F368190

General Info

Members Datasets Scaffolds Average Seq Length
258 164 516 328

Family's Representative Sequence

Representative Sequence 3300031691|Ga0316579_10033873|Ga0316579_100338732
Length 345
Sequence MSTKTAPKGKTRIAVLGAGSWGTTLALLLDGNGHTVVLWEYFSELAASITAKRRNDRFLPGIRIPRSIRVTDDLDGALDGASHVLFVVPSHTVRSVARAVAASSSFDRSLTVINASKGLEEKTLCRMSEVLADELPQPSSRIVGLLGPSHAEEVSRKMPTSVVVAXXXXAVLASIQSIFMNEYFRVYTNTDLVGVELGVSLKNTIAIAAGICDGLGFGDNTKAALLTRGLAEIKRLASRMGAREETLSGLAGVGDLIVTCMSRHSRNRHVGEQIGRGKKLPQILAEMVMVAEGVKTTKAAVALSRRMRVEMPIAEQVYRVLFYNKDPRKAIRDLMVRKAKREMYR

Samples

Sample ID Description Type Environment
1 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
26 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
35 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
36 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
38 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
39 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
40 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
41 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
42 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
48 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
49 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
52 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
58 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
59 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
60 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
61 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
80 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
82 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
83 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
84 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
85 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
86 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
87 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
88 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
89 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
90 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
91 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
92 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
93 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
94 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
95 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
96 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
97 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
98 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
99 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
100 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
101 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
102 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
103 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
104 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
105 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
106 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
107 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
108 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
109 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
110 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
111 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
112 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
113 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
114 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
115 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
116 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
117 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
118 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
119 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
120 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
121 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
122 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
123 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
124 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
125 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
126 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
127 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
128 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
129 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
130 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
131 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
132 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
133 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
134 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
135 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
136 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
137 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
138 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
139 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
140 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
147 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
148 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
149 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
150 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
151 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
152 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
153 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
154 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
155 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
156 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
157 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
158 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
159 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
160 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
161 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
162 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
163 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
164 2671180531 Gemmata sp. SH-PL17 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.61
Metatranscriptomes 0
Isolates 0.39

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.39
Nodule 0
Rhizoplane 5.43
Rhizosphere 92.64
Stem 0
Stem Tuber 0
Unclassified 3.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0316579_10033873 3300031691 Bacteria 2347
2 Ga0070690_100010138 3300005330 Bacteria 5474
3 Ga0070670_100000207 3300005331 Bacteria 54657
4 Ga0070666_10003775 3300005335 Bacteria 9184
5 Ga0068868_100000724 3300005338 Bacteria 22276
6 Ga0070689_100004576 3300005340 Bacteria 9367
7 Ga0070689_100010461 3300005340 Bacteria 6612
8 Ga0070689_100090017 3300005340 Bacteria 2417
9 Ga0070689_100332893 3300005340 Bacteria 1270
10 Ga0070687_100003306 3300005343 Bacteria 6233
11 Ga0070687_100062300 3300005343 Unclassified 1974
12 Ga0070661_100012774 3300005344 Bacteria 5880
13 Ga0070675_100034705 3300005354 Bacteria 4095
14 Ga0070671_100073362 3300005355 Bacteria 2858
15 Ga0070671_100274495 3300005355 Bacteria 1433
16 Ga0070673_100019399 3300005364 Bacteria 4881
17 Ga0070688_100003457 3300005365 Bacteria 8128
18 Ga0070688_100118686 3300005365 Bacteria 1768
19 Ga0070667_100014037 3300005367 Bacteria 6621
20 Ga0070701_10034261 3300005438 Bacteria 2542
21 Ga0070711_100144077 3300005439 Bacteria 1790
22 Ga0070705_100141565 3300005440 Bacteria 1583
23 Ga0070694_100065249 3300005444 Bacteria 2494
24 Ga0070694_100130220 3300005444 Bacteria 1816
25 Ga0070678_100006392 3300005456 Bacteria 6913
26 Ga0068867_100105002 3300005459 Bacteria 2163
27 Ga0070685_10058693 3300005466 Bacteria 2244
28 Ga0070707_100135395 3300005468 Bacteria 2396
29 Ga0070707_100246217 3300005468 Bacteria 1740
30 Ga0070698_100048784 3300005471 Bacteria 4326
31 Ga0070697_100086717 3300005536 Bacteria 2584
32 Ga0070672_100002719 3300005543 Bacteria 11314
33 Ga0070695_100001649 3300005545 Bacteria 12533
34 Ga0070704_100086020 3300005549 Bacteria 2328
35 Ga0070704_100190161 3300005549 Bacteria 1650
36 Ga0070704_100289700 3300005549 Bacteria 1360
37 Ga0070664_100001854 3300005564 Bacteria 16923
38 Ga0068857_100224104 3300005577 Bacteria 1718
39 Ga0068859_100085382 3300005617 Bacteria 3202
40 Ga0068864_100028497 3300005618 Bacteria 4721
41 Ga0068864_100329188 3300005618 Bacteria 1437
42 Ga0068861_100098081 3300005719 Bacteria 2326
43 Ga0068863_100014094 3300005841 Bacteria 7701
44 Ga0068863_100080573 3300005841 Bacteria 3084
45 Ga0068863_100103695 3300005841 Bacteria 2705
46 Ga0068860_100186545 3300005843 Bacteria 2006
47 Ga0070715_10034477 3300006163 Bacteria 2075
48 Ga0075367_10086892 3300006178 Bacteria 1898
49 Ga0097621_100034389 3300006237 Bacteria 4044
50 Ga0097621_100145579 3300006237 Bacteria 2028
51 Ga0097621_100202600 3300006237 Bacteria 1723
52 Ga0097621_100239156 3300006237 Bacteria 1587
53 Ga0075428_100004878 3300006844 Bacteria 14888
54 Ga0075430_100255084 3300006846 Bacteria 1453
55 Ga0075431_100012157 3300006847 Bacteria 8685
56 Ga0075433_10003742 3300006852 Bacteria 11771
57 Ga0075434_100000148 3300006871 Bacteria 42965
58 Ga0075434_100029674 3300006871 Bacteria 5382
59 Ga0075434_100041865 3300006871 Bacteria 4539
60 Ga0075434_100112261 3300006871 Bacteria 2737
61 Ga0075429_100000262 3300006880 Bacteria 36688
62 Ga0097620_100085383 3300006931 Bacteria 3202
63 Ga0075435_100002494 3300007076 Bacteria 12232
64 Ga0111539_10004440 3300009094 Bacteria 18328
65 Ga0111539_10025307 3300009094 Bacteria 7275
66 Ga0111539_10099795 3300009094 Bacteria 3409
67 Ga0111539_10112089 3300009094 Bacteria 3200
68 Ga0111539_10153404 3300009094 Bacteria 2696
69 Ga0111539_10157397 3300009094 Bacteria 2658
70 Ga0111539_10209842 3300009094 Bacteria 2269
71 Ga0114129_10044226 3300009147 Bacteria 6264
72 Ga0114129_10052726 3300009147 Bacteria 5709
73 Ga0105243_10030697 3300009148 Bacteria 4140
74 Ga0105241_10082228 3300009174 Bacteria 2524
75 Ga0105242_10263688 3300009176 Bacteria 1557
76 Ga0105242_10293154 3300009176 Bacteria 1482
77 Ga0105248_10004704 3300009177 Bacteria 15098
78 Ga0105237_10016383 3300009545 Bacteria 7704
79 Ga0157378_10006496 3300013297 Bacteria 10221
80 Ga0163162_10002123 3300013306 Bacteria 18627
81 Ga0157372_10016783 3300013307 Bacteria 7860
82 Ga0157375_10010182 3300013308 Bacteria 8276
83 Ga0163163_10061802 3300014325 Bacteria 3711
84 Ga0163163_10076127 3300014325 Bacteria 3350
85 Ga0157377_10045529 3300014745 Bacteria 2451
86 Ga0157379_10007653 3300014968 Bacteria 9352
87 Ga0157376_10007505 3300014969 Bacteria 7792
88 Ga0157376_10522722 3300014969 Bacteria 1170
89 Ga0213875_10000141 3300021388 Bacteria 78084
90 Ga0207680_10012030 3300025903 Bacteria 4397
91 Ga0207662_10000189 3300025918 Bacteria 28915
92 Ga0207662_10091198 3300025918 Unclassified 1874
93 Ga0207662_10097207 3300025918 Bacteria 1820
94 Ga0207650_10002070 3300025925 Bacteria 14019
95 Ga0207659_10017088 3300025926 Bacteria 4734
96 Ga0207644_10007623 3300025931 Bacteria 7057
97 Ga0207709_10082969 3300025935 Bacteria 2071
98 Ga0207670_10000370 3300025936 Bacteria 25957
99 Ga0207670_10007547 3300025936 Bacteria 6078
100 Ga0207670_10290550 3300025936 Bacteria 1277
101 Ga0207691_10014953 3300025940 Bacteria 7392
102 Ga0207711_10003308 3300025941 Bacteria 14001
103 Ga0207689_10139419 3300025942 Bacteria 1997
104 Ga0207651_10016949 3300025960 Bacteria 4288
105 Ga0207651_10257381 3300025960 Bacteria 1431
106 Ga0207677_10007599 3300026023 Bacteria 6012
107 Ga0207641_10013721 3300026088 Bacteria 6647
108 Ga0207641_10055569 3300026088 Bacteria 3362
109 Ga0207648_10027432 3300026089 Bacteria 5055
110 Ga0207648_10144881 3300026089 Bacteria 2095
111 Ga0207676_10008077 3300026095 Bacteria 7479
112 Ga0207676_10074014 3300026095 Bacteria 2743
113 Ga0207674_10245044 3300026116 Bacteria 1739
114 Ga0207675_100054441 3300026118 Bacteria 3732
115 Ga0207683_10002129 3300026121 Bacteria 17399
116 Ga0207683_10162762 3300026121 Bacteria 2018
117 Ga0207428_10014888 3300027907 Bacteria 6738
118 Ga0207428_10062066 3300027907 Bacteria 2956
119 Ga0268264_10069385 3300028381 Bacteria 2981
120 Ga0268264_10183575 3300028381 Bacteria 1902
121 Ga0265319_1015272 3300028563 Bacteria 2983
122 Ga0265319_1030896 3300028563 Bacteria 1869
123 Ga0265323_10000014 3300028653 Bacteria 106540
124 Ga0265323_10022734 3300028653 Bacteria 2395
125 Ga0265323_10051761 3300028653 Bacteria 1455
126 Ga0265322_10000677 3300028654 Bacteria 12619
127 Ga0265330_10024222 3300031235 Bacteria 2753
128 Ga0265328_10000034 3300031239 Bacteria 99505
129 Ga0265320_10003109 3300031240 Bacteria 11271
130 Ga0265320_10034174 3300031240 Bacteria 2589
131 Ga0265331_10000024 3300031250 Bacteria 235118
132 Ga0265331_10004122 3300031250 Bacteria 9123
133 Ga0265327_10000079 3300031251 Bacteria 206892
134 Ga0265327_10020601 3300031251 Bacteria 4009
135 Ga0265316_10002595 3300031344 Bacteria 18652
136 Ga0265316_10289617 3300031344 Unclassified 1195
137 Ga0265314_10119677 3300031711 Bacteria 1660
138 Ga0265342_10059718 3300031712 Bacteria 2251
139 Ga0316578_10021263 3300031728 Bacteria 3600
140 Ga0316577_10008560 3300031733 Bacteria 5487
141 Ga0316585_10008924 3300032137 Bacteria 2913
142 Ga0373934_0000419 3300035086 Bacteria 14852
143 Ga0373953_0025189 3300035117 Bacteria 2270
144 Ga0373953_0027978 3300035117 Bacteria 2170
145 Ga0373953_0121410 3300035117 Bacteria 1110
146 Ga0373954_0004543 3300035118 Bacteria 5977
147 Ga0373956_0002953 3300035119 Bacteria 6880
148 Ga0373957_0002599 3300035120 Bacteria 5180
149 Ga0373957_0022148 3300035120 Bacteria 2262
150 Ga0373955_0036366 3300035172 Bacteria 2612
151 Ga0373933_0009173 3300035724 Bacteria 5399
152 Ga0373933_0054504 3300035724 Bacteria 2397
153 Ga0373947_0175085 3300035725 Bacteria 1394
154 Ga0373937_0041480 3300036401 Bacteria 4197
155 Ga0373937_0064862 3300036401 Bacteria 3361
156 Ga0373937_0584475 3300036401 Bacteria 1060
157 Ga0316582_0085031 3300036647 Bacteria 2072
158 Ga0316584_0004494 3300036712 Bacteria 9233
159 Ga0316581_0008873 3300037588 Bacteria 2749
160 Ga0436364_0487252 3300037853 Bacteria 953
161 Ga0436364_1332997 3300037853 Bacteria 379560
162 Ga0451577_0009209 3300042876 Bacteria 9522
163 Ga0451577_0040874 3300042876 Bacteria 4163
164 Ga0451577_0075063 3300042876 Bacteria 3015
165 Ga0451577_0146594 3300042876 Bacteria 2123
166 Ga0451577_0226541 3300042876 Bacteria 1690
167 Ga0453683_0005638 3300044673 Bacteria 8695
168 Ga0453683_0039505 3300044673 Bacteria 2966
169 Ga0453684_0000001 3300044712 Bacteria 2623166
170 Ga0453684_0000027 3300044712 Bacteria 778857
171 Ga0453684_0028462 3300044712 Bacteria 7971
172 Ga0453684_0078508 3300044712 Bacteria 4131
173 Ga0453684_0547074 3300044712 Bacteria 1276
174 Ga0451576_0000109 3300045051 Bacteria 210549
175 Ga0451576_0007938 3300045051 Bacteria 12556
176 Ga0451576_0013733 3300045051 Bacteria 9047
177 Ga0451576_0021999 3300045051 Bacteria 6922
178 Ga0451576_0027156 3300045051 Bacteria 6151
179 Ga0451576_0060513 3300045051 Bacteria 3950
180 Ga0451576_0115434 3300045051 Bacteria 2795
181 Ga0451576_0143085 3300045051 Bacteria 2494
182 Ga0451576_0209208 3300045051 Bacteria 2037
183 Ga0495592_0011617 3300046454 Bacteria 6668
184 Ga0495603_0006547 3300046455 Bacteria 6989
185 Ga0495651_0020264 3300046462 Bacteria 5162
186 Ga0495662_0050772 3300046476 Bacteria 2002
187 Ga0495608_0004386 3300046511 Bacteria 10112
188 Ga0495608_0014836 3300046511 Bacteria 5406
189 Ga0495618_0000721 3300046514 Bacteria 23106
190 Ga0495618_0051507 3300046514 Bacteria 2601
191 Ga0495628_0000908 3300046516 Bacteria 27198
192 Ga0495628_0069240 3300046516 Bacteria 2752
193 Ga0495628_0234921 3300046516 Unclassified 1373
194 Ga0495666_0083490 3300046526 Bacteria 1510
195 Ga0495640_0214423 3300046533 Bacteria 1216
196 Ga0495587_0016277 3300046536 Bacteria 4628
197 Ga0495667_0009917 3300046559 Bacteria 6451
198 Ga0495657_0002235 3300046675 Bacteria 16391
199 Ga0495657_0033544 3300046675 Bacteria 3573
200 Ga0495599_0299639 3300046678 Unclassified 971
201 Ga0495613_0010774 3300046689 Bacteria 6783
202 Ga0495674_0082138 3300047319 Bacteria 2763
203 Ga0495674_0158566 3300047319 Bacteria 1894
204 Ga0495680_0027985 3300047322 Bacteria 4625
205 Ga0495680_0101945 3300047322 Bacteria 2138
206 Ga0495675_0037786 3300047444 Bacteria 3074
207 Ga0495684_0072340 3300047471 Bacteria 2620
208 Ga0496101_0096027 3300048904 Unclassified 2212
209 Ga0496101_0124328 3300048904 Bacteria 1953
210 Ga0496102_0010420 3300048905 Bacteria 7994
211 Ga0496104_0006149 3300048907 Bacteria 10538
212 Ga0496105_0024412 3300048908 Bacteria 4911
213 Ga0496105_0098650 3300048908 Bacteria 2412
214 Ga0496106_0026589 3300048909 Bacteria 4309
215 Ga0496107_0021465 3300048910 Bacteria 4563
216 Ga0496107_0070999 3300048910 Bacteria 2530
217 Ga0496108_0058894 3300048911 Unclassified 3230
218 Ga0496109_0032503 3300048912 Bacteria 4691
219 Ga0496112_0046093 3300048915 Bacteria 4275
220 Ga0496115_0023285 3300048918 Bacteria 4805
221 Ga0496115_0125884 3300048918 Bacteria 2111
222 Ga0501032_0042215 3300049569 Bacteria 3094
223 Ga0501034_0046604 3300049571 Bacteria 4379
224 Ga0501038_0087848 3300049574 Bacteria 2610
225 Ga0501039_0111703 3300049575 Bacteria 2136
226 Ga0501043_0411069 3300049579 Bacteria 1021
227 Ga0501047_0103357 3300049581 Bacteria 2729
228 Ga0501047_0373416 3300049581 Unclassified 1261
229 Ga0501070_0214275 3300049586 Bacteria 1580
230 Ga0501071_0159423 3300049587 Bacteria 1686
231 Ga0501074_0073876 3300049590 Bacteria 2449
232 Ga0501076_0220328 3300049592 Bacteria 1551
233 Ga0501083_0121774 3300049744 Bacteria 1711
234 Ga0501044_0077889 3300049823 Bacteria 3361
235 nmdc:mga05p37_413545_c1 3300050507 Bacteria 1571
236 nmdc:mga09592_287_c1 3300050508 Bacteria 36825
237 nmdc:mga09592_73204_c1 3300050508 Bacteria 2911
238 nmdc:mga0qj67_221694_c1 3300050509 Bacteria 1535
239 nmdc:mga0qj67_78567_c1 3300050509 Bacteria 2641
240 nmdc:mga06r32_18673_c1 3300050510 Bacteria 6352
241 nmdc:mga08y16_14814_c1 3300050511 Bacteria 8199
242 nmdc:mga08y16_189920_c1 3300050511 Bacteria 2131
243 nmdc:mga08y16_209292_c1 3300050511 Bacteria 2020
244 nmdc:mga08y16_25040_c1 3300050511 Bacteria 6295
245 nmdc:mga08y16_34867_c1 3300050511 Bacteria 5287
246 nmdc:mga0n895_4598_c1 3300050512 Bacteria 11370
247 nmdc:mga0n895_9845_c1 3300050512 Bacteria 8404
248 nmdc:mga0rr50_30414_c1 3300050513 Bacteria 3823
249 nmdc:mga0a205_140100_c1 3300050515 Bacteria 2319
250 nmdc:mga0a205_1697_c1 3300050515 Bacteria 19011
251 nmdc:mga0a205_71066_c1 3300050515 Bacteria 3361
252 Ga0495601_0001768 3300053077 Bacteria 11970
253 Ga0495601_0221212 3300053077 Unclassified 1237
254 Ga0495595_0012496 3300053084 Bacteria 3571
255 Ga0495619_0020121 3300053085 Bacteria 4247
256 Ga0495619_0047175 3300053085 Bacteria 2836
257 Ga0501084_0030070 3300054114 Bacteria 4544
258 2673161731 2671180531 Bacteria 9045424
259 Ga0316579_10033873
260 Ga0070690_100010138
261 Ga0070670_100000207
262 Ga0070666_10003775
263 Ga0068868_100000724
264 Ga0070689_100004576
265 Ga0070689_100010461
266 Ga0070689_100090017
267 Ga0070689_100332893
268 Ga0070687_100003306
269 Ga0070687_100062300
270 Ga0070661_100012774
271 Ga0070675_100034705
272 Ga0070671_100073362
273 Ga0070671_100274495
274 Ga0070673_100019399
275 Ga0070688_100003457
276 Ga0070688_100118686
277 Ga0070667_100014037
278 Ga0070701_10034261
279 Ga0070711_100144077
280 Ga0070705_100141565
281 Ga0070694_100065249
282 Ga0070694_100130220
283 Ga0070678_100006392
284 Ga0068867_100105002
285 Ga0070685_10058693
286 Ga0070707_100135395
287 Ga0070707_100246217
288 Ga0070698_100048784
289 Ga0070697_100086717
290 Ga0070672_100002719
291 Ga0070695_100001649
292 Ga0070704_100086020
293 Ga0070704_100190161
294 Ga0070704_100289700
295 Ga0070664_100001854
296 Ga0068857_100224104
297 Ga0068859_100085382
298 Ga0068864_100028497
299 Ga0068864_100329188
300 Ga0068861_100098081
301 Ga0068863_100014094
302 Ga0068863_100080573
303 Ga0068863_100103695
304 Ga0068860_100186545
305 Ga0070715_10034477
306 Ga0075367_10086892
307 Ga0097621_100034389
308 Ga0097621_100145579
309 Ga0097621_100202600
310 Ga0097621_100239156
311 Ga0075428_100004878
312 Ga0075430_100255084
313 Ga0075431_100012157
314 Ga0075433_10003742
315 Ga0075434_100000148
316 Ga0075434_100029674
317 Ga0075434_100041865
318 Ga0075434_100112261
319 Ga0075429_100000262
320 Ga0097620_100085383
321 Ga0075435_100002494
322 Ga0111539_10004440
323 Ga0111539_10025307
324 Ga0111539_10099795
325 Ga0111539_10112089
326 Ga0111539_10153404
327 Ga0111539_10157397
328 Ga0111539_10209842
329 Ga0114129_10044226
330 Ga0114129_10052726
331 Ga0105243_10030697
332 Ga0105241_10082228
333 Ga0105242_10263688
334 Ga0105242_10293154
335 Ga0105248_10004704
336 Ga0105237_10016383
337 Ga0157378_10006496
338 Ga0163162_10002123
339 Ga0157372_10016783
340 Ga0157375_10010182
341 Ga0163163_10061802
342 Ga0163163_10076127
343 Ga0157377_10045529
344 Ga0157379_10007653
345 Ga0157376_10007505
346 Ga0157376_10522722
347 Ga0213875_10000141
348 Ga0207680_10012030
349 Ga0207662_10000189
350 Ga0207662_10091198
351 Ga0207662_10097207
352 Ga0207650_10002070
353 Ga0207659_10017088
354 Ga0207644_10007623
355 Ga0207709_10082969
356 Ga0207670_10000370
357 Ga0207670_10007547
358 Ga0207670_10290550
359 Ga0207691_10014953
360 Ga0207711_10003308
361 Ga0207689_10139419
362 Ga0207651_10016949
363 Ga0207651_10257381
364 Ga0207677_10007599
365 Ga0207641_10013721
366 Ga0207641_10055569
367 Ga0207648_10027432
368 Ga0207648_10144881
369 Ga0207676_10008077
370 Ga0207676_10074014
371 Ga0207674_10245044
372 Ga0207675_100054441
373 Ga0207683_10002129
374 Ga0207683_10162762
375 Ga0207428_10014888
376 Ga0207428_10062066
377 Ga0268264_10069385
378 Ga0268264_10183575
379 Ga0265319_1015272
380 Ga0265319_1030896
381 Ga0265323_10000014
382 Ga0265323_10022734
383 Ga0265323_10051761
384 Ga0265322_10000677
385 Ga0265330_10024222
386 Ga0265328_10000034
387 Ga0265320_10003109
388 Ga0265320_10034174
389 Ga0265331_10000024
390 Ga0265331_10004122
391 Ga0265327_10000079
392 Ga0265327_10020601
393 Ga0265316_10002595
394 Ga0265316_10289617
395 Ga0265314_10119677
396 Ga0265342_10059718
397 Ga0316578_10021263
398 Ga0316577_10008560
399 Ga0316585_10008924
400 Ga0373934_0000419
401 Ga0373953_0025189
402 Ga0373953_0027978
403 Ga0373953_0121410
404 Ga0373954_0004543
405 Ga0373956_0002953
406 Ga0373957_0002599
407 Ga0373957_0022148
408 Ga0373955_0036366
409 Ga0373933_0009173
410 Ga0373933_0054504
411 Ga0373947_0175085
412 Ga0373937_0041480
413 Ga0373937_0064862
414 Ga0373937_0584475
415 Ga0316582_0085031
416 Ga0316584_0004494
417 Ga0316581_0008873
418 Ga0436364_0487252
419 Ga0436364_1332997
420 Ga0451577_0009209
421 Ga0451577_0040874
422 Ga0451577_0075063
423 Ga0451577_0146594
424 Ga0451577_0226541
425 Ga0453683_0005638
426 Ga0453683_0039505
427 Ga0453684_0000001
428 Ga0453684_0000027
429 Ga0453684_0028462
430 Ga0453684_0078508
431 Ga0453684_0547074
432 Ga0451576_0000109
433 Ga0451576_0007938
434 Ga0451576_0013733
435 Ga0451576_0021999
436 Ga0451576_0027156
437 Ga0451576_0060513
438 Ga0451576_0115434
439 Ga0451576_0143085
440 Ga0451576_0209208
441 Ga0495592_0011617
442 Ga0495603_0006547
443 Ga0495651_0020264
444 Ga0495662_0050772
445 Ga0495608_0004386
446 Ga0495608_0014836
447 Ga0495618_0000721
448 Ga0495618_0051507
449 Ga0495628_0000908
450 Ga0495628_0069240
451 Ga0495628_0234921
452 Ga0495666_0083490
453 Ga0495640_0214423
454 Ga0495587_0016277
455 Ga0495667_0009917
456 Ga0495657_0002235
457 Ga0495657_0033544
458 Ga0495599_0299639
459 Ga0495613_0010774
460 Ga0495674_0082138
461 Ga0495674_0158566
462 Ga0495680_0027985
463 Ga0495680_0101945
464 Ga0495675_0037786
465 Ga0495684_0072340
466 Ga0496101_0096027
467 Ga0496101_0124328
468 Ga0496102_0010420
469 Ga0496104_0006149
470 Ga0496105_0024412
471 Ga0496105_0098650
472 Ga0496106_0026589
473 Ga0496107_0021465
474 Ga0496107_0070999
475 Ga0496108_0058894
476 Ga0496109_0032503
477 Ga0496112_0046093
478 Ga0496115_0023285
479 Ga0496115_0125884
480 Ga0501032_0042215
481 Ga0501034_0046604
482 Ga0501038_0087848
483 Ga0501039_0111703
484 Ga0501043_0411069
485 Ga0501047_0103357
486 Ga0501047_0373416
487 Ga0501070_0214275
488 Ga0501071_0159423
489 Ga0501074_0073876
490 Ga0501076_0220328
491 Ga0501083_0121774
492 Ga0501044_0077889
493 nmdc:mga05p37_413545_c1
494 nmdc:mga09592_287_c1
495 nmdc:mga09592_73204_c1
496 nmdc:mga0qj67_221694_c1
497 nmdc:mga0qj67_78567_c1
498 nmdc:mga06r32_18673_c1
499 nmdc:mga08y16_14814_c1
500 nmdc:mga08y16_189920_c1
501 nmdc:mga08y16_209292_c1
502 nmdc:mga08y16_25040_c1
503 nmdc:mga08y16_34867_c1
504 nmdc:mga0n895_4598_c1
505 nmdc:mga0n895_9845_c1
506 nmdc:mga0rr50_30414_c1
507 nmdc:mga0a205_140100_c1
508 nmdc:mga0a205_1697_c1
509 nmdc:mga0a205_71066_c1
510 Ga0495601_0001768
511 Ga0495601_0221212
512 Ga0495595_0012496
513 Ga0495619_0020121
514 Ga0495619_0047175
515 Ga0501084_0030070
516 2673161731

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07479

NAD_Gly3P_dh_C

NAD-dependent glycerol-3-phosphate dehydrogenase C-terminus

191

332

0.99

PF01210

NAD_Gly3P_dh_N

NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus

12

171

0.96

PF20618

GPD_NAD_C_bact

Bacterial GPD, NAD-dependent C-terminal

251

317

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3k96-assembly1.cif.gz_B 2.1 angstrom resolution crystal structure of glycerol-3-phosphate dehydrogenase (gpsa) from coxiella burnetii 0.9665 2 328
1z82-assembly1.cif.gz_B crystal structure of glycerol-3-phosphate dehydrogenase (tm0378) from thermotoga maritima at 2.00 a resolution 0.9583 4 328
3k96-assembly1.cif.gz_B 2.1 angstrom resolution crystal structure of glycerol-3-phosphate dehydrogenase (gpsa) from coxiella burnetii 0.9578 2 328
1n1e-assembly1.cif.gz_B crystal structure of leishmania mexicana glycerol-3-phosphate dehydrogenase complexed with dhap and nad 0.9547 3 333
1z82-assembly1.cif.gz_B crystal structure of glycerol-3-phosphate dehydrogenase (tm0378) from thermotoga maritima at 2.00 a resolution 0.9523 4 328
ID Description Score Start End Superfamily
3k96B02 Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 0.9808 191 328 1.10.1040.10
af_Q2FYG1_190_332_1.10.1040.10 Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 0.9774 191 333 1.10.1040.10
3k96B02 Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 0.9738 191 328 1.10.1040.10
af_P9WN77_188_331_1.10.1040.10 Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 0.9715 187 330 1.10.1040.10
af_Q2FYG1_190_332_1.10.1040.10 Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 0.9707 191 333 1.10.1040.10
ID Description Score Start End GO Terms
AF-A0A532EH12-F1-model_v4 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase (EC 1.1.1.94) 0.9948 182 328 GO:0005829
GO:0005975
GO:0006072
GO:0006116
GO:0008654
GO:0047952
AF-A0A800EUA8-F1-model_v4 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase (EC 1.1.1.94) 0.992 183 331 GO:0005829
GO:0005975
GO:0006072
GO:0008654
GO:0047952
AF-A0A2V7KKN8-F1-model_v4 Glycerol-3-phosphate dehydrogenase 0.9903 182 328 GO:0005829
GO:0005975
GO:0006072
GO:0008654
GO:0047952
AF-A0A1F9DMV3-F1-model_v4 Glycerol-3-phosphate dehydrogenase (EC 1.1.1.94) 0.9891 62 333 GO:0005829
GO:0005975
GO:0006650
GO:0008654
GO:0046168
GO:0047952
GO:0051287
AF-E3ZRZ2-F1-model_v4 Glycerol-3-phosphate dehydrogenase (NAD(P)+) 0.9889 176 331 GO:0005829
GO:0005975
GO:0006072
GO:0008654
GO:0047952

Map