:mga03n38_42401_c1
499 nmdc:mga00v17_166505_c1
500 nmdc:mga00v17_4802_c1
501 nmdc:mga0yw44_111421_c1
502 nmdc:mga0yw44_2343_c1
503 nmdc:mga0yw44_3780_c1
504 nmdc:mga0yw44_53414_c1
505 nmdc:mga0yw44_80695_c1
506 nmdc:mga06z11_52745_c1
507 nmdc:mga06r32_6224_c1
508 nmdc:mga08y16_46527_c1
509 nmdc:mga08y16_48712_c1
510 nmdc:mga08y16_8203_c1
511 nmdc:mga0n895_9396_c1
512 Ga0495612_0000655
513 Ga0495619_0001274
514 Ga0500614_008818
515 Ga0501082_0040922
516 Ga0530510_0122963

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

260

407

0.63

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ypu-assembly2.cif.gz_D orfe-coa-glycylthricin complex 0.8184 64 130
1y9w-assembly1.cif.gz_B structural genomics, 1.9a crystal structure of an acetyltransferase from bacillus cereus atcc 14579 0.7632 62 130
2vbq-assembly1.cif.gz_A structure of aac(6')-iy in complex with bisubstrate analog coa-s- monomethyl-acetylneamine. 0.7613 206 372
1s60-assembly1.cif.gz_A-2 aminoglycoside n-acetyltransferase aac(6')-iy in complex with coa and n-terminal his(6)-tag (crystal form 2) 0.7611 206 372
2c27-assembly1.cif.gz_A the structure of mycothiol synthase in complex with des- acetylmycothiol and coenzymea. 0.7338 12 382
ID Description Score Start End Superfamily
af_Q46840_21_390_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9501 14 386 3.40.630.30
af_Q46840_21_390_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9476 14 386 3.40.630.30
af_B4FRF5_210_282_3.30.160.20 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.8789 64 80 3.30.160.20
af_A4HW91_407_525_2.60.40.150 Mainly Beta;Sandwich;Immunoglobulin-like;C2 domain 0.8046 63 84 2.60.40.150
af_Q54LZ9_6_162_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.7825 204 372 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A017T104-F1-model_v4 N-acetyltransferase domain-containing protein 0.9858 10 386 GO:0016747
AF-A0A061QCP9-F1-model_v4 N-acetyltransferase domain-containing protein 0.9813 10 386
AF-A0A017T104-F1-model_v4 N-acetyltransferase domain-containing protein 0.9806 10 386 GO:0016747
AF-A0A1V5XT95-F1-model_v4 N-acetyltransferase domain-containing protein 0.9797 10 386
AF-A0A061QCP9-F1-model_v4 N-acetyltransferase domain-containing protein 0.9761 10 386

Map