F368077
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 258 | 143 | 258 | 276 |
Family's Representative Sequence
| Representative Sequence | 3300013102|Ga0157371_10062993|Ga0157371_100629933 |
| Length | 310 |
| Sequence | MWRNLQNPNNKNLLVYCYFQIKNLSFRINYFWKMKIYKTKKGIIIEKENKFYLSKEDWDLFINDDHLFQKMENIIQRAGVHENKIRLTEEDIVAPVGNQELWACGVTYLRSKEGRQEESKDAGGGDFYARVYEAERPEVFFKSTPHRIVGHNGKVRIRKDSTWDVPEPELTLAVTSSGKIVGYTIGNDMSSRSIEGENPLYLPQAKTYDGCASLGPCIYVSEKPLDNSTKIYLEINRNDLKVFEGNIGINQMKRAFEELVSFVFRECSFPNGCLITTGTGIVPGNDFTLQAKDEIRISIDQIGTLANIVE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 2 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 3 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 5 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 25 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 30 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 33 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 35 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 36 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 37 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 39 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 40 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 41 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 42 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 43 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 44 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 45 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 46 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 47 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 48 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 49 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 50 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 51 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 52 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 114 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 115 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 116 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 117 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 118 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 119 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 120 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 121 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 122 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 123 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 124 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 125 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 126 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 132 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 133 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 134 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 135 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 136 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 137 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 138 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 139 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 140 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 141 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 142 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 143 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.16 |
| Nodule | 0 |
| Rhizoplane | 0.78 |
| Rhizosphere | 96.12 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.94 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24751J29686_10004047 | 3300002459 | Unclassified | 2967 |
| 2 | JGI24751J29686_10013904 | 3300002459 | Bacteria | 1661 |
| 3 | rootL2_10154932 | 3300003322 | Bacteria | 3657 |
| 4 | Ga0065704_10147617 | 3300005289 | Unclassified | 1457 |
| 5 | Ga0065712_10006000 | 3300005290 | Bacteria | 5239 |
| 6 | Ga0065707_10108386 | 3300005295 | Bacteria | 2512 |
| 7 | Ga0070658_10035121 | 3300005327 | Bacteria | 4036 |
| 8 | Ga0070676_10108264 | 3300005328 | Unclassified | 1727 |
| 9 | Ga0070683_100499949 | 3300005329 | Bacteria | 1161 |
| 10 | Ga0070670_100025909 | 3300005331 | Bacteria | 5045 |
| 11 | Ga0068869_100064174 | 3300005334 | Bacteria | 2701 |
| 12 | Ga0070682_100102545 | 3300005337 | Bacteria | 1891 |
| 13 | Ga0068868_100197955 | 3300005338 | Bacteria | 1673 |
| 14 | Ga0070660_100008086 | 3300005339 | Bacteria | 7352 |
| 15 | Ga0070689_100002994 | 3300005340 | Bacteria | 11111 |
| 16 | Ga0070689_100031165 | 3300005340 | Bacteria | 4052 |
| 17 | Ga0070689_100097608 | 3300005340 | Bacteria | 2323 |
| 18 | Ga0070687_100005612 | 3300005343 | Bacteria | 5088 |
| 19 | Ga0070687_100030910 | 3300005343 | Bacteria | 2621 |
| 20 | Ga0070669_100178616 | 3300005353 | Unclassified | 1659 |
| 21 | Ga0070675_100021347 | 3300005354 | Bacteria | 5174 |
| 22 | Ga0070673_100009064 | 3300005364 | Bacteria | 6661 |
| 23 | Ga0070673_100103172 | 3300005364 | Bacteria | 2352 |
| 24 | Ga0070673_100254647 | 3300005364 | Unclassified | 1531 |
| 25 | Ga0070688_100008502 | 3300005365 | Bacteria | 5573 |
| 26 | Ga0070688_100097912 | 3300005365 | Unclassified | 1929 |
| 27 | Ga0070659_100140711 | 3300005366 | Bacteria | 1965 |
| 28 | Ga0070667_100028545 | 3300005367 | Bacteria | 4646 |
| 29 | Ga0070700_100023820 | 3300005441 | Unclassified | 3586 |
| 30 | Ga0070700_100034305 | 3300005441 | Bacteria | 3064 |
| 31 | Ga0070700_100178586 | 3300005441 | Unclassified | 1475 |
| 32 | Ga0070681_10423923 | 3300005458 | Bacteria | 1243 |
| 33 | Ga0068867_100133066 | 3300005459 | Bacteria | 1935 |
| 34 | Ga0068867_100233946 | 3300005459 | Unclassified | 1487 |
| 35 | Ga0070685_10002599 | 3300005466 | Bacteria | 9247 |
| 36 | Ga0070698_100001104 | 3300005471 | Bacteria | 29751 |
| 37 | Ga0070698_100012395 | 3300005471 | Bacteria | 9030 |
| 38 | Ga0070698_100021687 | 3300005471 | Bacteria | 6725 |
| 39 | Ga0070679_100006452 | 3300005530 | Bacteria | 10928 |
| 40 | Ga0070679_100068169 | 3300005530 | Bacteria | 3549 |
| 41 | Ga0070679_100225680 | 3300005530 | Bacteria | 1833 |
| 42 | Ga0070684_100095085 | 3300005535 | Bacteria | 2654 |
| 43 | Ga0070684_100303858 | 3300005535 | Bacteria | 1464 |
| 44 | Ga0068853_100036567 | 3300005539 | Bacteria | 4177 |
| 45 | Ga0070672_100029887 | 3300005543 | Bacteria | 4090 |
| 46 | Ga0070686_100023593 | 3300005544 | Bacteria | 3679 |
| 47 | Ga0068855_100082125 | 3300005563 | Bacteria | 3735 |
| 48 | Ga0068855_100451407 | 3300005563 | Bacteria | 1403 |
| 49 | Ga0070664_100160860 | 3300005564 | Bacteria | 1986 |
| 50 | Ga0070664_100280458 | 3300005564 | Bacteria | 1502 |
| 51 | Ga0068857_100010725 | 3300005577 | Bacteria | 7974 |
| 52 | Ga0068857_100051832 | 3300005577 | Bacteria | 3641 |
| 53 | Ga0068857_100267432 | 3300005577 | Bacteria | 1571 |
| 54 | Ga0068854_100176639 | 3300005578 | Bacteria | 1665 |
| 55 | Ga0068856_100128503 | 3300005614 | Unclassified | 2538 |
| 56 | Ga0070702_100037948 | 3300005615 | Bacteria | 2679 |
| 57 | Ga0068852_100108753 | 3300005616 | Bacteria | 2516 |
| 58 | Ga0068852_100188229 | 3300005616 | Bacteria | 1946 |
| 59 | Ga0068859_100002811 | 3300005617 | Bacteria | 17638 |
| 60 | Ga0068859_100039363 | 3300005617 | Bacteria | 4743 |
| 61 | Ga0068859_100171569 | 3300005617 | Bacteria | 2250 |
| 62 | Ga0068859_100356091 | 3300005617 | Unclassified | 1558 |
| 63 | Ga0068859_100456721 | 3300005617 | Bacteria | 1373 |
| 64 | Ga0068864_100011087 | 3300005618 | Bacteria | 7449 |
| 65 | Ga0068866_10016583 | 3300005718 | Unclassified | 3296 |
| 66 | Ga0068861_100010592 | 3300005719 | Bacteria | 6402 |
| 67 | Ga0068870_10088050 | 3300005840 | Unclassified | 1730 |
| 68 | Ga0068870_10119311 | 3300005840 | Bacteria | 1517 |
| 69 | Ga0068870_10159358 | 3300005840 | Unclassified | 1337 |
| 70 | Ga0068863_100099482 | 3300005841 | Bacteria | 2763 |
| 71 | Ga0068863_100261419 | 3300005841 | Unclassified | 1673 |
| 72 | Ga0068863_100349416 | 3300005841 | Bacteria | 1440 |
| 73 | Ga0068860_100006421 | 3300005843 | Bacteria | 11804 |
| 74 | Ga0068860_100184873 | 3300005843 | Bacteria | 2015 |
| 75 | Ga0081539_10011718 | 3300005985 | Bacteria | 6879 |
| 76 | Ga0068871_100085659 | 3300006358 | Bacteria | 2617 |
| 77 | Ga0068871_100406021 | 3300006358 | Unclassified | 1214 |
| 78 | Ga0075428_100004225 | 3300006844 | Bacteria | 15814 |
| 79 | Ga0075428_100104274 | 3300006844 | Bacteria | 3092 |
| 80 | Ga0075428_100196831 | 3300006844 | Bacteria | 2179 |
| 81 | Ga0075430_100138875 | 3300006846 | Unclassified | 2024 |
| 82 | Ga0075431_100228046 | 3300006847 | Unclassified | 1898 |
| 83 | Ga0075429_100000723 | 3300006880 | Bacteria | 25874 |
| 84 | Ga0097620_100002810 | 3300006931 | Bacteria | 17638 |
| 85 | Ga0097620_100039364 | 3300006931 | Bacteria | 4743 |
| 86 | Ga0097620_100171570 | 3300006931 | Bacteria | 2250 |
| 87 | Ga0097620_100356088 | 3300006931 | Unclassified | 1558 |
| 88 | Ga0097620_100456761 | 3300006931 | Bacteria | 1373 |
| 89 | Ga0105240_10325931 | 3300009093 | Bacteria | 1749 |
| 90 | Ga0105240_10396875 | 3300009093 | Bacteria | 1554 |
| 91 | Ga0105240_10961278 | 3300009093 | Bacteria | 916 |
| 92 | Ga0111539_10303803 | 3300009094 | Bacteria | 1857 |
| 93 | Ga0111539_10314367 | 3300009094 | Bacteria | 1823 |
| 94 | Ga0114129_10176255 | 3300009147 | Bacteria | 2912 |
| 95 | Ga0105243_10258725 | 3300009148 | Bacteria | 1557 |
| 96 | Ga0105243_10361954 | 3300009148 | Bacteria | 1335 |
| 97 | Ga0105242_10005404 | 3300009176 | Bacteria | 9882 |
| 98 | Ga0105242_10099053 | 3300009176 | Unclassified | 2467 |
| 99 | Ga0105242_10132938 | 3300009176 | Bacteria | 2150 |
| 100 | Ga0105242_10517243 | 3300009176 | Bacteria | 1138 |
| 101 | Ga0105242_10747819 | 3300009176 | Unclassified | 962 |
| 102 | Ga0105237_10185508 | 3300009545 | Bacteria | 2080 |
| 103 | Ga0105249_10006282 | 3300009553 | Bacteria | 10323 |
| 104 | Ga0105249_10023039 | 3300009553 | Bacteria | 5583 |
| 105 | Ga0105249_10034405 | 3300009553 | Unclassified | 4592 |
| 106 | Ga0105249_10346510 | 3300009553 | Bacteria | 1504 |
| 107 | Ga0105246_10269672 | 3300011119 | Bacteria | 1360 |
| 108 | Ga0157373_10010949 | 3300013100 | Bacteria | 6677 |
| 109 | Ga0157373_10042751 | 3300013100 | Bacteria | 3238 |
| 110 | Ga0157373_10144141 | 3300013100 | Bacteria | 1675 |
| 111 | Ga0157371_10000548 | 3300013102 | Bacteria | 44733 |
| 112 | Ga0157371_10003863 | 3300013102 | Bacteria | 13369 |
| 113 | Ga0157371_10009574 | 3300013102 | Bacteria | 7620 |
| 114 | Ga0157371_10013223 | 3300013102 | Bacteria | 6282 |
| 115 | Ga0157371_10027156 | 3300013102 | Bacteria | 4154 |
| 116 | Ga0157371_10029538 | 3300013102 | Bacteria | 3962 |
| 117 | Ga0157371_10062993 | 3300013102 | Bacteria | 2628 |
| 118 | Ga0157371_10212119 | 3300013102 | Bacteria | 1390 |
| 119 | Ga0157370_10173171 | 3300013104 | Bacteria | 2006 |
| 120 | Ga0157369_10035272 | 3300013105 | Bacteria | 5486 |
| 121 | Ga0157369_10116058 | 3300013105 | Unclassified | 2843 |
| 122 | Ga0157374_10104708 | 3300013296 | Bacteria | 2716 |
| 123 | Ga0157378_10019019 | 3300013297 | Bacteria | 6037 |
| 124 | Ga0157378_10161056 | 3300013297 | Bacteria | 2098 |
| 125 | Ga0157378_10232876 | 3300013297 | Unclassified | 1756 |
| 126 | Ga0163162_10128188 | 3300013306 | Bacteria | 2645 |
| 127 | Ga0157372_10003393 | 3300013307 | Bacteria | 17187 |
| 128 | Ga0157372_10097596 | 3300013307 | Bacteria | 3351 |
| 129 | Ga0157372_10101648 | 3300013307 | Bacteria | 3282 |
| 130 | Ga0157372_10581736 | 3300013307 | Bacteria | 1305 |
| 131 | Ga0157372_10587703 | 3300013307 | Bacteria | 1298 |
| 132 | Ga0157375_10038654 | 3300013308 | Bacteria | 4582 |
| 133 | Ga0157375_10999661 | 3300013308 | Unclassified | 976 |
| 134 | Ga0163163_10032548 | 3300014325 | Bacteria | 5036 |
| 135 | Ga0163163_10508884 | 3300014325 | Bacteria | 1266 |
| 136 | Ga0157380_10323417 | 3300014326 | Bacteria | 1431 |
| 137 | Ga0157380_10739032 | 3300014326 | Bacteria | 994 |
| 138 | Ga0157377_10041835 | 3300014745 | Bacteria | 2543 |
| 139 | Ga0157376_10001877 | 3300014969 | Bacteria | 14019 |
| 140 | Ga0157376_10308969 | 3300014969 | Unclassified | 1499 |
| 141 | Ga0207682_10009236 | 3300025893 | Bacteria | 3895 |
| 142 | Ga0207645_10050048 | 3300025907 | Bacteria | 2668 |
| 143 | Ga0207643_10006914 | 3300025908 | Bacteria | 6082 |
| 144 | Ga0207643_10102076 | 3300025908 | Unclassified | 1682 |
| 145 | Ga0207705_10022270 | 3300025909 | Bacteria | 4519 |
| 146 | Ga0207705_10155679 | 3300025909 | Bacteria | 1714 |
| 147 | Ga0207707_10237111 | 3300025912 | Bacteria | 1587 |
| 148 | Ga0207695_10239589 | 3300025913 | Bacteria | 1716 |
| 149 | Ga0207695_10285192 | 3300025913 | Bacteria | 1544 |
| 150 | Ga0207660_10128766 | 3300025917 | Bacteria | 1925 |
| 151 | Ga0207662_10054675 | 3300025918 | Bacteria | 2381 |
| 152 | Ga0207662_10059882 | 3300025918 | Bacteria | 2283 |
| 153 | Ga0207662_10218685 | 3300025918 | Bacteria | 1240 |
| 154 | Ga0207657_10030117 | 3300025919 | Bacteria | 4931 |
| 155 | Ga0207657_10058846 | 3300025919 | Bacteria | 3305 |
| 156 | Ga0207652_10051344 | 3300025921 | Bacteria | 3535 |
| 157 | Ga0207652_10057158 | 3300025921 | Bacteria | 3359 |
| 158 | Ga0207652_10205525 | 3300025921 | Bacteria | 1772 |
| 159 | Ga0207681_10144738 | 3300025923 | Bacteria | 1774 |
| 160 | Ga0207650_10458572 | 3300025925 | Unclassified | 1061 |
| 161 | Ga0207659_10068918 | 3300025926 | Bacteria | 2574 |
| 162 | Ga0207659_10333761 | 3300025926 | Unclassified | 1254 |
| 163 | Ga0207686_10000937 | 3300025934 | Bacteria | 17450 |
| 164 | Ga0207670_10019549 | 3300025936 | Bacteria | 4139 |
| 165 | Ga0207670_10228909 | 3300025936 | Bacteria | 1427 |
| 166 | Ga0207669_10015750 | 3300025937 | Bacteria | 3822 |
| 167 | Ga0207669_10333950 | 3300025937 | Bacteria | 1165 |
| 168 | Ga0207704_10322927 | 3300025938 | Unclassified | 1191 |
| 169 | Ga0207691_10003985 | 3300025940 | Bacteria | 14344 |
| 170 | Ga0207691_10035749 | 3300025940 | Bacteria | 4607 |
| 171 | Ga0207691_10159229 | 3300025940 | Bacteria | 1982 |
| 172 | Ga0207691_10357885 | 3300025940 | Bacteria | 1248 |
| 173 | Ga0207689_10019904 | 3300025942 | Bacteria | 5652 |
| 174 | Ga0207689_10056197 | 3300025942 | Bacteria | 3238 |
| 175 | Ga0207661_10248429 | 3300025944 | Bacteria | 1580 |
| 176 | Ga0207679_10057959 | 3300025945 | Bacteria | 2867 |
| 177 | Ga0207679_10098992 | 3300025945 | Bacteria | 2275 |
| 178 | Ga0207667_10415456 | 3300025949 | Bacteria | 1369 |
| 179 | Ga0207667_10451868 | 3300025949 | Bacteria | 1306 |
| 180 | Ga0207651_10053544 | 3300025960 | Bacteria | 2759 |
| 181 | Ga0207651_10099221 | 3300025960 | Unclassified | 2156 |
| 182 | Ga0207651_10151767 | 3300025960 | Bacteria | 1804 |
| 183 | Ga0207651_10385749 | 3300025960 | Unclassified | 1188 |
| 184 | Ga0207712_10001478 | 3300025961 | Bacteria | 16013 |
| 185 | Ga0207712_10042565 | 3300025961 | Unclassified | 3128 |
| 186 | Ga0207668_10365645 | 3300025972 | Unclassified | 1210 |
| 187 | Ga0207640_10349832 | 3300025981 | Bacteria | 1187 |
| 188 | Ga0207658_10033047 | 3300025986 | Bacteria | 3687 |
| 189 | Ga0207658_10064831 | 3300025986 | Bacteria | 2742 |
| 190 | Ga0207677_10075645 | 3300026023 | Bacteria | 2394 |
| 191 | Ga0207639_10027886 | 3300026041 | Bacteria | 4118 |
| 192 | Ga0207639_10184197 | 3300026041 | Bacteria | 1779 |
| 193 | Ga0207639_10537977 | 3300026041 | Bacteria | 1071 |
| 194 | Ga0207708_10003347 | 3300026075 | Bacteria | 11818 |
| 195 | Ga0207708_10065580 | 3300026075 | Bacteria | 2776 |
| 196 | Ga0207708_10087066 | 3300026075 | Bacteria | 2404 |
| 197 | Ga0207641_10000111 | 3300026088 | Bacteria | 120527 |
| 198 | Ga0207641_10034216 | 3300026088 | Bacteria | 4225 |
| 199 | Ga0207641_10068213 | 3300026088 | Bacteria | 3049 |
| 200 | Ga0207641_10104031 | 3300026088 | Bacteria | 2506 |
| 201 | Ga0207641_10466514 | 3300026088 | Bacteria | 1222 |
| 202 | Ga0207648_10003423 | 3300026089 | Bacteria | 16650 |
| 203 | Ga0207648_10042607 | 3300026089 | Bacteria | 3984 |
| 204 | Ga0207648_10044820 | 3300026089 | Unclassified | 3881 |
| 205 | Ga0207648_10087124 | 3300026089 | Bacteria | 2725 |
| 206 | Ga0207648_10109139 | 3300026089 | Bacteria | 2429 |
| 207 | Ga0207674_10020230 | 3300026116 | Bacteria | 7197 |
| 208 | Ga0207674_10023639 | 3300026116 | Bacteria | 6579 |
| 209 | Ga0207674_10223373 | 3300026116 | Bacteria | 1832 |
| 210 | Ga0207674_10334838 | 3300026116 | Bacteria | 1463 |
| 211 | Ga0207675_100018475 | 3300026118 | Bacteria | 6503 |
| 212 | Ga0207675_100087912 | 3300026118 | Bacteria | 2919 |
| 213 | Ga0207683_10182050 | 3300026121 | Bacteria | 1905 |
| 214 | Ga0207698_10465737 | 3300026142 | Bacteria | 1223 |
| 215 | Ga0209995_1002454 | 3300027471 | Unclassified | 2928 |
| 216 | Ga0268265_10484124 | 3300028380 | Unclassified | 1163 |
| 217 | Ga0268264_10001248 | 3300028381 | Bacteria | 24263 |
| 218 | Ga0307515_10000001 | 3300028794 | Bacteria | 4259510 |
| 219 | Ga0265327_10000159 | 3300031251 | Bacteria | 145537 |
| 220 | Ga0265327_10000193 | 3300031251 | Bacteria | 129367 |
| 221 | Ga0307408_100171204 | 3300031548 | Bacteria | 1734 |
| 222 | Ga0307416_100225719 | 3300032002 | Bacteria | 1801 |
| 223 | Ga0307416_100917861 | 3300032002 | Unclassified | 976 |
| 224 | Ga0316583_10004893 | 3300032133 | Bacteria | 4788 |
| 225 | Ga0395905_0390056 | 3300037471 | Bacteria | 1287 |
| 226 | Ga0436365_0071140 | 3300039437 | Bacteria | 1129 |
| 227 | Ga0436365_0968987 | 3300039437 | Bacteria | 46063 |
| 228 | Ga0451800_0091743 | 3300041459 | Bacteria | 1537 |
| 229 | Ga0451807_2226376 | 3300041486 | Bacteria | 1769 |
| 230 | Ga0451853_1468156 | 3300041512 | Bacteria | 1686 |
| 231 | Ga0450923_020821 | 3300042125 | Bacteria | 1274 |
| 232 | Ga0439446_0077117 | 3300042156 | Unclassified | 1027 |
| 233 | Ga0451576_0013620 | 3300045051 | Bacteria | 9091 |
| 234 | Ga0451576_0121003 | 3300045051 | Bacteria | 2725 |
| 235 | Ga0451576_0178061 | 3300045051 | Bacteria | 2220 |
| 236 | Ga0495638_0106181 | 3300046460 | Unclassified | 1673 |
| 237 | Ga0495594_0210809 | 3300046499 | Unclassified | 1108 |
| 238 | Ga0495621_0055689 | 3300046539 | Bacteria | 1424 |
| 239 | Ga0495672_0009330 | 3300047320 | Bacteria | 7122 |
| 240 | Ga0495672_0037863 | 3300047320 | Bacteria | 2948 |
| 241 | Ga0495686_0014410 | 3300047472 | Bacteria | 5442 |
| 242 | Ga0495686_0030997 | 3300047472 | Bacteria | 3470 |
| 243 | Ga0501034_0034863 | 3300049571 | Bacteria | 5103 |
| 244 | Ga0501034_0051595 | 3300049571 | Bacteria | 4148 |
| 245 | Ga0501034_0541341 | 3300049571 | Bacteria | 1074 |
| 246 | Ga0501043_0020705 | 3300049579 | Bacteria | 5160 |
| 247 | Ga0501046_0004696 | 3300049580 | Bacteria | 12330 |
| 248 | Ga0501070_0006093 | 3300049586 | Bacteria | 10274 |
| 249 | Ga0501080_0067814 | 3300049742 | Bacteria | 3318 |
| 250 | Ga0501035_0082892 | 3300049822 | Bacteria | 2830 |
| 251 | nmdc:mga05p37_476474_c1 | 3300050507 | Bacteria | 1439 |
| 252 | nmdc:mga09592_81133_c1 | 3300050508 | Unclassified | 2764 |
| 253 | nmdc:mga0qj67_145430_c1 | 3300050509 | Unclassified | 1922 |
| 254 | nmdc:mga06r32_138104_c1 | 3300050510 | Unclassified | 2412 |
| 255 | nmdc:mga08y16_418557_c1 | 3300050511 | Bacteria | 1369 |
| 256 | Ga0500568_0000880 | 3300053139 | Bacteria | 21086 |
| 257 | Ga0500611_000033 | 3300053727 | Bacteria | 79214 |
| 258 | Ga0500611_000048 | 3300053727 | Bacteria | 56160 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300037471 | Ga0395905_0390056 | Ga0395905_0390056_460_1260 | 254 |
| 2 | 3300025940 | Ga0207691_10357885 | Ga0207691_103578852 | 256 |
| 3 | 3300025942 | Ga0207689_10056197 | Ga0207689_100561973 | 260 |
| 4 | 3300026041 | Ga0207639_10184197 | Ga0207639_101841972 | 261 |
| 5 | 3300005364 | Ga0070673_100009064 | Ga0070673_1000090642 | 263 |
| 6 | 3300005840 | Ga0068870_10159358 | Ga0068870_101593582 | 263 |
| 7 | 3300025893 | Ga0207682_10009236 | Ga0207682_100092362 | 263 |
| 8 | 3300025908 | Ga0207643_10102076 | Ga0207643_101020762 | 263 |
| 9 | 3300025960 | Ga0207651_10385749 | Ga0207651_103857491 | 263 |
| 10 | 3300005577 | Ga0068857_100267432 | Ga0068857_1002674322 | 264 |
| 11 | 3300049580 | Ga0501046_0004696 | Ga0501046_0004696_132_968 | 264 |
| 12 | 3300005334 | Ga0068869_100064174 | Ga0068869_1000641742 | 265 |
| 13 | 3300009147 | Ga0114129_10176255 | Ga0114129_101762552 | 268 |
| 14 | 3300050507 | nmdc:mga05p37_476474_c1 | nmdc:mga05p37_476474_c1_134_964 | 268 |
| 15 | 3300011119 | Ga0105246_10269672 | Ga0105246_102696721 | 269 |
| 16 | 3300013102 | Ga0157371_10003863 | Ga0157371_100038635 | 269 |
| 17 | 3300014326 | Ga0157380_10739032 | Ga0157380_107390321 | 269 |
| 18 | 3300005985 | Ga0081539_10011718 | Ga0081539_100117184 | 270 |
| 19 | 3300039437 | Ga0436365_0968987 | Ga0436365_0968987_12937_13761 | 270 |
| 20 | 3300039437 | Ga0436365_0071140 | Ga0436365_0071140_289_1116 | 271 |
| 21 | 3300025909 | Ga0207705_10022270 | Ga0207705_100222704 | 272 |
| 22 | 3300005327 | Ga0070658_10035121 | Ga0070658_100351211 | 273 |
| 23 | 3300005339 | Ga0070660_100008086 | Ga0070660_1000080864 | 273 |
| 24 | 3300005366 | Ga0070659_100140711 | Ga0070659_1001407111 | 273 |
| 25 | 3300005458 | Ga0070681_10423923 | Ga0070681_104239231 | 273 |
| 26 | 3300005530 | Ga0070679_100006452 | Ga0070679_1000064526 | 273 |
| 27 | 3300005530 | Ga0070679_100068169 | Ga0070679_1000681692 | 273 |
| 28 | 3300005530 | Ga0070679_100225680 | Ga0070679_1002256801 | 273 |
| 29 | 3300005563 | Ga0068855_100451407 | Ga0068855_1004514072 | 273 |
| 30 | 3300005577 | Ga0068857_100051832 | Ga0068857_1000518321 | 273 |
| 31 | 3300005616 | Ga0068852_100188229 | Ga0068852_1001882292 | 273 |
| 32 | 3300013100 | Ga0157373_10010949 | Ga0157373_100109493 | 273 |
| 33 | 3300013100 | Ga0157373_10144141 | Ga0157373_101441412 | 273 |
| 34 | 3300013102 | Ga0157371_10029538 | Ga0157371_100295382 | 273 |
| 35 | 3300013102 | Ga0157371_10062993 | Ga0157371_100629933 | 273 |
| 36 | 3300013105 | Ga0157369_10035272 | Ga0157369_100352727 | 273 |
| 37 | 3300013307 | Ga0157372_10581736 | Ga0157372_105817361 | 273 |
| 38 | 3300025909 | Ga0207705_10155679 | Ga0207705_101556793 | 273 |
| 39 | 3300025912 | Ga0207707_10237111 | Ga0207707_102371111 | 273 |
| 40 | 3300025917 | Ga0207660_10128766 | Ga0207660_101287663 | 273 |
| 41 | 3300025919 | Ga0207657_10030117 | Ga0207657_100301173 | 273 |
| 42 | 3300025919 | Ga0207657_10058846 | Ga0207657_100588462 | 273 |
| 43 | 3300025921 | Ga0207652_10051344 | Ga0207652_100513442 | 273 |
| 44 | 3300025921 | Ga0207652_10057158 | Ga0207652_100571582 | 273 |
| 45 | 3300025921 | Ga0207652_10205525 | Ga0207652_102055251 | 273 |
| 46 | 3300025949 | Ga0207667_10415456 | Ga0207667_104154562 | 273 |
| 47 | 3300025949 | Ga0207667_10451868 | Ga0207667_104518682 | 273 |
| 48 | 3300026116 | Ga0207674_10023639 | Ga0207674_100236393 | 273 |
| 49 | 3300031548 | Ga0307408_100171204 | Ga0307408_1001712042 | 273 |
| 50 | 3300032002 | Ga0307416_100225719 | Ga0307416_1002257192 | 273 |
| 51 | 3300032002 | Ga0307416_100917861 | Ga0307416_1009178611 | 273 |
| 52 | 3300047472 | Ga0495686_0014410 | Ga0495686_0014410_3421_4245 | 273 |
| 53 | 3300047472 | Ga0495686_0030997 | Ga0495686_0030997_2261_3085 | 273 |
| 54 | 3300049571 | Ga0501034_0034863 | Ga0501034_0034863_1958_2791 | 273 |
| 55 | 3300049571 | Ga0501034_0541341 | Ga0501034_0541341_101_937 | 273 |
| 56 | 3300049586 | Ga0501070_0006093 | Ga0501070_0006093_2541_3374 | 273 |
| 57 | 3300049822 | Ga0501035_0082892 | Ga0501035_0082892_861_1697 | 273 |
| 58 | 3300003322 | rootL2_10154932 | rootL2_101549322 | 274 |
| 59 | 3300005328 | Ga0070676_10108264 | Ga0070676_101082642 | 274 |
| 60 | 3300005338 | Ga0068868_100197955 | Ga0068868_1001979552 | 274 |
| 61 | 3300005340 | Ga0070689_100097608 | Ga0070689_1000976082 | 274 |
| 62 | 3300005343 | Ga0070687_100030910 | Ga0070687_1000309102 | 274 |
| 63 | 3300005353 | Ga0070669_100178616 | Ga0070669_1001786162 | 274 |
| 64 | 3300005354 | Ga0070675_100021347 | Ga0070675_1000213474 | 274 |
| 65 | 3300005364 | Ga0070673_100103172 | Ga0070673_1001031722 | 274 |
| 66 | 3300005441 | Ga0070700_100034305 | Ga0070700_1000343053 | 274 |
| 67 | 3300005459 | Ga0068867_100133066 | Ga0068867_1001330662 | 274 |
| 68 | 3300005459 | Ga0068867_100233946 | Ga0068867_1002339462 | 274 |
| 69 | 3300005471 | Ga0070698_100001104 | Ga0070698_10000110415 | 274 |
| 70 | 3300005471 | Ga0070698_100021687 | Ga0070698_1000216875 | 274 |
| 71 | 3300005539 | Ga0068853_100036567 | Ga0068853_1000365672 | 274 |
| 72 | 3300005543 | Ga0070672_100029887 | Ga0070672_1000298873 | 274 |
| 73 | 3300005544 | Ga0070686_100023593 | Ga0070686_1000235933 | 274 |
| 74 | 3300005563 | Ga0068855_100082125 | Ga0068855_1000821252 | 274 |
| 75 | 3300005578 | Ga0068854_100176639 | Ga0068854_1001766392 | 274 |
| 76 | 3300005614 | Ga0068856_100128503 | Ga0068856_1001285032 | 274 |
| 77 | 3300005615 | Ga0070702_100037948 | Ga0070702_1000379482 | 274 |
| 78 | 3300005618 | Ga0068864_100011087 | Ga0068864_1000110874 | 274 |
| 79 | 3300005718 | Ga0068866_10016583 | Ga0068866_100165832 | 274 |
| 80 | 3300006358 | Ga0068871_100406021 | Ga0068871_1004060212 | 274 |
| 81 | 3300006844 | Ga0075428_100004225 | Ga0075428_10000422510 | 274 |
| 82 | 3300006846 | Ga0075430_100138875 | Ga0075430_1001388752 | 274 |
| 83 | 3300006847 | Ga0075431_100228046 | Ga0075431_1002280462 | 274 |
| 84 | 3300006880 | Ga0075429_100000723 | Ga0075429_10000072319 | 274 |
| 85 | 3300009093 | Ga0105240_10325931 | Ga0105240_103259312 | 274 |
| 86 | 3300009093 | Ga0105240_10961278 | Ga0105240_109612781 | 274 |
| 87 | 3300009148 | Ga0105243_10258725 | Ga0105243_102587252 | 274 |
| 88 | 3300009148 | Ga0105243_10361954 | Ga0105243_103619542 | 274 |
| 89 | 3300009176 | Ga0105242_10132938 | Ga0105242_101329381 | 274 |
| 90 | 3300009545 | Ga0105237_10185508 | Ga0105237_101855082 | 274 |
| 91 | 3300013100 | Ga0157373_10042751 | Ga0157373_100427511 | 274 |
| 92 | 3300013102 | Ga0157371_10000548 | Ga0157371_1000054848 | 274 |
| 93 | 3300013102 | Ga0157371_10027156 | Ga0157371_100271564 | 274 |
| 94 | 3300013104 | Ga0157370_10173171 | Ga0157370_101731712 | 274 |
| 95 | 3300013105 | Ga0157369_10116058 | Ga0157369_101160582 | 274 |
| 96 | 3300013297 | Ga0157378_10019019 | Ga0157378_100190192 | 274 |
| 97 | 3300013307 | Ga0157372_10097596 | Ga0157372_100975963 | 274 |
| 98 | 3300013307 | Ga0157372_10101648 | Ga0157372_101016482 | 274 |
| 99 | 3300013307 | Ga0157372_10587703 | Ga0157372_105877032 | 274 |
| 100 | 3300014325 | Ga0163163_10508884 | Ga0163163_105088841 | 274 |
| 101 | 3300014745 | Ga0157377_10041835 | Ga0157377_100418352 | 274 |
| 102 | 3300025907 | Ga0207645_10050048 | Ga0207645_100500483 | 274 |
| 103 | 3300025913 | Ga0207695_10239589 | Ga0207695_102395892 | 274 |
| 104 | 3300025918 | Ga0207662_10059882 | Ga0207662_100598822 | 274 |
| 105 | 3300025926 | Ga0207659_10068918 | Ga0207659_100689181 | 274 |
| 106 | 3300025936 | Ga0207670_10228909 | Ga0207670_102289092 | 274 |
| 107 | 3300025937 | Ga0207669_10015750 | Ga0207669_100157503 | 274 |
| 108 | 3300025940 | Ga0207691_10003985 | Ga0207691_100039853 | 274 |
| 109 | 3300025940 | Ga0207691_10035749 | Ga0207691_100357493 | 274 |
| 110 | 3300025945 | Ga0207679_10057959 | Ga0207679_100579592 | 274 |
| 111 | 3300025960 | Ga0207651_10053544 | Ga0207651_100535442 | 274 |
| 112 | 3300025960 | Ga0207651_10151767 | Ga0207651_101517671 | 274 |
| 113 | 3300025972 | Ga0207668_10365645 | Ga0207668_103656452 | 274 |
| 114 | 3300025981 | Ga0207640_10349832 | Ga0207640_103498321 | 274 |
| 115 | 3300026041 | Ga0207639_10027886 | Ga0207639_100278863 | 274 |
| 116 | 3300026041 | Ga0207639_10537977 | Ga0207639_105379771 | 274 |
| 117 | 3300026075 | Ga0207708_10065580 | Ga0207708_100655802 | 274 |
| 118 | 3300026088 | Ga0207641_10068213 | Ga0207641_100682132 | 274 |
| 119 | 3300026089 | Ga0207648_10003423 | Ga0207648_1000342315 | 274 |
| 120 | 3300026089 | Ga0207648_10087124 | Ga0207648_100871242 | 274 |
| 121 | 3300026089 | Ga0207648_10109139 | Ga0207648_101091391 | 274 |
| 122 | 3300026116 | Ga0207674_10334838 | Ga0207674_103348382 | 274 |
| 123 | 3300026118 | Ga0207675_100087912 | Ga0207675_1000879122 | 274 |
| 124 | 3300027471 | Ga0209995_1002454 | Ga0209995_10024542 | 274 |
| 125 | 3300031251 | Ga0265327_10000193 | Ga0265327_10000193108 | 274 |
| 126 | 3300032133 | Ga0316583_10004893 | Ga0316583_100048933 | 274 |
| 127 | 3300041512 | Ga0451853_1468156 | Ga0451853_1468156_11_847 | 274 |
| 128 | 3300042156 | Ga0439446_0077117 | Ga0439446_0077117_104_931 | 274 |
| 129 | 3300045051 | Ga0451576_0013620 | Ga0451576_0013620_5211_6038 | 274 |
| 130 | 3300045051 | Ga0451576_0121003 | Ga0451576_0121003_901_1728 | 274 |
| 131 | 3300045051 | Ga0451576_0178061 | Ga0451576_0178061_1377_2204 | 274 |
| 132 | 3300046460 | Ga0495638_0106181 | Ga0495638_0106181_782_1615 | 274 |
| 133 | 3300047320 | Ga0495672_0009330 | Ga0495672_0009330_5253_6080 | 274 |
| 134 | 3300047320 | Ga0495672_0037863 | Ga0495672_0037863_1572_2399 | 274 |
| 135 | 3300049571 | Ga0501034_0051595 | Ga0501034_0051595_3045_3881 | 274 |
| 136 | 3300049742 | Ga0501080_0067814 | Ga0501080_0067814_276_1112 | 274 |
| 137 | 3300050508 | nmdc:mga09592_81133_c1 | nmdc:mga09592_81133_c1_1790_2617 | 274 |
| 138 | 3300050509 | nmdc:mga0qj67_145430_c1 | nmdc:mga0qj67_145430_c1_47_874 | 274 |
| 139 | 3300050510 | nmdc:mga06r32_138104_c1 | nmdc:mga06r32_138104_c1_213_1040 | 274 |
| 140 | 3300053139 | Ga0500568_0000880 | Ga0500568_0000880_6179_7054 | 274 |
| 141 | 3300053727 | Ga0500611_000033 | Ga0500611_000033_64071_64907 | 274 |
| 142 | 3300053727 | Ga0500611_000048 | Ga0500611_000048_36748_37581 | 274 |
| 143 | 3300002459 | JGI24751J29686_10004047 | JGI24751J29686_100040473 | 275 |
| 144 | 3300002459 | JGI24751J29686_10013904 | JGI24751J29686_100139042 | 275 |
| 145 | 3300005289 | Ga0065704_10147617 | Ga0065704_101476172 | 275 |
| 146 | 3300005290 | Ga0065712_10006000 | Ga0065712_100060002 | 275 |
| 147 | 3300005295 | Ga0065707_10108386 | Ga0065707_101083862 | 275 |
| 148 | 3300005329 | Ga0070683_100499949 | Ga0070683_1004999492 | 275 |
| 149 | 3300005331 | Ga0070670_100025909 | Ga0070670_1000259092 | 275 |
| 150 | 3300005337 | Ga0070682_100102545 | Ga0070682_1001025452 | 275 |
| 151 | 3300005340 | Ga0070689_100002994 | Ga0070689_1000029948 | 275 |
| 152 | 3300005340 | Ga0070689_100031165 | Ga0070689_1000311654 | 275 |
| 153 | 3300005343 | Ga0070687_100005612 | Ga0070687_1000056121 | 275 |
| 154 | 3300005364 | Ga0070673_100254647 | Ga0070673_1002546471 | 275 |
| 155 | 3300005365 | Ga0070688_100008502 | Ga0070688_1000085022 | 275 |
| 156 | 3300005365 | Ga0070688_100097912 | Ga0070688_1000979122 | 275 |
| 157 | 3300005367 | Ga0070667_100028545 | Ga0070667_1000285453 | 275 |
| 158 | 3300005441 | Ga0070700_100023820 | Ga0070700_1000238203 | 275 |
| 159 | 3300005441 | Ga0070700_100178586 | Ga0070700_1001785862 | 275 |
| 160 | 3300005466 | Ga0070685_10002599 | Ga0070685_100025997 | 275 |
| 161 | 3300005471 | Ga0070698_100012395 | Ga0070698_1000123955 | 275 |
| 162 | 3300005535 | Ga0070684_100095085 | Ga0070684_1000950852 | 275 |
| 163 | 3300005535 | Ga0070684_100303858 | Ga0070684_1003038582 | 275 |
| 164 | 3300005564 | Ga0070664_100160860 | Ga0070664_1001608601 | 275 |
| 165 | 3300005564 | Ga0070664_100280458 | Ga0070664_1002804582 | 275 |
| 166 | 3300005577 | Ga0068857_100010725 | Ga0068857_1000107254 | 275 |
| 167 | 3300005616 | Ga0068852_100108753 | Ga0068852_1001087533 | 275 |
| 168 | 3300005617 | Ga0068859_100002811 | Ga0068859_1000028114 | 275 |
| 169 | 3300005617 | Ga0068859_100039363 | Ga0068859_1000393634 | 275 |
| 170 | 3300005617 | Ga0068859_100171569 | Ga0068859_1001715692 | 275 |
| 171 | 3300005617 | Ga0068859_100356091 | Ga0068859_1003560912 | 275 |
| 172 | 3300005617 | Ga0068859_100456721 | Ga0068859_1004567212 | 275 |
| 173 | 3300005719 | Ga0068861_100010592 | Ga0068861_1000105925 | 275 |
| 174 | 3300005840 | Ga0068870_10088050 | Ga0068870_100880502 | 275 |
| 175 | 3300005840 | Ga0068870_10119311 | Ga0068870_101193112 | 275 |
| 176 | 3300005841 | Ga0068863_100099482 | Ga0068863_1000994822 | 275 |
| 177 | 3300005841 | Ga0068863_100261419 | Ga0068863_1002614192 | 275 |
| 178 | 3300005841 | Ga0068863_100349416 | Ga0068863_1003494161 | 275 |
| 179 | 3300005843 | Ga0068860_100006421 | Ga0068860_1000064214 | 275 |
| 180 | 3300005843 | Ga0068860_100184873 | Ga0068860_1001848732 | 275 |
| 181 | 3300006358 | Ga0068871_100085659 | Ga0068871_1000856592 | 275 |
| 182 | 3300006844 | Ga0075428_100104274 | Ga0075428_1001042742 | 275 |
| 183 | 3300006844 | Ga0075428_100196831 | Ga0075428_1001968312 | 275 |
| 184 | 3300006931 | Ga0097620_100002810 | Ga0097620_1000028104 | 275 |
| 185 | 3300006931 | Ga0097620_100039364 | Ga0097620_1000393644 | 275 |
| 186 | 3300006931 | Ga0097620_100171570 | Ga0097620_1001715702 | 275 |
| 187 | 3300006931 | Ga0097620_100356088 | Ga0097620_1003560882 | 275 |
| 188 | 3300006931 | Ga0097620_100456761 | Ga0097620_1004567612 | 275 |
| 189 | 3300009093 | Ga0105240_10396875 | Ga0105240_103968752 | 275 |
| 190 | 3300009094 | Ga0111539_10303803 | Ga0111539_103038031 | 275 |
| 191 | 3300009094 | Ga0111539_10314367 | Ga0111539_103143672 | 275 |
| 192 | 3300009176 | Ga0105242_10005404 | Ga0105242_100054042 | 275 |
| 193 | 3300009176 | Ga0105242_10099053 | Ga0105242_100990532 | 275 |
| 194 | 3300009176 | Ga0105242_10517243 | Ga0105242_105172432 | 275 |
| 195 | 3300009176 | Ga0105242_10747819 | Ga0105242_107478191 | 275 |
| 196 | 3300009553 | Ga0105249_10006282 | Ga0105249_100062827 | 275 |
| 197 | 3300009553 | Ga0105249_10023039 | Ga0105249_100230392 | 275 |
| 198 | 3300009553 | Ga0105249_10034405 | Ga0105249_100344054 | 275 |
| 199 | 3300009553 | Ga0105249_10346510 | Ga0105249_103465102 | 275 |
| 200 | 3300013102 | Ga0157371_10009574 | Ga0157371_100095746 | 275 |
| 201 | 3300013102 | Ga0157371_10013223 | Ga0157371_100132233 | 275 |
| 202 | 3300013102 | Ga0157371_10212119 | Ga0157371_102121192 | 275 |
| 203 | 3300013296 | Ga0157374_10104708 | Ga0157374_101047082 | 275 |
| 204 | 3300013297 | Ga0157378_10161056 | Ga0157378_101610562 | 275 |
| 205 | 3300013297 | Ga0157378_10232876 | Ga0157378_102328762 | 275 |
| 206 | 3300013306 | Ga0163162_10128188 | Ga0163162_101281882 | 275 |
| 207 | 3300013307 | Ga0157372_10003393 | Ga0157372_100033932 | 275 |
| 208 | 3300013308 | Ga0157375_10038654 | Ga0157375_100386544 | 275 |
| 209 | 3300013308 | Ga0157375_10999661 | Ga0157375_109996612 | 275 |
| 210 | 3300014325 | Ga0163163_10032548 | Ga0163163_100325482 | 275 |
| 211 | 3300014326 | Ga0157380_10323417 | Ga0157380_103234171 | 275 |
| 212 | 3300014969 | Ga0157376_10001877 | Ga0157376_100018772 | 275 |
| 213 | 3300014969 | Ga0157376_10308969 | Ga0157376_103089692 | 275 |
| 214 | 3300025908 | Ga0207643_10006914 | Ga0207643_100069142 | 275 |
| 215 | 3300025913 | Ga0207695_10285192 | Ga0207695_102851922 | 275 |
| 216 | 3300025918 | Ga0207662_10054675 | Ga0207662_100546752 | 275 |
| 217 | 3300025918 | Ga0207662_10218685 | Ga0207662_102186852 | 275 |
| 218 | 3300025923 | Ga0207681_10144738 | Ga0207681_101447382 | 275 |
| 219 | 3300025925 | Ga0207650_10458572 | Ga0207650_104585721 | 275 |
| 220 | 3300025926 | Ga0207659_10333761 | Ga0207659_103337612 | 275 |
| 221 | 3300025934 | Ga0207686_10000937 | Ga0207686_100009379 | 275 |
| 222 | 3300025936 | Ga0207670_10019549 | Ga0207670_100195494 | 275 |
| 223 | 3300025937 | Ga0207669_10333950 | Ga0207669_103339501 | 275 |
| 224 | 3300025938 | Ga0207704_10322927 | Ga0207704_103229272 | 275 |
| 225 | 3300025940 | Ga0207691_10159229 | Ga0207691_101592291 | 275 |
| 226 | 3300025942 | Ga0207689_10019904 | Ga0207689_100199042 | 275 |
| 227 | 3300025944 | Ga0207661_10248429 | Ga0207661_102484292 | 275 |
| 228 | 3300025945 | Ga0207679_10098992 | Ga0207679_100989922 | 275 |
| 229 | 3300025960 | Ga0207651_10099221 | Ga0207651_100992212 | 275 |
| 230 | 3300025961 | Ga0207712_10001478 | Ga0207712_100014785 | 275 |
| 231 | 3300025961 | Ga0207712_10042565 | Ga0207712_100425653 | 275 |
| 232 | 3300025986 | Ga0207658_10033047 | Ga0207658_100330472 | 275 |
| 233 | 3300025986 | Ga0207658_10064831 | Ga0207658_100648313 | 275 |
| 234 | 3300026023 | Ga0207677_10075645 | Ga0207677_100756452 | 275 |
| 235 | 3300026075 | Ga0207708_10003347 | Ga0207708_100033474 | 275 |
| 236 | 3300026075 | Ga0207708_10087066 | Ga0207708_100870662 | 275 |
| 237 | 3300026088 | Ga0207641_10000111 | Ga0207641_100001114 | 275 |
| 238 | 3300026088 | Ga0207641_10034216 | Ga0207641_100342163 | 275 |
| 239 | 3300026088 | Ga0207641_10104031 | Ga0207641_101040312 | 275 |
| 240 | 3300026088 | Ga0207641_10466514 | Ga0207641_104665142 | 275 |
| 241 | 3300026089 | Ga0207648_10042607 | Ga0207648_100426073 | 275 |
| 242 | 3300026089 | Ga0207648_10044820 | Ga0207648_100448203 | 275 |
| 243 | 3300026116 | Ga0207674_10020230 | Ga0207674_100202305 | 275 |
| 244 | 3300026116 | Ga0207674_10223373 | Ga0207674_102233732 | 275 |
| 245 | 3300026118 | Ga0207675_100018475 | Ga0207675_1000184754 | 275 |
| 246 | 3300026121 | Ga0207683_10182050 | Ga0207683_101820502 | 275 |
| 247 | 3300026142 | Ga0207698_10465737 | Ga0207698_104657371 | 275 |
| 248 | 3300028380 | Ga0268265_10484124 | Ga0268265_104841242 | 275 |
| 249 | 3300028381 | Ga0268264_10001248 | Ga0268264_100012488 | 275 |
| 250 | 3300028794 | Ga0307515_10000001 | Ga0307515_100000011764 | 275 |
| 251 | 3300031251 | Ga0265327_10000159 | Ga0265327_1000015956 | 275 |
| 252 | 3300041459 | Ga0451800_0091743 | Ga0451800_0091743_99_929 | 275 |
| 253 | 3300041486 | Ga0451807_2226376 | Ga0451807_2226376_920_1750 | 275 |
| 254 | 3300042125 | Ga0450923_020821 | Ga0450923_020821_370_1200 | 275 |
| 255 | 3300046499 | Ga0495594_0210809 | Ga0495594_0210809_89_919 | 275 |
| 256 | 3300046539 | Ga0495621_0055689 | Ga0495621_0055689_133_963 | 275 |
| 257 | 3300049579 | Ga0501043_0020705 | Ga0501043_0020705_4034_4864 | 275 |
| 258 | 3300050511 | nmdc:mga08y16_418557_c1 | nmdc:mga08y16_418557_c1_24_854 | 275 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3bqb-assembly1.cif.gz_X | hexagonal kristal form of 2-keto-3-deoxyarabinonate dehydratase | 0.8588 | 1 | 275 |
| 3bqb-assembly1.cif.gz_X | hexagonal kristal form of 2-keto-3-deoxyarabinonate dehydratase | 0.8558 | 1 | 275 |
| 2q1d-assembly1.cif.gz_X | 2-keto-3-deoxy-d-arabinonate dehydratase complexed with magnesium and 2,5-dioxopentanoate | 0.8447 | 1 | 275 |
| 2q1d-assembly1.cif.gz_X | 2-keto-3-deoxy-d-arabinonate dehydratase complexed with magnesium and 2,5-dioxopentanoate | 0.8417 | 1 | 275 |
| 3bqb-assembly1.cif.gz_A | hexagonal kristal form of 2-keto-3-deoxyarabinonate dehydratase | 0.8327 | 1 | 274 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2q18X02 | Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain | 0.9245 | 62 | 275 | 3.90.850.10 |
| 2q18X02 | Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain | 0.8992 | 62 | 275 | 3.90.850.10 |
| 4dbfB02 | Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain | 0.8372 | 62 | 274 | 3.90.850.10 |
| 4dbfB02 | Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain | 0.8176 | 62 | 274 | 3.90.850.10 |
| 1wzoC02 | Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain | 0.8149 | 62 | 275 | 3.90.850.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A349BVW8-F1-model_v4 | Fumarylacetoacetase-like C-terminal domain-containing protein | 0.9877 | 193 | 275 |
GO:0003824
|
| AF-A0A537IWT0-F1-model_v4 | 2-hydroxyhepta-2,4-diene-1,7-dioate isomerase | 0.9842 | 163 | 275 |
GO:0016853
GO:0044281 |
| AF-A0A3B9G7U1-F1-model_v4 | 2-hydroxyhepta-2,4-diene-1,7-dioate isomerase | 0.9791 | 97 | 275 |
GO:0016853
GO:0044281 |
| AF-A0A3L7WW04-F1-model_v4 | Fumarylacetoacetase-like C-terminal domain-containing protein | 0.9784 | 194 | 274 |
GO:0003824
|
| AF-A0A537JWX1-F1-model_v4 | 2-hydroxyhepta-2,4-diene-1,7-dioate isomerase | 0.977 | 141 | 274 |
GO:0016853
GO:0044281 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar