F368077

General Info

Members Datasets Scaffolds Average Seq Length
258 143 258 276

Family's Representative Sequence

Representative Sequence 3300013102|Ga0157371_10062993|Ga0157371_100629933
Length 310
Sequence MWRNLQNPNNKNLLVYCYFQIKNLSFRINYFWKMKIYKTKKGIIIEKENKFYLSKEDWDLFINDDHLFQKMENIIQRAGVHENKIRLTEEDIVAPVGNQELWACGVTYLRSKEGRQEESKDAGGGDFYARVYEAERPEVFFKSTPHRIVGHNGKVRIRKDSTWDVPEPELTLAVTSSGKIVGYTIGNDMSSRSIEGENPLYLPQAKTYDGCASLGPCIYVSEKPLDNSTKIYLEINRNDLKVFEGNIGINQMKRAFEELVSFVFRECSFPNGCLITTGTGIVPGNDFTLQAKDEIRISIDQIGTLANIVE

Samples

Sample ID Description Type Environment
1 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
49 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
50 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
51 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
61 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
62 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
72 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
114 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
115 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
116 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
117 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
118 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
119 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
120 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
121 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
122 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
123 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
124 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
125 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
126 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
127 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
128 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
129 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
130 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
131 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
135 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
136 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
137 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
138 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
139 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
140 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
141 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
142 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
143 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.16
Nodule 0
Rhizoplane 0.78
Rhizosphere 96.12
Stem 0
Stem Tuber 0
Unclassified 1.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10004047 3300002459 Unclassified 2967
2 JGI24751J29686_10013904 3300002459 Bacteria 1661
3 rootL2_10154932 3300003322 Bacteria 3657
4 Ga0065704_10147617 3300005289 Unclassified 1457
5 Ga0065712_10006000 3300005290 Bacteria 5239
6 Ga0065707_10108386 3300005295 Bacteria 2512
7 Ga0070658_10035121 3300005327 Bacteria 4036
8 Ga0070676_10108264 3300005328 Unclassified 1727
9 Ga0070683_100499949 3300005329 Bacteria 1161
10 Ga0070670_100025909 3300005331 Bacteria 5045
11 Ga0068869_100064174 3300005334 Bacteria 2701
12 Ga0070682_100102545 3300005337 Bacteria 1891
13 Ga0068868_100197955 3300005338 Bacteria 1673
14 Ga0070660_100008086 3300005339 Bacteria 7352
15 Ga0070689_100002994 3300005340 Bacteria 11111
16 Ga0070689_100031165 3300005340 Bacteria 4052
17 Ga0070689_100097608 3300005340 Bacteria 2323
18 Ga0070687_100005612 3300005343 Bacteria 5088
19 Ga0070687_100030910 3300005343 Bacteria 2621
20 Ga0070669_100178616 3300005353 Unclassified 1659
21 Ga0070675_100021347 3300005354 Bacteria 5174
22 Ga0070673_100009064 3300005364 Bacteria 6661
23 Ga0070673_100103172 3300005364 Bacteria 2352
24 Ga0070673_100254647 3300005364 Unclassified 1531
25 Ga0070688_100008502 3300005365 Bacteria 5573
26 Ga0070688_100097912 3300005365 Unclassified 1929
27 Ga0070659_100140711 3300005366 Bacteria 1965
28 Ga0070667_100028545 3300005367 Bacteria 4646
29 Ga0070700_100023820 3300005441 Unclassified 3586
30 Ga0070700_100034305 3300005441 Bacteria 3064
31 Ga0070700_100178586 3300005441 Unclassified 1475
32 Ga0070681_10423923 3300005458 Bacteria 1243
33 Ga0068867_100133066 3300005459 Bacteria 1935
34 Ga0068867_100233946 3300005459 Unclassified 1487
35 Ga0070685_10002599 3300005466 Bacteria 9247
36 Ga0070698_100001104 3300005471 Bacteria 29751
37 Ga0070698_100012395 3300005471 Bacteria 9030
38 Ga0070698_100021687 3300005471 Bacteria 6725
39 Ga0070679_100006452 3300005530 Bacteria 10928
40 Ga0070679_100068169 3300005530 Bacteria 3549
41 Ga0070679_100225680 3300005530 Bacteria 1833
42 Ga0070684_100095085 3300005535 Bacteria 2654
43 Ga0070684_100303858 3300005535 Bacteria 1464
44 Ga0068853_100036567 3300005539 Bacteria 4177
45 Ga0070672_100029887 3300005543 Bacteria 4090
46 Ga0070686_100023593 3300005544 Bacteria 3679
47 Ga0068855_100082125 3300005563 Bacteria 3735
48 Ga0068855_100451407 3300005563 Bacteria 1403
49 Ga0070664_100160860 3300005564 Bacteria 1986
50 Ga0070664_100280458 3300005564 Bacteria 1502
51 Ga0068857_100010725 3300005577 Bacteria 7974
52 Ga0068857_100051832 3300005577 Bacteria 3641
53 Ga0068857_100267432 3300005577 Bacteria 1571
54 Ga0068854_100176639 3300005578 Bacteria 1665
55 Ga0068856_100128503 3300005614 Unclassified 2538
56 Ga0070702_100037948 3300005615 Bacteria 2679
57 Ga0068852_100108753 3300005616 Bacteria 2516
58 Ga0068852_100188229 3300005616 Bacteria 1946
59 Ga0068859_100002811 3300005617 Bacteria 17638
60 Ga0068859_100039363 3300005617 Bacteria 4743
61 Ga0068859_100171569 3300005617 Bacteria 2250
62 Ga0068859_100356091 3300005617 Unclassified 1558
63 Ga0068859_100456721 3300005617 Bacteria 1373
64 Ga0068864_100011087 3300005618 Bacteria 7449
65 Ga0068866_10016583 3300005718 Unclassified 3296
66 Ga0068861_100010592 3300005719 Bacteria 6402
67 Ga0068870_10088050 3300005840 Unclassified 1730
68 Ga0068870_10119311 3300005840 Bacteria 1517
69 Ga0068870_10159358 3300005840 Unclassified 1337
70 Ga0068863_100099482 3300005841 Bacteria 2763
71 Ga0068863_100261419 3300005841 Unclassified 1673
72 Ga0068863_100349416 3300005841 Bacteria 1440
73 Ga0068860_100006421 3300005843 Bacteria 11804
74 Ga0068860_100184873 3300005843 Bacteria 2015
75 Ga0081539_10011718 3300005985 Bacteria 6879
76 Ga0068871_100085659 3300006358 Bacteria 2617
77 Ga0068871_100406021 3300006358 Unclassified 1214
78 Ga0075428_100004225 3300006844 Bacteria 15814
79 Ga0075428_100104274 3300006844 Bacteria 3092
80 Ga0075428_100196831 3300006844 Bacteria 2179
81 Ga0075430_100138875 3300006846 Unclassified 2024
82 Ga0075431_100228046 3300006847 Unclassified 1898
83 Ga0075429_100000723 3300006880 Bacteria 25874
84 Ga0097620_100002810 3300006931 Bacteria 17638
85 Ga0097620_100039364 3300006931 Bacteria 4743
86 Ga0097620_100171570 3300006931 Bacteria 2250
87 Ga0097620_100356088 3300006931 Unclassified 1558
88 Ga0097620_100456761 3300006931 Bacteria 1373
89 Ga0105240_10325931 3300009093 Bacteria 1749
90 Ga0105240_10396875 3300009093 Bacteria 1554
91 Ga0105240_10961278 3300009093 Bacteria 916
92 Ga0111539_10303803 3300009094 Bacteria 1857
93 Ga0111539_10314367 3300009094 Bacteria 1823
94 Ga0114129_10176255 3300009147 Bacteria 2912
95 Ga0105243_10258725 3300009148 Bacteria 1557
96 Ga0105243_10361954 3300009148 Bacteria 1335
97 Ga0105242_10005404 3300009176 Bacteria 9882
98 Ga0105242_10099053 3300009176 Unclassified 2467
99 Ga0105242_10132938 3300009176 Bacteria 2150
100 Ga0105242_10517243 3300009176 Bacteria 1138
101 Ga0105242_10747819 3300009176 Unclassified 962
102 Ga0105237_10185508 3300009545 Bacteria 2080
103 Ga0105249_10006282 3300009553 Bacteria 10323
104 Ga0105249_10023039 3300009553 Bacteria 5583
105 Ga0105249_10034405 3300009553 Unclassified 4592
106 Ga0105249_10346510 3300009553 Bacteria 1504
107 Ga0105246_10269672 3300011119 Bacteria 1360
108 Ga0157373_10010949 3300013100 Bacteria 6677
109 Ga0157373_10042751 3300013100 Bacteria 3238
110 Ga0157373_10144141 3300013100 Bacteria 1675
111 Ga0157371_10000548 3300013102 Bacteria 44733
112 Ga0157371_10003863 3300013102 Bacteria 13369
113 Ga0157371_10009574 3300013102 Bacteria 7620
114 Ga0157371_10013223 3300013102 Bacteria 6282
115 Ga0157371_10027156 3300013102 Bacteria 4154
116 Ga0157371_10029538 3300013102 Bacteria 3962
117 Ga0157371_10062993 3300013102 Bacteria 2628
118 Ga0157371_10212119 3300013102 Bacteria 1390
119 Ga0157370_10173171 3300013104 Bacteria 2006
120 Ga0157369_10035272 3300013105 Bacteria 5486
121 Ga0157369_10116058 3300013105 Unclassified 2843
122 Ga0157374_10104708 3300013296 Bacteria 2716
123 Ga0157378_10019019 3300013297 Bacteria 6037
124 Ga0157378_10161056 3300013297 Bacteria 2098
125 Ga0157378_10232876 3300013297 Unclassified 1756
126 Ga0163162_10128188 3300013306 Bacteria 2645
127 Ga0157372_10003393 3300013307 Bacteria 17187
128 Ga0157372_10097596 3300013307 Bacteria 3351
129 Ga0157372_10101648 3300013307 Bacteria 3282
130 Ga0157372_10581736 3300013307 Bacteria 1305
131 Ga0157372_10587703 3300013307 Bacteria 1298
132 Ga0157375_10038654 3300013308 Bacteria 4582
133 Ga0157375_10999661 3300013308 Unclassified 976
134 Ga0163163_10032548 3300014325 Bacteria 5036
135 Ga0163163_10508884 3300014325 Bacteria 1266
136 Ga0157380_10323417 3300014326 Bacteria 1431
137 Ga0157380_10739032 3300014326 Bacteria 994
138 Ga0157377_10041835 3300014745 Bacteria 2543
139 Ga0157376_10001877 3300014969 Bacteria 14019
140 Ga0157376_10308969 3300014969 Unclassified 1499
141 Ga0207682_10009236 3300025893 Bacteria 3895
142 Ga0207645_10050048 3300025907 Bacteria 2668
143 Ga0207643_10006914 3300025908 Bacteria 6082
144 Ga0207643_10102076 3300025908 Unclassified 1682
145 Ga0207705_10022270 3300025909 Bacteria 4519
146 Ga0207705_10155679 3300025909 Bacteria 1714
147 Ga0207707_10237111 3300025912 Bacteria 1587
148 Ga0207695_10239589 3300025913 Bacteria 1716
149 Ga0207695_10285192 3300025913 Bacteria 1544
150 Ga0207660_10128766 3300025917 Bacteria 1925
151 Ga0207662_10054675 3300025918 Bacteria 2381
152 Ga0207662_10059882 3300025918 Bacteria 2283
153 Ga0207662_10218685 3300025918 Bacteria 1240
154 Ga0207657_10030117 3300025919 Bacteria 4931
155 Ga0207657_10058846 3300025919 Bacteria 3305
156 Ga0207652_10051344 3300025921 Bacteria 3535
157 Ga0207652_10057158 3300025921 Bacteria 3359
158 Ga0207652_10205525 3300025921 Bacteria 1772
159 Ga0207681_10144738 3300025923 Bacteria 1774
160 Ga0207650_10458572 3300025925 Unclassified 1061
161 Ga0207659_10068918 3300025926 Bacteria 2574
162 Ga0207659_10333761 3300025926 Unclassified 1254
163 Ga0207686_10000937 3300025934 Bacteria 17450
164 Ga0207670_10019549 3300025936 Bacteria 4139
165 Ga0207670_10228909 3300025936 Bacteria 1427
166 Ga0207669_10015750 3300025937 Bacteria 3822
167 Ga0207669_10333950 3300025937 Bacteria 1165
168 Ga0207704_10322927 3300025938 Unclassified 1191
169 Ga0207691_10003985 3300025940 Bacteria 14344
170 Ga0207691_10035749 3300025940 Bacteria 4607
171 Ga0207691_10159229 3300025940 Bacteria 1982
172 Ga0207691_10357885 3300025940 Bacteria 1248
173 Ga0207689_10019904 3300025942 Bacteria 5652
174 Ga0207689_10056197 3300025942 Bacteria 3238
175 Ga0207661_10248429 3300025944 Bacteria 1580
176 Ga0207679_10057959 3300025945 Bacteria 2867
177 Ga0207679_10098992 3300025945 Bacteria 2275
178 Ga0207667_10415456 3300025949 Bacteria 1369
179 Ga0207667_10451868 3300025949 Bacteria 1306
180 Ga0207651_10053544 3300025960 Bacteria 2759
181 Ga0207651_10099221 3300025960 Unclassified 2156
182 Ga0207651_10151767 3300025960 Bacteria 1804
183 Ga0207651_10385749 3300025960 Unclassified 1188
184 Ga0207712_10001478 3300025961 Bacteria 16013
185 Ga0207712_10042565 3300025961 Unclassified 3128
186 Ga0207668_10365645 3300025972 Unclassified 1210
187 Ga0207640_10349832 3300025981 Bacteria 1187
188 Ga0207658_10033047 3300025986 Bacteria 3687
189 Ga0207658_10064831 3300025986 Bacteria 2742
190 Ga0207677_10075645 3300026023 Bacteria 2394
191 Ga0207639_10027886 3300026041 Bacteria 4118
192 Ga0207639_10184197 3300026041 Bacteria 1779
193 Ga0207639_10537977 3300026041 Bacteria 1071
194 Ga0207708_10003347 3300026075 Bacteria 11818
195 Ga0207708_10065580 3300026075 Bacteria 2776
196 Ga0207708_10087066 3300026075 Bacteria 2404
197 Ga0207641_10000111 3300026088 Bacteria 120527
198 Ga0207641_10034216 3300026088 Bacteria 4225
199 Ga0207641_10068213 3300026088 Bacteria 3049
200 Ga0207641_10104031 3300026088 Bacteria 2506
201 Ga0207641_10466514 3300026088 Bacteria 1222
202 Ga0207648_10003423 3300026089 Bacteria 16650
203 Ga0207648_10042607 3300026089 Bacteria 3984
204 Ga0207648_10044820 3300026089 Unclassified 3881
205 Ga0207648_10087124 3300026089 Bacteria 2725
206 Ga0207648_10109139 3300026089 Bacteria 2429
207 Ga0207674_10020230 3300026116 Bacteria 7197
208 Ga0207674_10023639 3300026116 Bacteria 6579
209 Ga0207674_10223373 3300026116 Bacteria 1832
210 Ga0207674_10334838 3300026116 Bacteria 1463
211 Ga0207675_100018475 3300026118 Bacteria 6503
212 Ga0207675_100087912 3300026118 Bacteria 2919
213 Ga0207683_10182050 3300026121 Bacteria 1905
214 Ga0207698_10465737 3300026142 Bacteria 1223
215 Ga0209995_1002454 3300027471 Unclassified 2928
216 Ga0268265_10484124 3300028380 Unclassified 1163
217 Ga0268264_10001248 3300028381 Bacteria 24263
218 Ga0307515_10000001 3300028794 Bacteria 4259510
219 Ga0265327_10000159 3300031251 Bacteria 145537
220 Ga0265327_10000193 3300031251 Bacteria 129367
221 Ga0307408_100171204 3300031548 Bacteria 1734
222 Ga0307416_100225719 3300032002 Bacteria 1801
223 Ga0307416_100917861 3300032002 Unclassified 976
224 Ga0316583_10004893 3300032133 Bacteria 4788
225 Ga0395905_0390056 3300037471 Bacteria 1287
226 Ga0436365_0071140 3300039437 Bacteria 1129
227 Ga0436365_0968987 3300039437 Bacteria 46063
228 Ga0451800_0091743 3300041459 Bacteria 1537
229 Ga0451807_2226376 3300041486 Bacteria 1769
230 Ga0451853_1468156 3300041512 Bacteria 1686
231 Ga0450923_020821 3300042125 Bacteria 1274
232 Ga0439446_0077117 3300042156 Unclassified 1027
233 Ga0451576_0013620 3300045051 Bacteria 9091
234 Ga0451576_0121003 3300045051 Bacteria 2725
235 Ga0451576_0178061 3300045051 Bacteria 2220
236 Ga0495638_0106181 3300046460 Unclassified 1673
237 Ga0495594_0210809 3300046499 Unclassified 1108
238 Ga0495621_0055689 3300046539 Bacteria 1424
239 Ga0495672_0009330 3300047320 Bacteria 7122
240 Ga0495672_0037863 3300047320 Bacteria 2948
241 Ga0495686_0014410 3300047472 Bacteria 5442
242 Ga0495686_0030997 3300047472 Bacteria 3470
243 Ga0501034_0034863 3300049571 Bacteria 5103
244 Ga0501034_0051595 3300049571 Bacteria 4148
245 Ga0501034_0541341 3300049571 Bacteria 1074
246 Ga0501043_0020705 3300049579 Bacteria 5160
247 Ga0501046_0004696 3300049580 Bacteria 12330
248 Ga0501070_0006093 3300049586 Bacteria 10274
249 Ga0501080_0067814 3300049742 Bacteria 3318
250 Ga0501035_0082892 3300049822 Bacteria 2830
251 nmdc:mga05p37_476474_c1 3300050507 Bacteria 1439
252 nmdc:mga09592_81133_c1 3300050508 Unclassified 2764
253 nmdc:mga0qj67_145430_c1 3300050509 Unclassified 1922
254 nmdc:mga06r32_138104_c1 3300050510 Unclassified 2412
255 nmdc:mga08y16_418557_c1 3300050511 Bacteria 1369
256 Ga0500568_0000880 3300053139 Bacteria 21086
257 Ga0500611_000033 3300053727 Bacteria 79214
258 Ga0500611_000048 3300053727 Bacteria 56160

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037471 Ga0395905_0390056 Ga0395905_0390056_460_1260 254
2 3300025940 Ga0207691_10357885 Ga0207691_103578852 256
3 3300025942 Ga0207689_10056197 Ga0207689_100561973 260
4 3300026041 Ga0207639_10184197 Ga0207639_101841972 261
5 3300005364 Ga0070673_100009064 Ga0070673_1000090642 263
6 3300005840 Ga0068870_10159358 Ga0068870_101593582 263
7 3300025893 Ga0207682_10009236 Ga0207682_100092362 263
8 3300025908 Ga0207643_10102076 Ga0207643_101020762 263
9 3300025960 Ga0207651_10385749 Ga0207651_103857491 263
10 3300005577 Ga0068857_100267432 Ga0068857_1002674322 264
11 3300049580 Ga0501046_0004696 Ga0501046_0004696_132_968 264
12 3300005334 Ga0068869_100064174 Ga0068869_1000641742 265
13 3300009147 Ga0114129_10176255 Ga0114129_101762552 268
14 3300050507 nmdc:mga05p37_476474_c1 nmdc:mga05p37_476474_c1_134_964 268
15 3300011119 Ga0105246_10269672 Ga0105246_102696721 269
16 3300013102 Ga0157371_10003863 Ga0157371_100038635 269
17 3300014326 Ga0157380_10739032 Ga0157380_107390321 269
18 3300005985 Ga0081539_10011718 Ga0081539_100117184 270
19 3300039437 Ga0436365_0968987 Ga0436365_0968987_12937_13761 270
20 3300039437 Ga0436365_0071140 Ga0436365_0071140_289_1116 271
21 3300025909 Ga0207705_10022270 Ga0207705_100222704 272
22 3300005327 Ga0070658_10035121 Ga0070658_100351211 273
23 3300005339 Ga0070660_100008086 Ga0070660_1000080864 273
24 3300005366 Ga0070659_100140711 Ga0070659_1001407111 273
25 3300005458 Ga0070681_10423923 Ga0070681_104239231 273
26 3300005530 Ga0070679_100006452 Ga0070679_1000064526 273
27 3300005530 Ga0070679_100068169 Ga0070679_1000681692 273
28 3300005530 Ga0070679_100225680 Ga0070679_1002256801 273
29 3300005563 Ga0068855_100451407 Ga0068855_1004514072 273
30 3300005577 Ga0068857_100051832 Ga0068857_1000518321 273
31 3300005616 Ga0068852_100188229 Ga0068852_1001882292 273
32 3300013100 Ga0157373_10010949 Ga0157373_100109493 273
33 3300013100 Ga0157373_10144141 Ga0157373_101441412 273
34 3300013102 Ga0157371_10029538 Ga0157371_100295382 273
35 3300013102 Ga0157371_10062993 Ga0157371_100629933 273
36 3300013105 Ga0157369_10035272 Ga0157369_100352727 273
37 3300013307 Ga0157372_10581736 Ga0157372_105817361 273
38 3300025909 Ga0207705_10155679 Ga0207705_101556793 273
39 3300025912 Ga0207707_10237111 Ga0207707_102371111 273
40 3300025917 Ga0207660_10128766 Ga0207660_101287663 273
41 3300025919 Ga0207657_10030117 Ga0207657_100301173 273
42 3300025919 Ga0207657_10058846 Ga0207657_100588462 273
43 3300025921 Ga0207652_10051344 Ga0207652_100513442 273
44 3300025921 Ga0207652_10057158 Ga0207652_100571582 273
45 3300025921 Ga0207652_10205525 Ga0207652_102055251 273
46 3300025949 Ga0207667_10415456 Ga0207667_104154562 273
47 3300025949 Ga0207667_10451868 Ga0207667_104518682 273
48 3300026116 Ga0207674_10023639 Ga0207674_100236393 273
49 3300031548 Ga0307408_100171204 Ga0307408_1001712042 273
50 3300032002 Ga0307416_100225719 Ga0307416_1002257192 273
51 3300032002 Ga0307416_100917861 Ga0307416_1009178611 273
52 3300047472 Ga0495686_0014410 Ga0495686_0014410_3421_4245 273
53 3300047472 Ga0495686_0030997 Ga0495686_0030997_2261_3085 273
54 3300049571 Ga0501034_0034863 Ga0501034_0034863_1958_2791 273
55 3300049571 Ga0501034_0541341 Ga0501034_0541341_101_937 273
56 3300049586 Ga0501070_0006093 Ga0501070_0006093_2541_3374 273
57 3300049822 Ga0501035_0082892 Ga0501035_0082892_861_1697 273
58 3300003322 rootL2_10154932 rootL2_101549322 274
59 3300005328 Ga0070676_10108264 Ga0070676_101082642 274
60 3300005338 Ga0068868_100197955 Ga0068868_1001979552 274
61 3300005340 Ga0070689_100097608 Ga0070689_1000976082 274
62 3300005343 Ga0070687_100030910 Ga0070687_1000309102 274
63 3300005353 Ga0070669_100178616 Ga0070669_1001786162 274
64 3300005354 Ga0070675_100021347 Ga0070675_1000213474 274
65 3300005364 Ga0070673_100103172 Ga0070673_1001031722 274
66 3300005441 Ga0070700_100034305 Ga0070700_1000343053 274
67 3300005459 Ga0068867_100133066 Ga0068867_1001330662 274
68 3300005459 Ga0068867_100233946 Ga0068867_1002339462 274
69 3300005471 Ga0070698_100001104 Ga0070698_10000110415 274
70 3300005471 Ga0070698_100021687 Ga0070698_1000216875 274
71 3300005539 Ga0068853_100036567 Ga0068853_1000365672 274
72 3300005543 Ga0070672_100029887 Ga0070672_1000298873 274
73 3300005544 Ga0070686_100023593 Ga0070686_1000235933 274
74 3300005563 Ga0068855_100082125 Ga0068855_1000821252 274
75 3300005578 Ga0068854_100176639 Ga0068854_1001766392 274
76 3300005614 Ga0068856_100128503 Ga0068856_1001285032 274
77 3300005615 Ga0070702_100037948 Ga0070702_1000379482 274
78 3300005618 Ga0068864_100011087 Ga0068864_1000110874 274
79 3300005718 Ga0068866_10016583 Ga0068866_100165832 274
80 3300006358 Ga0068871_100406021 Ga0068871_1004060212 274
81 3300006844 Ga0075428_100004225 Ga0075428_10000422510 274
82 3300006846 Ga0075430_100138875 Ga0075430_1001388752 274
83 3300006847 Ga0075431_100228046 Ga0075431_1002280462 274
84 3300006880 Ga0075429_100000723 Ga0075429_10000072319 274
85 3300009093 Ga0105240_10325931 Ga0105240_103259312 274
86 3300009093 Ga0105240_10961278 Ga0105240_109612781 274
87 3300009148 Ga0105243_10258725 Ga0105243_102587252 274
88 3300009148 Ga0105243_10361954 Ga0105243_103619542 274
89 3300009176 Ga0105242_10132938 Ga0105242_101329381 274
90 3300009545 Ga0105237_10185508 Ga0105237_101855082 274
91 3300013100 Ga0157373_10042751 Ga0157373_100427511 274
92 3300013102 Ga0157371_10000548 Ga0157371_1000054848 274
93 3300013102 Ga0157371_10027156 Ga0157371_100271564 274
94 3300013104 Ga0157370_10173171 Ga0157370_101731712 274
95 3300013105 Ga0157369_10116058 Ga0157369_101160582 274
96 3300013297 Ga0157378_10019019 Ga0157378_100190192 274
97 3300013307 Ga0157372_10097596 Ga0157372_100975963 274
98 3300013307 Ga0157372_10101648 Ga0157372_101016482 274
99 3300013307 Ga0157372_10587703 Ga0157372_105877032 274
100 3300014325 Ga0163163_10508884 Ga0163163_105088841 274
101 3300014745 Ga0157377_10041835 Ga0157377_100418352 274
102 3300025907 Ga0207645_10050048 Ga0207645_100500483 274
103 3300025913 Ga0207695_10239589 Ga0207695_102395892 274
104 3300025918 Ga0207662_10059882 Ga0207662_100598822 274
105 3300025926 Ga0207659_10068918 Ga0207659_100689181 274
106 3300025936 Ga0207670_10228909 Ga0207670_102289092 274
107 3300025937 Ga0207669_10015750 Ga0207669_100157503 274
108 3300025940 Ga0207691_10003985 Ga0207691_100039853 274
109 3300025940 Ga0207691_10035749 Ga0207691_100357493 274
110 3300025945 Ga0207679_10057959 Ga0207679_100579592 274
111 3300025960 Ga0207651_10053544 Ga0207651_100535442 274
112 3300025960 Ga0207651_10151767 Ga0207651_101517671 274
113 3300025972 Ga0207668_10365645 Ga0207668_103656452 274
114 3300025981 Ga0207640_10349832 Ga0207640_103498321 274
115 3300026041 Ga0207639_10027886 Ga0207639_100278863 274
116 3300026041 Ga0207639_10537977 Ga0207639_105379771 274
117 3300026075 Ga0207708_10065580 Ga0207708_100655802 274
118 3300026088 Ga0207641_10068213 Ga0207641_100682132 274
119 3300026089 Ga0207648_10003423 Ga0207648_1000342315 274
120 3300026089 Ga0207648_10087124 Ga0207648_100871242 274
121 3300026089 Ga0207648_10109139 Ga0207648_101091391 274
122 3300026116 Ga0207674_10334838 Ga0207674_103348382 274
123 3300026118 Ga0207675_100087912 Ga0207675_1000879122 274
124 3300027471 Ga0209995_1002454 Ga0209995_10024542 274
125 3300031251 Ga0265327_10000193 Ga0265327_10000193108 274
126 3300032133 Ga0316583_10004893 Ga0316583_100048933 274
127 3300041512 Ga0451853_1468156 Ga0451853_1468156_11_847 274
128 3300042156 Ga0439446_0077117 Ga0439446_0077117_104_931 274
129 3300045051 Ga0451576_0013620 Ga0451576_0013620_5211_6038 274
130 3300045051 Ga0451576_0121003 Ga0451576_0121003_901_1728 274
131 3300045051 Ga0451576_0178061 Ga0451576_0178061_1377_2204 274
132 3300046460 Ga0495638_0106181 Ga0495638_0106181_782_1615 274
133 3300047320 Ga0495672_0009330 Ga0495672_0009330_5253_6080 274
134 3300047320 Ga0495672_0037863 Ga0495672_0037863_1572_2399 274
135 3300049571 Ga0501034_0051595 Ga0501034_0051595_3045_3881 274
136 3300049742 Ga0501080_0067814 Ga0501080_0067814_276_1112 274
137 3300050508 nmdc:mga09592_81133_c1 nmdc:mga09592_81133_c1_1790_2617 274
138 3300050509 nmdc:mga0qj67_145430_c1 nmdc:mga0qj67_145430_c1_47_874 274
139 3300050510 nmdc:mga06r32_138104_c1 nmdc:mga06r32_138104_c1_213_1040 274
140 3300053139 Ga0500568_0000880 Ga0500568_0000880_6179_7054 274
141 3300053727 Ga0500611_000033 Ga0500611_000033_64071_64907 274
142 3300053727 Ga0500611_000048 Ga0500611_000048_36748_37581 274
143 3300002459 JGI24751J29686_10004047 JGI24751J29686_100040473 275
144 3300002459 JGI24751J29686_10013904 JGI24751J29686_100139042 275
145 3300005289 Ga0065704_10147617 Ga0065704_101476172 275
146 3300005290 Ga0065712_10006000 Ga0065712_100060002 275
147 3300005295 Ga0065707_10108386 Ga0065707_101083862 275
148 3300005329 Ga0070683_100499949 Ga0070683_1004999492 275
149 3300005331 Ga0070670_100025909 Ga0070670_1000259092 275
150 3300005337 Ga0070682_100102545 Ga0070682_1001025452 275
151 3300005340 Ga0070689_100002994 Ga0070689_1000029948 275
152 3300005340 Ga0070689_100031165 Ga0070689_1000311654 275
153 3300005343 Ga0070687_100005612 Ga0070687_1000056121 275
154 3300005364 Ga0070673_100254647 Ga0070673_1002546471 275
155 3300005365 Ga0070688_100008502 Ga0070688_1000085022 275
156 3300005365 Ga0070688_100097912 Ga0070688_1000979122 275
157 3300005367 Ga0070667_100028545 Ga0070667_1000285453 275
158 3300005441 Ga0070700_100023820 Ga0070700_1000238203 275
159 3300005441 Ga0070700_100178586 Ga0070700_1001785862 275
160 3300005466 Ga0070685_10002599 Ga0070685_100025997 275
161 3300005471 Ga0070698_100012395 Ga0070698_1000123955 275
162 3300005535 Ga0070684_100095085 Ga0070684_1000950852 275
163 3300005535 Ga0070684_100303858 Ga0070684_1003038582 275
164 3300005564 Ga0070664_100160860 Ga0070664_1001608601 275
165 3300005564 Ga0070664_100280458 Ga0070664_1002804582 275
166 3300005577 Ga0068857_100010725 Ga0068857_1000107254 275
167 3300005616 Ga0068852_100108753 Ga0068852_1001087533 275
168 3300005617 Ga0068859_100002811 Ga0068859_1000028114 275
169 3300005617 Ga0068859_100039363 Ga0068859_1000393634 275
170 3300005617 Ga0068859_100171569 Ga0068859_1001715692 275
171 3300005617 Ga0068859_100356091 Ga0068859_1003560912 275
172 3300005617 Ga0068859_100456721 Ga0068859_1004567212 275
173 3300005719 Ga0068861_100010592 Ga0068861_1000105925 275
174 3300005840 Ga0068870_10088050 Ga0068870_100880502 275
175 3300005840 Ga0068870_10119311 Ga0068870_101193112 275
176 3300005841 Ga0068863_100099482 Ga0068863_1000994822 275
177 3300005841 Ga0068863_100261419 Ga0068863_1002614192 275
178 3300005841 Ga0068863_100349416 Ga0068863_1003494161 275
179 3300005843 Ga0068860_100006421 Ga0068860_1000064214 275
180 3300005843 Ga0068860_100184873 Ga0068860_1001848732 275
181 3300006358 Ga0068871_100085659 Ga0068871_1000856592 275
182 3300006844 Ga0075428_100104274 Ga0075428_1001042742 275
183 3300006844 Ga0075428_100196831 Ga0075428_1001968312 275
184 3300006931 Ga0097620_100002810 Ga0097620_1000028104 275
185 3300006931 Ga0097620_100039364 Ga0097620_1000393644 275
186 3300006931 Ga0097620_100171570 Ga0097620_1001715702 275
187 3300006931 Ga0097620_100356088 Ga0097620_1003560882 275
188 3300006931 Ga0097620_100456761 Ga0097620_1004567612 275
189 3300009093 Ga0105240_10396875 Ga0105240_103968752 275
190 3300009094 Ga0111539_10303803 Ga0111539_103038031 275
191 3300009094 Ga0111539_10314367 Ga0111539_103143672 275
192 3300009176 Ga0105242_10005404 Ga0105242_100054042 275
193 3300009176 Ga0105242_10099053 Ga0105242_100990532 275
194 3300009176 Ga0105242_10517243 Ga0105242_105172432 275
195 3300009176 Ga0105242_10747819 Ga0105242_107478191 275
196 3300009553 Ga0105249_10006282 Ga0105249_100062827 275
197 3300009553 Ga0105249_10023039 Ga0105249_100230392 275
198 3300009553 Ga0105249_10034405 Ga0105249_100344054 275
199 3300009553 Ga0105249_10346510 Ga0105249_103465102 275
200 3300013102 Ga0157371_10009574 Ga0157371_100095746 275
201 3300013102 Ga0157371_10013223 Ga0157371_100132233 275
202 3300013102 Ga0157371_10212119 Ga0157371_102121192 275
203 3300013296 Ga0157374_10104708 Ga0157374_101047082 275
204 3300013297 Ga0157378_10161056 Ga0157378_101610562 275
205 3300013297 Ga0157378_10232876 Ga0157378_102328762 275
206 3300013306 Ga0163162_10128188 Ga0163162_101281882 275
207 3300013307 Ga0157372_10003393 Ga0157372_100033932 275
208 3300013308 Ga0157375_10038654 Ga0157375_100386544 275
209 3300013308 Ga0157375_10999661 Ga0157375_109996612 275
210 3300014325 Ga0163163_10032548 Ga0163163_100325482 275
211 3300014326 Ga0157380_10323417 Ga0157380_103234171 275
212 3300014969 Ga0157376_10001877 Ga0157376_100018772 275
213 3300014969 Ga0157376_10308969 Ga0157376_103089692 275
214 3300025908 Ga0207643_10006914 Ga0207643_100069142 275
215 3300025913 Ga0207695_10285192 Ga0207695_102851922 275
216 3300025918 Ga0207662_10054675 Ga0207662_100546752 275
217 3300025918 Ga0207662_10218685 Ga0207662_102186852 275
218 3300025923 Ga0207681_10144738 Ga0207681_101447382 275
219 3300025925 Ga0207650_10458572 Ga0207650_104585721 275
220 3300025926 Ga0207659_10333761 Ga0207659_103337612 275
221 3300025934 Ga0207686_10000937 Ga0207686_100009379 275
222 3300025936 Ga0207670_10019549 Ga0207670_100195494 275
223 3300025937 Ga0207669_10333950 Ga0207669_103339501 275
224 3300025938 Ga0207704_10322927 Ga0207704_103229272 275
225 3300025940 Ga0207691_10159229 Ga0207691_101592291 275
226 3300025942 Ga0207689_10019904 Ga0207689_100199042 275
227 3300025944 Ga0207661_10248429 Ga0207661_102484292 275
228 3300025945 Ga0207679_10098992 Ga0207679_100989922 275
229 3300025960 Ga0207651_10099221 Ga0207651_100992212 275
230 3300025961 Ga0207712_10001478 Ga0207712_100014785 275
231 3300025961 Ga0207712_10042565 Ga0207712_100425653 275
232 3300025986 Ga0207658_10033047 Ga0207658_100330472 275
233 3300025986 Ga0207658_10064831 Ga0207658_100648313 275
234 3300026023 Ga0207677_10075645 Ga0207677_100756452 275
235 3300026075 Ga0207708_10003347 Ga0207708_100033474 275
236 3300026075 Ga0207708_10087066 Ga0207708_100870662 275
237 3300026088 Ga0207641_10000111 Ga0207641_100001114 275
238 3300026088 Ga0207641_10034216 Ga0207641_100342163 275
239 3300026088 Ga0207641_10104031 Ga0207641_101040312 275
240 3300026088 Ga0207641_10466514 Ga0207641_104665142 275
241 3300026089 Ga0207648_10042607 Ga0207648_100426073 275
242 3300026089 Ga0207648_10044820 Ga0207648_100448203 275
243 3300026116 Ga0207674_10020230 Ga0207674_100202305 275
244 3300026116 Ga0207674_10223373 Ga0207674_102233732 275
245 3300026118 Ga0207675_100018475 Ga0207675_1000184754 275
246 3300026121 Ga0207683_10182050 Ga0207683_101820502 275
247 3300026142 Ga0207698_10465737 Ga0207698_104657371 275
248 3300028380 Ga0268265_10484124 Ga0268265_104841242 275
249 3300028381 Ga0268264_10001248 Ga0268264_100012488 275
250 3300028794 Ga0307515_10000001 Ga0307515_100000011764 275
251 3300031251 Ga0265327_10000159 Ga0265327_1000015956 275
252 3300041459 Ga0451800_0091743 Ga0451800_0091743_99_929 275
253 3300041486 Ga0451807_2226376 Ga0451807_2226376_920_1750 275
254 3300042125 Ga0450923_020821 Ga0450923_020821_370_1200 275
255 3300046499 Ga0495594_0210809 Ga0495594_0210809_89_919 275
256 3300046539 Ga0495621_0055689 Ga0495621_0055689_133_963 275
257 3300049579 Ga0501043_0020705 Ga0501043_0020705_4034_4864 275
258 3300050511 nmdc:mga08y16_418557_c1 nmdc:mga08y16_418557_c1_24_854 275

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01557

FAA_hydrolase

Fumarylacetoacetate (FAA) hydrolase family

109

310

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
3bqb-assembly1.cif.gz_X hexagonal kristal form of 2-keto-3-deoxyarabinonate dehydratase 0.8588 1 275
3bqb-assembly1.cif.gz_X hexagonal kristal form of 2-keto-3-deoxyarabinonate dehydratase 0.8558 1 275
2q1d-assembly1.cif.gz_X 2-keto-3-deoxy-d-arabinonate dehydratase complexed with magnesium and 2,5-dioxopentanoate 0.8447 1 275
2q1d-assembly1.cif.gz_X 2-keto-3-deoxy-d-arabinonate dehydratase complexed with magnesium and 2,5-dioxopentanoate 0.8417 1 275
3bqb-assembly1.cif.gz_A hexagonal kristal form of 2-keto-3-deoxyarabinonate dehydratase 0.8327 1 274
ID Description Score Start End Superfamily
2q18X02 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.9245 62 275 3.90.850.10
2q18X02 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.8992 62 275 3.90.850.10
4dbfB02 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.8372 62 274 3.90.850.10
4dbfB02 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.8176 62 274 3.90.850.10
1wzoC02 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.8149 62 275 3.90.850.10
ID Description Score Start End GO Terms
AF-A0A349BVW8-F1-model_v4 Fumarylacetoacetase-like C-terminal domain-containing protein 0.9877 193 275 GO:0003824
AF-A0A537IWT0-F1-model_v4 2-hydroxyhepta-2,4-diene-1,7-dioate isomerase 0.9842 163 275 GO:0016853
GO:0044281
AF-A0A3B9G7U1-F1-model_v4 2-hydroxyhepta-2,4-diene-1,7-dioate isomerase 0.9791 97 275 GO:0016853
GO:0044281
AF-A0A3L7WW04-F1-model_v4 Fumarylacetoacetase-like C-terminal domain-containing protein 0.9784 194 274 GO:0003824
AF-A0A537JWX1-F1-model_v4 2-hydroxyhepta-2,4-diene-1,7-dioate isomerase 0.977 141 274 GO:0016853
GO:0044281

Feature Viewer

pLDDT pTM Quality
87.32 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map